Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30027574
Length (bp)2242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30027574) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30027574) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30027574h1SMcG0000443 dd_Smed_v4_25001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30027574h1SMcG0000443 dd_Smed_v4_25001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30027574h1SMcG0000443 dd_Smed_v4_25001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027574h1SMcG0000443 dd_Smed_v4_25001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027574h1SMcG0000443 Contig40357uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027574h1SMcG0000443 Contig40357newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: STK38 (serine/threonine kinase 38 [Source:HGNC Symbol;Acc:HGNC:17847])

HSP 1 Score: 82.4185 bits (202), Expect = 7.122e-16
Identity = 80/302 (26.49%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEE----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: LATS2 (large tumor suppressor kinase 2 [Source:HGNC Symbol;Acc:HGNC:6515])

HSP 1 Score: 83.5741 bits (205), Expect = 9.821e-16
Identity = 79/282 (28.01%), Postives = 121/282 (42.91%), Query Frame = 2
Query:  659 IQMDIVP--IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKSTTG----------DSIISYECKNCFTELPETILLPDPFDTRRRNYNNR---HSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPL-FKPIVSDPDLCFNLIPMDNDDIIYDV 1432
            I+M++ P  +  F++AEL +AI  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y   S             D + +  C +    L          + R R  + R   HS      G   Y APE+        YT  CD+WS G + F ML    PF     A    +  L   +  N   I  +    P A+ L+ + LC     RL  N  ++    +   FF ++DF + +  +P  + P +S P    N  P+D +    D 
Sbjct:  758 IRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSDLWDDVSNCRCGDRLKTL----------EQRARKQHQRCLAHSL----VGTPNYIAPEV---LLRKGYTQLCDWWSVGVILFEMLVGQPPF----LAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITK-LCCSADHRLGRNGADDL---KAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDA 1014          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: STK38L (serine/threonine kinase 38 like [Source:HGNC Symbol;Acc:HGNC:17848])

HSP 1 Score: 78.9518 bits (193), Expect = 1.055e-14
Identity = 77/304 (25.33%), Postives = 127/304 (41.78%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + S      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ +T +                         F+++E ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKS------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLTEEE----------------------TQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: LATS1 (large tumor suppressor kinase 1 [Source:HGNC Symbol;Acc:HGNC:6514])

HSP 1 Score: 79.337 bits (194), Expect = 1.728e-14
Identity = 79/269 (29.37%), Postives = 125/269 (46.47%), Query Frame = 2
Query:  659 IQMDIVP--IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKSTTGDSIISYECKNCFTELPETILLPD---PFDTRRRNYNNR---HSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPL-FKPIVSDPDLCFNLIPMDND 1414
            I+M I P  +  F++AEL  A+  +H+ G +HRDI+PDNI++   GH+KLTD GL        +++ Y  +S       S +  N + + P +    D   P + R    + R   HS      G   Y APE+        YT  CD+WS G + F ML    PF +    +E    ++  ++ L+   I  +    P A  L+++ LC  P  RL  N  +     +   FFK++DF + L  +   + P ++ P    N  P+D D
Sbjct:  795 IRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYY--QSGDHPRQDSMDFSNEWGD-PSSCRCGDRLKPLERRAARQHQRCLAHSL----VGTPNYIAPEV---LLRTGYTQLCDWWSVGVILFEMLVGQPPF-LAQTPLETQMKVINWQTSLH---IPPQAKLSPEASDLIIK-LCRGPEDRLGKNGADEI---KAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPD 1045          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: LATS1 (large tumor suppressor kinase 1 [Source:HGNC Symbol;Acc:HGNC:6514])

HSP 1 Score: 79.337 bits (194), Expect = 1.728e-14
Identity = 79/269 (29.37%), Postives = 125/269 (46.47%), Query Frame = 2
Query:  659 IQMDIVP--IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKSTTGDSIISYECKNCFTELPETILLPD---PFDTRRRNYNNR---HSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPL-FKPIVSDPDLCFNLIPMDND 1414
            I+M I P  +  F++AEL  A+  +H+ G +HRDI+PDNI++   GH+KLTD GL        +++ Y  +S       S +  N + + P +    D   P + R    + R   HS      G   Y APE+        YT  CD+WS G + F ML    PF +    +E    ++  ++ L+   I  +    P A  L+++ LC  P  RL  N  +     +   FFK++DF + L  +   + P ++ P    N  P+D D
Sbjct:  795 IRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYY--QSGDHPRQDSMDFSNEWGD-PSSCRCGDRLKPLERRAARQHQRCLAHSL----VGTPNYIAPEV---LLRTGYTQLCDWWSVGVILFEMLVGQPPF-LAQTPLETQMKVINWQTSLH---IPPQAKLSPEASDLIIK-LCRGPEDRLGKNGADEI---KAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPD 1045          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: sax-1 (Serine/threonine-protein kinase sax-1 [Source:UniProtKB/Swiss-Prot;Acc:Q2L6W9])

HSP 1 Score: 89.3521 bits (220), Expect = 1.720e-18
Identity = 50/146 (34.25%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETI---LLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE  +AI+FIH  G +HRDI+PDN+++  RGH+KL+D GL          TG  +  +   + +   P T+    +  PF+++R+      NR +Y +   G   Y APE+        YT  CD+WS G + + ML    PF
Sbjct:  189 FYIAEAALAIQFIHSLGFIHRDIKPDNLLLDARGHVKLSDFGL---------CTG--LKKFHRTDHYRNWPSTLPPDFISKPFESKRKAETWKRNRRAYAYSTVGTPDYIAPEVFQPNG---YTKSCDWWSLGVIMYEMLIGYPPF 320          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: sax-1 (Serine/threonine-protein kinase sax-1 [Source:UniProtKB/Swiss-Prot;Acc:Q2L6W9])

HSP 1 Score: 89.3521 bits (220), Expect = 1.859e-18
Identity = 50/143 (34.97%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE  +AI+FIH  G +HRDI+PDN+++  RGH+KL+D GL   +     T          +N  + LP    +  PF+++R+      NR +Y +   G   Y APE+        YT  CD+WS G + + ML    PF
Sbjct:  189 FYIAEAALAIQFIHSLGFIHRDIKPDNLLLDARGHVKLSDFGLCTGLKKFHRTD-------HYRNWPSTLPPD-FISKPFESKRKAETWKRNRRAYAYSTVGTPDYIAPEVFQPNG---YTKSCDWWSLGVIMYEMLIGYPPF 320          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: wts-1 (Serine/threonine-protein kinase WARTS homolog [Source:UniProtKB/Swiss-Prot;Acc:O45797])

HSP 1 Score: 72.7886 bits (177), Expect = 7.347e-13
Identity = 42/144 (29.17%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  680 IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEI-YTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            +  F++AEL  AI ++H  G +HRD++PDNI++ + GH+KLTD GL   + +T           +   + F+  PE   +             R        G   Y APE+ +      +   CD+WS G + + M+F   PF
Sbjct:  601 LARFYIAELACAIEYVHNVGFIHRDLKPDNILIDQHGHIKLTDFGLCTGLRWTHDRRYYGPENDHHRVDSFSLPPEVAAIDKSVKVLNVRQQTRRITAHSLVGTGNYMAPEVIAKTG---HNQSCDWWSTGVILYEMVFGRVPF 741          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 64.6994 bits (156), Expect = 1.613e-10
Identity = 64/247 (25.91%), Postives = 99/247 (40.08%), Query Frame = 2
Query:  683 ITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNF-GAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTW-----LPETLE------FFKSVDFKNLLNME--PLFKPIVSDPD 1381
            + F++AEL +A+  +H  GI++RD++P+NI++   GH+K+TD GL+ E                                  D+ ++ Y         +F G V Y APE+ +      ++   D+WS G + F ML    PF                    N T+ +     +  AK  +   L  E    L   F  N+       P+ +E      FF  +DF  LLN E  P FKP +S  D
Sbjct:  149 VKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKE--------------------------------AIDSEKKTY---------SFCGTVEYMAPEVINRRG---HSMAADFWSLGVLMFEMLTGHLPFQ---------------GRDRNDTMTQ-----ILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALSTVD 331          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 64.6994 bits (156), Expect = 1.720e-10
Identity = 64/247 (25.91%), Postives = 99/247 (40.08%), Query Frame = 2
Query:  683 ITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNF-GAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTW-----LPETLE------FFKSVDFKNLLNME--PLFKPIVSDPD 1381
            + F++AEL +A+  +H  GI++RD++P+NI++   GH+K+TD GL+ E                                  D+ ++ Y         +F G V Y APE+ +      ++   D+WS G + F ML    PF                    N T+ +     +  AK  +   L  E    L   F  N+       P+ +E      FF  +DF  LLN E  P FKP +S  D
Sbjct:  167 VKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKE--------------------------------AIDSEKKTY---------SFCGTVEYMAPEVINRRG---HSMAADFWSLGVLMFEMLTGHLPFQ---------------GRDRNDTMTQ-----ILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALSTVD 349          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: wts (gene:FBgn0011739 transcript:FBtr0085720)

HSP 1 Score: 87.4261 bits (215), Expect = 3.051e-17
Identity = 72/266 (27.07%), Postives = 115/266 (43.23%), Query Frame = 2
Query:  680 IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKS--TTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNR---HSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQL------LLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDI 1420
            +  F++AE+  A+  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y      +  DS+  +E      E  E    P   + RR   + R   HS      G   Y APE+   +    YT  CDYWS G + + ML    PF           L  +        I   +  ++P   +L      L+  LC    +RL  +  E     ++ +FFK +DF ++   +  + P +  P    N  P+D + +
Sbjct:  819 LARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWE------EYSENGPKPTVLERRRMRDHQRVLAHSL----VGTPNYIAPEVLERSG---YTQLCDYWSVGVILYEMLVGQPPF-----------LANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEV----KSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKL 1056          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: trc (gene:FBgn0003744 transcript:FBtr0332154)

HSP 1 Score: 78.5666 bits (192), Expect = 6.007e-15
Identity = 50/148 (33.78%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYN---NRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYD 1123
            F+++E  +AI  IH+ G +HRDI+PDN+++  RGHLKL+D GL   +     T     +S    + F     + L   P D++RR  +   NR +  +   G   Y APE+        Y   CD+WS G + + ML    PF  C D
Sbjct:  195 FYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCAS-LSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVFLQTG---YGPACDWWSLGVIMYEMLMGYPPF--CSD 336          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: trc (gene:FBgn0003744 transcript:FBtr0074922)

HSP 1 Score: 78.1814 bits (191), Expect = 7.557e-15
Identity = 49/148 (33.11%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYN---NRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYD 1123
            F+++E  +AI  IH+ G +HRDI+PDN+++  RGHLKL+D GL   +     T     +S    + F           P D++RR  +   NR +  +   G   Y APE+        Y   CD+WS G + + ML    PF  C D
Sbjct:  195 FYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIG-----TCASPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVFLQTG---YGPACDWWSLGVIMYEMLMGYPPF--CSD 332          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: gek (gene:FBgn0023081 transcript:FBtr0072287)

HSP 1 Score: 71.2478 bits (173), Expect = 2.605e-12
Identity = 68/280 (24.29%), Postives = 114/280 (40.71%), Query Frame = 2
Query:  626 LLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAE--YTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPS-----------AKQLLLEVLCVEPVRRLDDN----FHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDND 1414
            LLT  ++F + +  D+     F++ E+++AI  IHQ   +HRDI+PDN+++ +RGH++L D G                              + L  D   T + N            G   Y +PE+  +    +  Y ++CD+WS G   + ML+   PF              +        +  + C+N+PS           ++ LL +++C+ P  RL  N    F ++ W       F  +D+KN+      + P VS P    N    DND
Sbjct:  185 LLTLLSKFEDKLPEDMAK---FYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGHVRLADFG------------------------------SCLRLDKDGTVQSNV---------AVGTPDYISPEILRAMEDGKGRYGTECDWWSLGVCMYEMLYGETPF-----------YAESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLICI-PENRLGQNGIQDFMDHPW-------FVGIDWKNIRQGPAPYVPEVSSPTDTSNFDVDDND 403          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: dop (gene:FBgn0267390 transcript:FBtr0075562)

HSP 1 Score: 69.707 bits (169), Expect = 8.999e-12
Identity = 46/153 (30.07%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  650 IEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            I P+  D+     F+ AE ++A+ ++H  GI+HRD++PDN+++T  GH+KLTD GL        S  G   ++       T L E  +     D+  R ++++  Y     G   Y APE+        Y    D+WS G + +  L    PF
Sbjct:  927 IGPLPADMA---RFYFAETVLAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGL--------SKMGLMSLA-------TNLYEGYI-----DSETRQFSDKQVY-----GTPEYIAPEV---ILRQGYGKPVDWWSMGIILYEFLIGCVPF 1048          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk38a (serine/threonine kinase 38a [Source:ZFIN;Acc:ZDB-GENE-040426-2811])

HSP 1 Score: 85.1149 bits (209), Expect = 6.411e-17
Identity = 87/336 (25.89%), Postives = 132/336 (39.29%), Query Frame = 2
Query:  164 ISRQKLVKIHDPHSLN------------------LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            + +QKL K+ D   L                   L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF    + + +I E   G  +                       +T+  +   LT  A               F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   43 MRQQKLEKVMDQEGLADEEKRLRRSEHARKETEFLRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILR------KADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKMNLYLIMEFLPGGDM-----------------------MTLLMKKDTLTEEA-------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQNG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk38a (serine/threonine kinase 38a [Source:ZFIN;Acc:ZDB-GENE-040426-2811])

HSP 1 Score: 85.1149 bits (209), Expect = 6.411e-17
Identity = 87/336 (25.89%), Postives = 132/336 (39.29%), Query Frame = 2
Query:  164 ISRQKLVKIHDPHSLN------------------LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            + +QKL K+ D   L                   L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF    + + +I E   G  +                       +T+  +   LT  A               F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   43 MRQQKLEKVMDQEGLADEEKRLRRSEHARKETEFLRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILR------KADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKMNLYLIMEFLPGGDM-----------------------MTLLMKKDTLTEEA-------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQNG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 82.0333 bits (201), Expect = 6.866e-16
Identity = 78/304 (25.66%), Postives = 128/304 (42.11%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ ++ +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLSEEA----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 82.0333 bits (201), Expect = 6.866e-16
Identity = 78/304 (25.66%), Postives = 128/304 (42.11%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ ++ +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLSEEA----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 81.6481 bits (200), Expect = 7.881e-16
Identity = 78/304 (25.66%), Postives = 128/304 (42.11%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ ++ +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLSEEA----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: stk38l (serine/threonine kinase 38 like [Source:NCBI gene;Acc:448427])

HSP 1 Score: 82.0333 bits (201), Expect = 7.331e-16
Identity = 78/304 (25.66%), Postives = 128/304 (42.11%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ +T +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   26 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLTEEA----------------------TQFYIAETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 271          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: stk38l (serine/threonine kinase 38 like [Source:NCBI gene;Acc:448427])

HSP 1 Score: 82.0333 bits (201), Expect = 7.735e-16
Identity = 78/304 (25.66%), Postives = 128/304 (42.11%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ +T +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   74 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLTEEA----------------------TQFYIAETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 319          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: ENSXETT00000029007.1 (serine/threonine kinase 38 [Source:NCBI gene;Acc:100379821])

HSP 1 Score: 81.6481 bits (200), Expect = 1.125e-15
Identity = 79/302 (26.16%), Postives = 122/302 (40.40%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF    + + +I E   G  +                       +T+  +   LT                  F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   74 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILR------KTDMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPGGDM-----------------------MTLLMKKDTLTEEE-------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTDF-------YRNLNHSLPSDFNFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFLQTG---YNKLCDWWSLGVIMYEMLIGYPPF 319          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: ENSXETT00000012893.1 (serine/threonine kinase 38 [Source:NCBI gene;Acc:100379821])

HSP 1 Score: 81.6481 bits (200), Expect = 1.212e-15
Identity = 80/302 (26.49%), Postives = 124/302 (41.06%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRK------TDMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEE----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTDF-------YRNLNHSLPSDFNFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFLQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: ENSXETT00000029036.1 (serine/threonine kinase 38 [Source:NCBI gene;Acc:100379821])

HSP 1 Score: 81.2629 bits (199), Expect = 1.557e-15
Identity = 80/302 (26.49%), Postives = 124/302 (41.06%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILR------KTDMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEE----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTDF-------YRNLNHSLPSDFNFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFLQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk38 (serine/threonine kinase 38 [Source:MGI Symbol;Acc:MGI:2442572])

HSP 1 Score: 82.4185 bits (202), Expect = 5.249e-16
Identity = 80/302 (26.49%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEETQ----------------------FYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk38 (serine/threonine kinase 38 [Source:MGI Symbol;Acc:MGI:2442572])

HSP 1 Score: 82.4185 bits (202), Expect = 5.249e-16
Identity = 80/302 (26.49%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEETQ----------------------FYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk38 (serine/threonine kinase 38 [Source:MGI Symbol;Acc:MGI:2442572])

HSP 1 Score: 82.4185 bits (202), Expect = 5.249e-16
Identity = 80/302 (26.49%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEETQ----------------------FYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk38 (serine/threonine kinase 38 [Source:MGI Symbol;Acc:MGI:2442572])

HSP 1 Score: 77.0258 bits (188), Expect = 4.061e-15
Identity = 46/142 (32.39%), Postives = 66/142 (46.48%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   20 FYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 151          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Stk38l (serine/threonine kinase 38 like [Source:MGI Symbol;Acc:MGI:1922250])

HSP 1 Score: 78.5666 bits (192), Expect = 1.027e-14
Identity = 75/304 (24.67%), Postives = 127/304 (41.78%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ +T +                         F+++E ++AI  IHQ G +HRD++PDN+++  +GH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLTEEETQ----------------------FYISETVLAIDAIHQLGFIHRDVKPDNLLLDAKGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGFPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q54IH8|NDRB_DICDI (Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum OX=44689 GN=ndrB PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.974e-21
Identity = 79/276 (28.62%), Postives = 127/276 (46.01%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSII-SYECKNCFTELPETILLPDP-FDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIE--RRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDIIYDVLRDHHDSLLLPFTTPPINAYSHNK 1504
            F++AE ++A+  IH+   +HRDI+PDN+++ ++GH+K++D GL   + T +  T   I   YE  N   E  +T       FD+ +R    R    + N G   Y+APE+        Y+++CD+WS G + F ML    PF  C ++I E    +       P I+E  +   N+    Q L+E    +P+ R+  N  E     ++  FFK VD++ L    P   P +S P    N               DH++    P    P+ + S  K
Sbjct:  237 FYIAETVLALHSIHKLSYIHRDIKPDNLLIDQKGHIKVSDFGLCTGLQTNRVPTLAEIYKKYEGDNNIREEDQTPQSRSARFDSWKR---QRRVLAYSNVGTPDYTAPEVLMKDG---YSAECDWWSVGVIMFEMLVGYPPF--CSESIRETYHKIMNWKQTLPKIMEEAKAEVNLSPEAQDLIERFLTDPMTRIGFNGVEEI---QSHPFFKGVDWRRLRETRPPIIPQLSSPTDTSNF--------------DHYEEEQQPEPMQPVQSKSRRK 487          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q2L6W9|SAX1_CAEEL (Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans OX=6239 GN=sax-1 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.189e-17
Identity = 50/146 (34.25%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETI---LLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE  +AI+FIH  G +HRDI+PDN+++  RGH+KL+D GL          TG  +  +   + +   P T+    +  PF+++R+      NR +Y +   G   Y APE+        YT  CD+WS G + + ML    PF
Sbjct:  189 FYIAEAALAIQFIHSLGFIHRDIKPDNLLLDARGHVKLSDFGL---------CTG--LKKFHRTDHYRNWPSTLPPDFISKPFESKRKAETWKRNRRAYAYSTVGTPDYIAPEVFQPNG---YTKSCDWWSLGVIMYEMLIGYPPF 320          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|A8XJL7|SAX1_CAEBR (Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae OX=6238 GN=sax-1 PE=3 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 4.361e-17
Identity = 50/143 (34.97%), Postives = 74/143 (51.75%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE  +AI+FIH  G +HRDI+PDN+++  RGH+KL+D GL   +     T          +N    LP    +  PF+++R+      NR +Y +   G   Y APE+        YT  CD+WS G + + ML    PF
Sbjct:  189 FYVAEAALAIQFIHNLGFIHRDIKPDNLLLDARGHVKLSDFGLCTGLKKFHRTD-------HYRNWPVTLPPD-FISKPFESKRKAETWKRNRRAYAYSTVGTPDYIAPEVFQPNG---YTKSCDWWSLGVIMYEMLIGYPPF 320          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q9VA38|WARTS_DROME (Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.058e-16
Identity = 72/266 (27.07%), Postives = 115/266 (43.23%), Query Frame = 2
Query:  680 IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKS--TTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNR---HSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQL------LLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDI 1420
            +  F++AE+  A+  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y      +  DS+  +E      E  E    P   + RR   + R   HS      G   Y APE+   +    YT  CDYWS G + + ML    PF           L  +        I   +  ++P   +L      L+  LC    +RL  +  E     ++ +FFK +DF ++   +  + P +  P    N  P+D + +
Sbjct:  819 LARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWE------EYSENGPKPTVLERRRMRDHQRVLAHSL----VGTPNYIAPEVLERSG---YTQLCDYWSVGVILYEMLVGQPPF-----------LANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEV----KSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKL 1056          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|A2VDV2|STK38_BOVIN (Serine/threonine-protein kinase 38 OS=Bos taurus OX=9913 GN=STK38 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.994e-15
Identity = 80/302 (26.49%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G            G     L+  K++ +T +                         F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKLNLYLIMEFLPG------------GDMMTLLM--KKDTLTEEE----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: F1A4B8 (Non-specific serine/threonine protein kinase OS=Dictyostelium purpureum OX=5786 GN=DICPUDRAFT_51572 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.046e-18
Identity = 73/247 (29.55%), Postives = 123/247 (49.80%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSII-SYECKNCFTELPETILLPDP-FDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIE--RRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDD 1417
            F++AE ++A+  IH+   +HRDI+PDN+++  +GH+K++D GL   + T +  T   I   YE  N   E  +TI      FD+ +R    R    + N G   Y+APE+        Y+++CD+WS G + F ML    PF  C ++I E    +       P I+E  +   N+ +  Q L+E    +P+ R+  N  E     ++  FF+ VD+KN+ + +    P ++ P    N    D ++
Sbjct:  176 FYIAETVLALHSIHKLSYIHRDIKPDNLLIDSKGHIKVSDFGLCTGLQTNRVPTLAEIYKKYEGDNIRDE--DTISTRSARFDSWKR---QRRVLAYSNVGTPDYTAPEVLMKDG---YSAECDWWSVGVIMFEMLVGYPPF--CSESIRETYHKIMNWKQTLPKIMEEAKAEVNLSAEAQDLIERFLTDPLNRIGFNGVEEI---QSHPFFRGVDWKNIRHGKTPIIPTITSPTDTQNFDHYDEEE 409          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A210PWC1 (Serine/threonine-protein kinase LATS1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06944 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.676e-18
Identity = 81/266 (30.45%), Postives = 125/266 (46.99%), Query Frame = 2
Query:  677 PIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKST--TGDSI-----ISYECKNCFTELPETILLPDPFDTRRRNYNNR---HSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDI 1420
            P+  F++AEL++AI  +H+ G +HRDI+PDNI++ + GH+KLTD GL        N++ Y  +      DS+        ECK C    P       P + RR+ +N+R   HS      G   Y APE+  + + + YT  CD+WS G + + ML    PF   +    +   +       N   I R      +A+ L+L++ C +  R       E    P    FF S++F+ L     LFKP +S P    N  P+D + +
Sbjct:  952 PLAVFYIAELVLAIESVHKMGFIHRDIKPDNILIDKDGHMKLTDFGLCTGFRWTHNSKYYQPQGHHLRQDSMDVNFASEVECK-CGQSQPL-----KPLERRRKRHNHRCLAHSL----VGTPNYIAPEV-LAVSGSGYTKCCDWWSVGVILYEMLVGQPPF---FAPTPQETQMKVIHWSEN-LNIPREANLSRAAEDLILKLCCDQETRLGAKGAAEIKEHP----FFYSLNFEGLRKQTALFKPKISHPTDTSNFDPIDPERV 1198          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: D3B1I2 (Non-specific serine/threonine protein kinase OS=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) OX=670386 GN=ndrB PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.672e-17
Identity = 71/234 (30.34%), Postives = 113/234 (48.29%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSII-SYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNV---PSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDP 1378
            F++AE ++A+  IH+   +HRDI+PDN+++  +GH+K++D GL   + T +  T   I   YE  +   E   ++     FD+ +R    R    + N G   Y+APE+        Y+++CD+WS G + F ML    PF  C +   E    +       P I+E     V   P A Q L+E L  +  RR+  N  E     +   FFK V++K+L    P   P ++ P
Sbjct:  238 FYIAETVLALHSIHKMSYIHRDIKPDNLLIDSKGHIKVSDFGLCTGLQTNRVPTLAEIYKKYESDSLTEEDKTSLGRAARFDSWKR---QRRVLAYSNVGTPDYTAPEVLMQNG---YSAECDWWSVGVIMFEMLVGYPPF--CSETQRETYHKIMNWKYTLPKIMEEAKAEVSLSPEA-QDLIERLLTDSYRRIGANGAEEI---QAHPFFKGVNWKSLRESTPPIVPQLTSP 459          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A1J4JQ96 (Serine/threonine-protein kinase CBK1 OS=Tritrichomonas foetus OX=1144522 GN=CBK1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 7.568e-17
Identity = 53/143 (37.06%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  680 IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            I  +++AE+ +AI+ +H  G +HRDI+PDN+++T RGHLKLTD GL+      K  TG   +  E K    +  E  ++ DP  T  +        P    G V Y APE+ +     EY ++CD+WS G + + ML+ I PF
Sbjct:  205 IARYYIAEIALAIQSVHNLGFVHRDIKPDNVLITTRGHLKLTDFGLSTRFE--KRDTGFLRVLEELKKLLVK-DEQNIVTDPHLTSDK--------PMSMVGTVEYVAPEVLAE---EEYDARCDWWSLGILMYEMLYGITPF 333          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: B4JY27 (GH14097 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH14097 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.969e-16
Identity = 74/264 (28.03%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  677 PIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKS--TTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEV------LCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDI 1420
            P+  F++AE+  A+  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y      +  DS+  +E  +     P T+L       RRR  +++        G   Y APE+   +    YT  CDYWS G + + ML    PF           L  +        I   +  ++P   QL +E       LC    +RL  +  E     +  EFFK +DF ++   +  + P +  P    N  P+D D +
Sbjct:  889 PLARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEDNSENGPKP-TVL------ERRRMRDHQRVLAHSLVGTPNYIAPEVLERSG---YTQLCDYWSVGVILYEMLVGQPPF-----------LANSPMETQQKVINWEKTLHIPPQAQLSMEAMDLIRRLCASADKRLGKSVDEV----KGHEFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPDKL 1127          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: stk38b (serine/threonine kinase 38b [Source:ZFIN;Acc:ZDB-GENE-081031-2])

HSP 1 Score: 87.0409 bits (214), Expect = 1.227e-17
Identity = 81/301 (26.91%), Postives = 129/301 (42.86%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF D  N+ ++              +  +  G     L+     + T+  + A                     F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T     +S+   N FT   + +      +T +R   NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   77 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILR------KADMLEKEQVGHIRAERDILVQADSLWVVKMFYSFQDKQNLYLL--------------MEFLPGGDMMTLLM----KKDTLSEEEA--------------------QFYVAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLSHNLTNDFT--SQNMNSKRKAETWKR---NRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: stk38a (serine/threonine-protein kinase 38 [Source:NCBI gene;Acc:103023219])

HSP 1 Score: 83.9593 bits (206), Expect = 1.351e-16
Identity = 86/336 (25.60%), Postives = 132/336 (39.29%), Query Frame = 2
Query:  164 ISRQKLVKIHDPHSLN------------------LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            + +QKL K+ D   L                   L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    +        D +    +G IR ERD L+    LW  K+F SF    + + +I E   G  +                       +T+  +   LT  A               F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T          +N    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   43 MRQQKLEKVMDQEGLADEEKRMRRSQHARKETEFLRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILR------KADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKMNLYLIMEFLPGGDM-----------------------MTLLMKKDTLTEEA-------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF-------YRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQNG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 82.0333 bits (201), Expect = 5.765e-16
Identity = 78/304 (25.66%), Postives = 128/304 (42.11%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+   G W  K+F SF D  N+ ++              +  +  G     L+  K++ ++ +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   73 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLSEEATQ----------------------FYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 318          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: lats2 (large tumor suppressor kinase 2 [Source:NCBI gene;Acc:103025207])

HSP 1 Score: 75.485 bits (184), Expect = 1.302e-13
Identity = 74/285 (25.96%), Postives = 112/285 (39.30%), Query Frame = 2
Query:  659 IQMDIVP--IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVK----------STTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEV------------LCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPL-FKPIVSDPDLCFNLIPMDND 1414
            I+M + P  +  F++AEL +AI  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y             S   D + +  C +    L            +R N  ++        G   Y APE+        YT  CD+WS G + F ML    PF                     PT  + +  N  S  Q+  +V            LC     RL  N        +   FF  VDF + L  +P  ++P ++ P    N  P++ +
Sbjct:  795 IRMGVFPEQLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHIRQDSMEPSDFWDDVSNCRCGDRLITL-----------EQRANRQHQRCLAHSLVGTPNYIAPEV---LLRKGYTQLCDWWSVGVILFEMLVGQPPF-----------------LAPTPTETQIKVINWESTLQVPPQVKLSPEAVDIIGRLCCSAEERLGSNGAGEI---KAHPFFSQVDFSSNLRTQPAPYRPKIAHPMDTSNFDPVEEE 1045          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: lats2 (large tumor suppressor kinase 2 [Source:NCBI gene;Acc:103025207])

HSP 1 Score: 75.485 bits (184), Expect = 1.302e-13
Identity = 74/285 (25.96%), Postives = 112/285 (39.30%), Query Frame = 2
Query:  659 IQMDIVP--IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVK----------STTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEV------------LCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPL-FKPIVSDPDLCFNLIPMDND 1414
            I+M + P  +  F++AEL +AI  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y             S   D + +  C +    L            +R N  ++        G   Y APE+        YT  CD+WS G + F ML    PF                     PT  + +  N  S  Q+  +V            LC     RL  N        +   FF  VDF + L  +P  ++P ++ P    N  P++ +
Sbjct:  795 IRMGVFPEQLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHIRQDSMEPSDFWDDVSNCRCGDRLITL-----------EQRANRQHQRCLAHSLVGTPNYIAPEV---LLRKGYTQLCDWWSVGVILFEMLVGQPPF-----------------LAPTPTETQIKVINWESTLQVPPQVKLSPEAVDIIGRLCCSAEERLGSNGAGEI---KAHPFFSQVDFSSNLRTQPAPYRPKIAHPMDTSNFDPVEEE 1045          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 77.7962 bits (190), Expect = 1.448e-15
Identity = 45/143 (31.47%), Postives = 71/143 (49.65%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE ++AI  IHQ G +HRDI+PDN+++  +GH+KL+D GL   +     T     ++    + F+   +      P +++R+      NR    +   G   Y APE+        Y   CD+WS G + F ML    PF
Sbjct:   89 FYIAESILAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRDLTQAQPSDFSTSSK------PMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFLQTG---YNKLCDWWSLGVIMFEMLIGYPPF 222          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005559.1 (pep scaffold:Pmarinus_7.0:GL476474:6865:57025:1 gene:ENSPMAG00000004999.1 transcript:ENSPMAT00000005559.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.277e-13
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  680 IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSS-ATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            ++ F++AEL++A + +HQ G +HRD++P+N++V   GH+KL D G  A++   K  +             ++LPE                          G+  Y APE+ SS +    Y  +CD+WS G + + M++   PF
Sbjct:  196 MVRFYLAELVLATQSLHQMGYVHRDLKPENVLVDRTGHIKLADFGSAAKLNANKMVS-------------SKLPE--------------------------GSPDYIAPEVLSSFSGKGSYGPECDWWSVGVIAYEMVYGKTPF 300          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004683.1 (pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene:ENSPMAG00000004265.1 transcript:ENSPMAT00000004683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.193e-11
Identity = 43/142 (30.28%), Postives = 65/142 (45.77%), Query Frame = 2
Query:  683 ITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            + F++AEL +A+  +H  GI++RD++P+NI++ E GH+ LTD GL+ E            I +E K                           +Y F   G V Y APE+ +      +T   D+WS G + F ML    PF
Sbjct:   35 VKFYLAELALALDHLHSLGIIYRDLKPENILLDESGHIGLTDFGLSKE-----------SIDHEKK---------------------------AYSF--CGTVEYMAPEVVNRKG---HTHSADWWSFGVLMFEMLTGTLPF 133          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004595.1 (pep scaffold:Pmarinus_7.0:GL477044:11103:63873:-1 gene:ENSPMAG00000004137.1 transcript:ENSPMAT00000004595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.287e-10
Identity = 41/141 (29.08%), Postives = 59/141 (41.84%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPE-LHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F+ AE+++A+  IH  G +HRD++PDN+++ + GHLKL D G      T      D ++      C T +                            G   Y +PE L S      Y  +CD+WS G   F ML    PF
Sbjct:  148 FYTAEVVLAVDAIHSMGYIHRDVKPDNMLLDKSGHLKLADFG------TCMKLNKDGMV-----RCDTAV----------------------------GTPDYISPEVLRSQGGQGYYGRECDWWSVGVFLFEMLVGDTPF 249          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003561.1 (pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 gene:ENSPMAG00000003167.1 transcript:ENSPMAT00000003561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 3.157e-10
Identity = 39/141 (27.66%), Postives = 59/141 (41.84%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPE-LHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F+ AE+++A+  IH  G +HRD++PDN+++ + GHLKL D G   ++ T      D+ +                 PD                        Y +PE L S      Y  +CD+WS G   + ML    PF
Sbjct:  177 FYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKNGHLKLADFGTCMKMDTEGMVRCDTAVG---------------TPD------------------------YISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPF 278          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: DBF20 (Ser/Thr kinase involved in late nuclear division; one of the mitotic exit network (MEN) proteins; necessary for the execution of cytokinesis; also plays a role in regulating the stability of SWI5 and CLB2 mRNAs; DBF20 has a paralog, DBF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006315])

HSP 1 Score: 73.9442 bits (180), Expect = 3.366e-14
Identity = 61/237 (25.74%), Postives = 102/237 (43.04%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATI--AEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRC------WNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSD 1375
            F+++E+  A+  +H+ G  HRD++P+N ++   GH+KLTD GL A   + +      I   E KN   E P         + RR+ Y+N       N+      +P+  +   +   +Y    DYWS GC+ F  L    PF           L   +K+L  P   +RR       W+       L+  L  +P+ R+  +F +       + +F  ++F+ L    P F P + D
Sbjct:  271 FYISEMFCAVNALHELGYTHRDLKPENFLIDATGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL--EFP--AFTERSIEDRRKIYHNMRKTEI-NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRYWKKTLRRPRTEDRRAAFSDRTWD-------LITRLIADPINRV-RSFEQ----VRKMSYFAEINFETLRTSSPPFIPQLDD 490          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: DBF2 (Ser/Thr kinase involved in transcription and stress response; functions as part of a network of genes in exit from mitosis; localization is cell cycle regulated; activated by Cdc15p during the exit from mitosis; also plays a role in regulating the stability of SWI5 and CLB2 mRNAs; phosphorylates Chs2p to regulate primary septum formation and Hof1p to regulate cytokinesis; DBF2 has a paralog, DBF20, that arose from the whole genome duplication [Source:SGD;Acc:S000003324])

HSP 1 Score: 73.559 bits (179), Expect = 5.098e-14
Identity = 59/233 (25.32%), Postives = 98/233 (42.06%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATI--AEYTSKCDYWSAGCVFFYMLFMINPF-----DVCYDAIXXXXXXXXXXXXXNP-TIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKP 1363
            F+++E+  A+  +H  G  HRD++P+N ++  +GH+KLTD GL A   + +      I   + K+   E P         + RR+ YN        N+      +P+  +   +   +Y    DYWS GC+ F  L    PF     +  YD +   K  L      +       R W+       L+  L  +P+ RL    H      + + +F  ++F  L +M P F P
Sbjct:  279 FYISEMFCAVNALHDLGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDL--EFP--AFTEKSIEDRRKMYNQLREKEI-NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYDNLRRWKQTLRRPRQSDGRAAFSDRTWD-------LITRLIADPINRLRSFEH-----VKRMSYFADINFSTLRSMIPPFTP 494          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: YPK3 (AGC kinase; phosphorylated by cAMP-dependent protein kinase (PKA) in a TORC1-dependent manner; directly phosphorylated by TORC1; phosphorylates ribosomal protein Rps6a/b (S6), in a TORC-dependent manner; undergoes autophosphorylation [Source:SGD;Acc:S000000232])

HSP 1 Score: 72.0182 bits (175), Expect = 1.429e-13
Identity = 44/142 (30.99%), Postives = 71/142 (50.00%), Query Frame = 2
Query:  683 ITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            ++F+ AE+  A+RF+H +G+++RD++P+N ++ +RGHL LTD GL+      K +  DS +  E               DP      N N  +S      G   Y APE+        Y+  CD++S GC+ + ML    P+
Sbjct:  254 VSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLS------KKSANDSAVDEE---------------DP-----ENVNALYSI----IGTPEYCAPEILLGKA---YSQNCDWYSLGCLLYDMLVGKPPY 362          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: CBK1 (Serine/threonine protein kinase of the the RAM signaling network; Ndr/LATS family member; binds regulatory subunit Mob2p; involved in regulation of cellular morphogenesis, polarized growth, and septum destruction; phosphorylation by Cbk1p regulates localization and activity of Ace2p transcription factor and Ssd1p translational repressor; Cbk1p activity is regulated by both phosphorylation and specific localization; relocalizes to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000005105])

HSP 1 Score: 69.3218 bits (168), Expect = 1.207e-12
Identity = 47/164 (28.66%), Postives = 72/164 (43.90%), Query Frame = 2
Query:  680 IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTV-------------KSTTGDSI-ISYECKNCFTELPETILLPDPFDTRRRNYN-------NRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            +  F+MAE ++AI  IH+ G +HRDI+PDNI++  RGH+KL+D GL+   +               ++T G S   +Y      T      ++ D       N         +R    +   G   Y APE+        Y  +CD+WS G + +  L    PF
Sbjct:  451 VTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATNGISKPGTYNANTTDTANKRQTMVVDSISLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIF---LYQGYGQECDWWSLGAIMYECLIGWPPF 611          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 63.1586 bits (152), Expect = 5.435e-11
Identity = 40/144 (27.78%), Postives = 62/144 (43.06%), Query Frame = 2
Query:  677 PIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            P+  F+ AE+++A+ ++H   I++RD++P+NI++   GH+K+TD G   E+ TV  T            C T        PD                        Y APE+    T   Y    D+WS G + + ML    PF
Sbjct:  168 PVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTL-----------CGT--------PD------------------------YIAPEV---ITTKPYNKSVDWWSLGVLIYEMLAGYTPF 265          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO42700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0M7])

HSP 1 Score: 87.4261 bits (215), Expect = 4.000e-18
Identity = 52/143 (36.36%), Postives = 70/143 (48.95%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNY---NNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AE L+AI  IHQ G +HRDI+PDN+++  RGH+KL D GL   +     T     IS      F+         DP D++RR      NR    +   G   Y APE+        YT  CD+WS G + + ML    PF
Sbjct:  196 FYIAEALLAIDSIHQLGFIHRDIKPDNLLLDSRGHIKLADFGLCTGLKKAHRTEFYRDISPADIKDFSN-------GDPLDSKRRAATWKRNRRQLAYSTVGTPDYIAPEVFIQQG---YTKSCDFWSLGVIMYEMLIGYPPF 328          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO37677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF23])

HSP 1 Score: 73.559 bits (179), Expect = 7.629e-14
Identity = 42/144 (29.17%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSS--ATIAEYTSKCDYWSAGCVFFYMLFMINPFDV 1114
            F++AE+++AI  +H  G +HRD++PDN+++   GH+KL D G +A +      + D       K  F+++P                           G   Y APE+ +S   +   Y  +CD+WS G V + MLF   PF+ 
Sbjct:  185 FYLAEIVMAIHSLHTMGFVHRDVKPDNVLIDRTGHIKLADFGSSARL------SAD-------KKVFSKMP--------------------------VGTPEYIAPEVLTSMDGSGGAYGVECDWWSLGVVAYEMLFGQTPFEA 289          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO28503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6A2])

HSP 1 Score: 67.3958 bits (163), Expect = 6.668e-12
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
             + AE ++A+ ++H  GI+HRDI+PDN+++T  GH+KLTD GL ++I  + STT                    +     D   + + ++       FG   Y APE+        Y    D+WS G + +  L  + PF
Sbjct:  208 MYFAETVLAVEYLHSYGIVHRDIKPDNLLITSLGHIKLTDFGL-SKIGLMNSTTR-------------------MYEHSLDRDTKQFMDKQV-----FGTPDYLAPEV---ILRQGYGRAVDWWSMGIILYEFLMGVPPF 319          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO36034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR1])

HSP 1 Score: 67.3958 bits (163), Expect = 8.808e-12
Identity = 48/161 (29.81%), Postives = 76/161 (47.20%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTV-KSTTGDSIISYE-----------CKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNF-GAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            F++AEL++AI  +H+ G +HRDI+PDNI++ + GH+KLTD GL        +++ Y   +    DS+   E           C +   + P + + P      RR++         +  G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:  140 FYIAELVLAIDSVHRMGFVHRDIKPDNILIDKDGHIKLTDFGLCTGFRWTHDSKYYEKGQHMRQDSMEPDERAWEEMRATCHCGDISIDKPYSEMKP----LERRHFRKHMRCQAHSLVGTPNYIAPEV---LLRIGYRQSCDWWSVGVILYEMLVGQPPF 293          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 67.3958 bits (163), Expect = 8.880e-12
Identity = 58/230 (25.22%), Postives = 104/230 (45.22%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLL--NMEPLFKPIVS 1372
            F+++E+ +A+  +H+QGI++RD++P+NI++   GH+KLTD GL                   CK                      + N  ++ F   G + Y APE+    T + +    D+WS G + + ML    PF  C D  ++    + +  L+ P  +       P AK  + ++L   P  RL     +   + +   FF+ + +++LL   +EP F+P +S
Sbjct:  171 FYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGL-------------------CKESI-------------------FENSLTHTF--CGTIEYMAPEI---LTRSGHGKAVDWWSLGALMYDMLTGTPPF--CADNRKKTIDKILKGKLIIPPYL------TPEAKDFIRKLLKRHPQARLGGMAGDANPI-KAHSFFRHICWEDLLAKKVEPPFRPSIS 348          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: stk38a (serine/threonine kinase 38 [Source:NCBI gene;Acc:101163252])

HSP 1 Score: 82.8037 bits (203), Expect = 4.187e-16
Identity = 87/336 (25.89%), Postives = 132/336 (39.29%), Query Frame = 2
Query:  164 ISRQKLVKIHDPHSLN------------------LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN--YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            + +QKL K+ D   L                   L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G  +                       +T+  +   LT  A               F++AE ++AI  IH  G +HRDI+PDN+++  RGH+KL+D GL   +     T          KN    LP      +    R+      NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   43 MRQQKLEKVMDQEGLADEEKRIRRSEHARKETDFLRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKMNLYLIMEFLPGGDM-----------------------MTLLMKKDTLTEEA-------------TQFYIAETVLAIDSIHTLGFIHRDIKPDNLLLDARGHVKLSDFGLCTGLKKAHCTDF-------YKNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 322          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: stk38a (serine/threonine kinase 38 [Source:NCBI gene;Acc:101163252])

HSP 1 Score: 82.0333 bits (201), Expect = 5.674e-16
Identity = 85/335 (25.37%), Postives = 138/335 (41.19%), Query Frame = 2
Query:  164 ISRQKLVKIHDPHSLN------------------LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELP-ETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            + +QKL K+ D   L                   L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +G IR ERD L+    LW  K+F SF    + + +I E   G  +                       +T+  +   LT  A               F++AE ++AI  IH  G +HRDI+PDN+++  RGH+KL+D GL   +     T     +++   + F++   + +      +T +R   NR    F   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   43 MRQQKLEKVMDQEGLADEEKRIRRSEHARKETDFLRLKRTRLG---LEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA------DMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQ-DKMNLYLIMEFLPGGDM-----------------------MTLLMKKDTLTEEA-------------TQFYIAETVLAIDSIHTLGFIHRDIKPDNLLLDARGHVKLSDFGLCTGLKKAHCTDFYKNLNHSLPSDFSKQTFQNMNSKRKAETWKR---NRRQLAFSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 325          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: stk38l (serine/threonine kinase 38 like [Source:NCBI gene;Acc:101163624])

HSP 1 Score: 79.337 bits (194), Expect = 3.161e-15
Identity = 77/304 (25.33%), Postives = 127/304 (41.78%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+     W  K+F SF D  N+ ++              +  +  G     L+  K++ ++ +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADSAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLSEEA----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: stk38l (serine/threonine kinase 38 like [Source:NCBI gene;Acc:101163624])

HSP 1 Score: 79.337 bits (194), Expect = 3.917e-15
Identity = 77/304 (25.33%), Postives = 127/304 (41.78%), Query Frame = 2
Query:  212 LLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIR-ERDALLNCGGLWTPKVFQSF-DIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRN---YNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPF 1108
            L LK+TRL    L DF  + +   G+FG+  ++++K   +  +    + +      D +    +  IR ERD L+     W  K+F SF D  N+ ++              +  +  G     L+  K++ ++ +A                        F++AE ++AI  IHQ G +HRDI+PDN+++  RGH+KL+D GL   +     T        E     T  P +       +++R+      NR    +   G   Y APE+        Y   CD+WS G + + ML    PF
Sbjct:   78 LRLKRTRLG---LDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKA------DMLEKEQVAHIRAERDILVEADSAWVVKMFYSFQDKRNLYLI--------------MEFLPGGDMMTLLM--KKDTLSEEA----------------------TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRT--------EFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTG---YNKLCDWWSLGVIMYEMLIGYPPF 323          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: lats2 (large tumor suppressor kinase 2 [Source:NCBI gene;Acc:101165431])

HSP 1 Score: 78.5666 bits (192), Expect = 1.811e-14
Identity = 74/285 (25.96%), Postives = 113/285 (39.65%), Query Frame = 2
Query:  659 IQMDIVP--IITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYTVKSTTG----------DSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEV------------LCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPL-FKPIVSDPDLCFNLIPMDND 1414
            I+M + P  +  F++AEL +AI  +H+ G +HRDI+PDNI++   GH+KLTD GL        N++ Y   S             D + +  C +    L            +R N  ++        G   Y APE+        YT  CD+WS G + F ML    PF                     PT  + +  N  S  Q+  +V            LC     RL  N        ++  FF  VDF + L  +P  ++P ++ P    N  P++ +
Sbjct:  795 IRMGVFPEHLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSDFWDDVSNCRCGDRLMTL-----------EQRANRQHQRCLAHSLVGTPNYIAPEV---LLRKGYTQLCDWWSVGVILFEMLVGQPPF-----------------LAATPTETQIKVINWESTLQVPAQVKLSPEAVDIIGRLCCAAEDRLGANGAGEI---KSHPFFAGVDFSSNLRQQPAPYRPKIAHPMDTSNFDPVEEE 1045          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000070521.1 (SMESG000070521.1)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 509/513 (99.22%), Postives = 511/513 (99.61%), Query Frame = 2
Query:   38 MMCSLPFHKCRLILSEHSKFHIKKHLCPKFKFAEYFFYNKEIISRQKLVKIHDPHSLNLLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXXXXXXXXPIDFMVTYYIGLIRERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDIIYDVLRDHHDSLLLPFTTPPINAYSHNKGCGSQSTSFPSPTLTMKSLFDTFT 1576
            MMCSLPFHKCRLILSEHSKFHIKKHLCPKFKFAEYFFYNKEIISRQKLVKIHDPHSLNLLLKKTRLSKVKLSDFSLVGLNSCGSFGKRYIIKRKKKSYYLSTISSKSSKFKSPIDFMVTYYIGLIRERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCS CLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLN+EIYTVKSTTGDSIISYECKNCFTELPE+ILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIEE KLLLAEKSLLNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDIIYDVLRDHHDSLLLPFTTPPINAYSHNKGCGSQSTSFPSPTLTMKSLFDTFT
Sbjct:    1 MMCSLPFHKCRLILSEHSKFHIKKHLCPKFKFAEYFFYNKEIISRQKLVKIHDPHSLNLLLKKTRLSKVKLSDFSLVGLNSCGSFGKRYIIKRKKKSYYLSTISSKSSKFKSPIDFMVTYYIGLIRERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWPLNKCIHIIHVGSCSRCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNSEIYTVKSTTGDSIISYECKNCFTELPESILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIEEVKLLLAEKSLLNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLCFNLIPMDNDDIIYDVLRDHHDSLLLPFTTPPINAYSHNKGCGSQSTSFPSPTLTMKSLFDTFT 513          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000021246.1 (SMESG000021246.1)

HSP 1 Score: 120.168 bits (300), Expect = 2.078e-28
Identity = 116/421 (27.55%), Postives = 187/421 (44.42%), Query Frame = 2
Query:  125 FKFAEYFFYNKEIISRQKLVKIHDPHSLNLLLKKTRLSKVKLSDFSLVGLNSCGSFGXXXXXXXXXXXXXXXXXXXX----XXXXXXPIDFMVTYYIGLIRERDALLNCGGLWTPKVFQSFDIHNIPIVVITEATVGWP---LNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTGSAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFD-VCYDAIXXXX---XXXXXXXXXNPTIIERRCWNVPSAKQLLLEVLCVEPVRRLDD-NFHENTWLPETLEFFKSVDFKNLLNMEP 1351
            F F+E   YN+E +S    +K     ++NL ++    S +    F+   L   GSFGK +I   K      +    K            D +  +Y  LI ERD+L+   G+WTPK++  F    +  + + E   G     L K I I +       LI +  N+ T+            F+   Q DIV    F++AELL A++++H+QG+LHRD++ +NI++T  GHLKL D GL        ST  +   S+      + L E+ L      + RR + NR+           Y+APE +       Y  K D+W+ G +FF++LF   P+  +  D ++E          KS +  +I+++RC   P        ++  E  R  D  N     WLP+++  FK  +   +   +P
Sbjct:   56 FLFSECMMYNREYLSWHFSMKPTQIPNINLPIQIRMPSLLSWKQFNYHKLIGQGSFGKGFIASLKYSLEDENKKRIKICLIKMIGARKGDDIQNHYSQLINERDSLIRLSGMWTPKLYACFIERQLAAIFVQEFIDGETITYLKKLIKIDNGADLYPLLISAITNEKTV--------IDVPFLTQRQFDIV---QFYVAELLGALKYMHEQGVLHRDLKENNILLTCSGHLKLIDFGLAKR--KCSSTELEGTCSFSSSCSSSHLLESYLY-----SPRRMWGNRY-----------YAAPE-YIKEEKNVYDDKGDFWAVGVIFFHLLFGCRPYQHIVSDKVKELSDFISNWKTKSFMQKSILKQRCKRFPELITAFFSLISDESTRLHDSMNDTNQKWLPQSMPLFKKFNLFKMYEYQP 446          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000057360.1 (SMESG000057360.1)

HSP 1 Score: 85.8853 bits (211), Expect = 4.842e-17
Identity = 72/251 (28.69%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYT--VKSTTGDSIISYECKNCFTELPETILLPD---PFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQL------LLEVLCVEPVRRLDDNFHENTWLPETLE---FFKSVDFKNLLNMEPLFKPIVSD 1375
            F+ AE+ +A+  +H  G +HRDI+PDNI++T+ GH+KLTD GL         A+ Y     S T    IS + +     + +    PD   P   R+  + NR  +     G   Y APE+       +Y   CD+WS G + + ML    PF     A  + +            I      N+P+   L      ++   C  P  RL D        P  ++   FF S+D+KNL+N +  +KP + D
Sbjct:  534 FYAAEMTLALESVHSLGFVHRDIKPDNILLTKDGHIKLTDFGLCTGFRWTHMAQYYKHWDPSATSSYHISQDSEGFQEIVADGQTNPDLNKPLIRRKNRFKNR-KFMRSLVGTPNYIAPEI---LKREKYNKSCDWWSVGVIVYEMLVGQPPFLAPSAAHTQYR-----------VINWESFLNIPAHANLDPNAEDIIRRFCCNPANRLSD--------PSEIKQHPFFISIDWKNLINQDAPYKPYIRD 761          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000068357.1 (SMESG000068357.1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.119e-17
Identity = 52/148 (35.14%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTRRRNYN---NRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYD 1123
            F++AE  +AI  IH  G +HRDI+PDN+++  +GH+KL+D GL   +     T     +S + K C            P D++RR  +   NR +  +   G   Y APE+        YTS CD+WS G + F ML    PF  C D
Sbjct:  200 FYVAETALAIDSIHSMGFIHRDIKPDNLLLDAKGHIKLSDFGLCTGLKKSHRTEFYKDLS-QAKPC-------DFAQSPLDSKRRAESWRKNRRNLAYSTVGTPDYIAPEVFQQKG---YTSSCDWWSLGVIMFEMLIGYPPF--CSD 334          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000057360.1 (SMESG000057360.1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.218e-17
Identity = 72/251 (28.69%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  689 FWMAELLVAIRFIHQQGILHRDIRPDNIIVTERGHLKLTDLGL--------NAEIYT--VKSTTGDSIISYECKNCFTELPETILLPD---PFDTRRRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYMLFMINPFDVCYDAIXXXXXXXXXXXXXNPTIIERRCWNVPSAKQL------LLEVLCVEPVRRLDDNFHENTWLPETLE---FFKSVDFKNLLNMEPLFKPIVSD 1375
            F+ AE+ +A+  +H  G +HRDI+PDNI++T+ GH+KLTD GL         A+ Y     S T    IS + +     + +    PD   P   R+  + NR  +     G   Y APE+       +Y   CD+WS G + + ML    PF     A  + +            I      N+P+   L      ++   C  P  RL D        P  ++   FF S+D+KNL+N +  +KP + D
Sbjct:  531 FYAAEMTLALESVHSLGFVHRDIKPDNILLTKDGHIKLTDFGLCTGFRWTHMAQYYKHWDPSATSSYHISQDSEGFQEIVADGQTNPDLNKPLIRRKNRFKNR-KFMRSLVGTPNYIAPEI---LKREKYNKSCDWWSVGVIVYEMLVGQPPFLAPSAAHTQYR-----------VINWESFLNIPAHANLDPNAEDIIRRFCCNPANRLSD--------PSEIKQHPFFISIDWKNLINQDAPYKPYIRD 758          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK387.122e-1626.49serine/threonine kinase 38 [Source:HGNC Symbol;Acc... [more]
LATS29.821e-1628.01large tumor suppressor kinase 2 [Source:HGNC Symbo... [more]
STK38L1.055e-1425.33serine/threonine kinase 38 like [Source:HGNC Symbo... [more]
LATS11.728e-1429.37large tumor suppressor kinase 1 [Source:HGNC Symbo... [more]
LATS11.728e-1429.37large tumor suppressor kinase 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sax-11.720e-1834.25Serine/threonine-protein kinase sax-1 [Source:Uni... [more]
sax-11.859e-1834.97Serine/threonine-protein kinase sax-1 [Source:Uni... [more]
wts-17.347e-1329.17Serine/threonine-protein kinase WARTS homolog [So... [more]
rskn-11.613e-1025.91Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.720e-1025.91Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wts3.051e-1727.07gene:FBgn0011739 transcript:FBtr0085720[more]
trc6.007e-1533.78gene:FBgn0003744 transcript:FBtr0332154[more]
trc7.557e-1533.11gene:FBgn0003744 transcript:FBtr0074922[more]
gek2.605e-1224.29gene:FBgn0023081 transcript:FBtr0072287[more]
dop8.999e-1230.07gene:FBgn0267390 transcript:FBtr0075562[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk38a6.411e-1725.89serine/threonine kinase 38a [Source:ZFIN;Acc:ZDB-G... [more]
stk38a6.411e-1725.89serine/threonine kinase 38a [Source:ZFIN;Acc:ZDB-G... [more]
stk38l6.866e-1625.66serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
stk38l6.866e-1625.66serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
stk38l7.881e-1625.66serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk38l7.331e-1625.66serine/threonine kinase 38 like [Source:NCBI gene;... [more]
stk38l7.735e-1625.66serine/threonine kinase 38 like [Source:NCBI gene;... [more]
ENSXETT00000029007.11.125e-1526.16serine/threonine kinase 38 [Source:NCBI gene;Acc:1... [more]
ENSXETT00000012893.11.212e-1526.49serine/threonine kinase 38 [Source:NCBI gene;Acc:1... [more]
ENSXETT00000029036.11.557e-1526.49serine/threonine kinase 38 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk385.249e-1626.49serine/threonine kinase 38 [Source:MGI Symbol;Acc:... [more]
Stk385.249e-1626.49serine/threonine kinase 38 [Source:MGI Symbol;Acc:... [more]
Stk385.249e-1626.49serine/threonine kinase 38 [Source:MGI Symbol;Acc:... [more]
Stk384.061e-1532.39serine/threonine kinase 38 [Source:MGI Symbol;Acc:... [more]
Stk38l1.027e-1424.67serine/threonine kinase 38 like [Source:MGI Symbol... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54IH8|NDRB_DICDI1.974e-2128.62Probable serine/threonine-protein kinase ndrB OS=D... [more]
sp|Q2L6W9|SAX1_CAEEL2.189e-1734.25Serine/threonine-protein kinase sax-1 OS=Caenorhab... [more]
sp|A8XJL7|SAX1_CAEBR4.361e-1734.97Serine/threonine-protein kinase sax-1 OS=Caenorhab... [more]
sp|Q9VA38|WARTS_DROME3.058e-1627.07Serine/threonine-protein kinase Warts OS=Drosophil... [more]
sp|A2VDV2|STK38_BOVIN2.994e-1526.49Serine/threonine-protein kinase 38 OS=Bos taurus O... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1A4B86.046e-1829.55Non-specific serine/threonine protein kinase OS=Di... [more]
A0A210PWC19.676e-1830.45Serine/threonine-protein kinase LATS1 OS=Mizuhopec... [more]
D3B1I22.672e-1730.34Non-specific serine/threonine protein kinase OS=Po... [more]
A0A1J4JQ967.568e-1737.06Serine/threonine-protein kinase CBK1 OS=Tritrichom... [more]
B4JY271.969e-1628.03GH14097 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk38b1.227e-1726.91serine/threonine kinase 38b [Source:ZFIN;Acc:ZDB-G... [more]
stk38a1.351e-1625.60serine/threonine-protein kinase 38 [Source:NCBI ge... [more]
stk38l5.765e-1625.66serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
lats21.302e-1325.96large tumor suppressor kinase 2 [Source:NCBI gene;... [more]
lats21.302e-1325.96large tumor suppressor kinase 2 [Source:NCBI gene;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk38l1.448e-1531.47serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000005559.12.277e-1328.47pep scaffold:Pmarinus_7.0:GL476474:6865:57025:1 ge... [more]
ENSPMAT00000004683.11.193e-1130.28pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene... [more]
ENSPMAT00000004595.11.287e-1029.08pep scaffold:Pmarinus_7.0:GL477044:11103:63873:-1 ... [more]
ENSPMAT00000003561.13.157e-1027.66pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 ge... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBF203.366e-1425.74Ser/Thr kinase involved in late nuclear division; ... [more]
DBF25.098e-1425.32Ser/Thr kinase involved in transcription and stres... [more]
YPK31.429e-1330.99AGC kinase; phosphorylated by cAMP-dependent prote... [more]
CBK11.207e-1228.66Serine/threonine protein kinase of the the RAM sig... [more]
TPK25.435e-1127.78cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427004.000e-1836.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376777.629e-1429.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285036.668e-1229.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360348.808e-1229.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411668.880e-1225.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk38a4.187e-1625.89serine/threonine kinase 38 [Source:NCBI gene;Acc:1... [more]
stk38a5.674e-1625.37serine/threonine kinase 38 [Source:NCBI gene;Acc:1... [more]
stk38l3.161e-1525.33serine/threonine kinase 38 like [Source:NCBI gene;... [more]
stk38l3.917e-1525.33serine/threonine kinase 38 like [Source:NCBI gene;... [more]
lats21.811e-1425.96large tumor suppressor kinase 2 [Source:NCBI gene;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070521.10.000e+099.22SMESG000070521.1[more]
SMESG000021246.12.078e-2827.55SMESG000021246.1[more]
SMESG000057360.14.842e-1728.69SMESG000057360.1[more]
SMESG000068357.15.119e-1735.14SMESG000068357.1[more]
SMESG000057360.15.218e-1728.69SMESG000057360.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027574 ID=SMED30027574|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2242bp
ATCGATAAATAAAAGTTTACTAGCCTTAAGAAGGTAAATGATGTGCTCCC
TTCCATTTCATAAATGCCGATTAATTCTATCCGAACATTCGAAATTTCAT
ATTAAAAAGCATTTATGTCCAAAATTCAAATTTGCAGAGTATTTCTTCTA
CAATAAAGAAATAATAAGTCGGCAGAAACTAGTAAAAATTCATGATCCTC
ACTCATTGAATTTGCTATTAAAAAAGACACGCTTATCCAAAGTGAAACTA
TCAGATTTTTCATTGGTCGGTCTTAATAGTTGCGGCAGTTTCGGCAAAAG
GTATATTATTAAAAGGAAAAAGAAAAGCTATTACTTAAGTACAATTAGTT
CAAAATCATCAAAGTTTAAATCACCAATTGACTTCATGGTCACGTATTAT
ATTGGGCTTATTCGTGAAAGGGATGCTTTATTAAACTGCGGGGGATTATG
GACCCCAAAAGTATTTCAAAGCTTTGATATACATAATATTCCAATTGTAG
TCATCACAGAGGCAACTGTAGGATGGCCATTGAATAAATGTATTCATATT
ATTCACGTTGGCAGTTGCTCTGGGTGCCTTATTTATTCTAAACGCAATCA
AATAACAATAAAAGCACAAAGCGCCTTATTGACTGGAAGTGCCGAATTTA
TTGAACCAATTCAAATGGATATAGTTCCAATCATTACATTTTGGATGGCT
GAATTGCTGGTTGCTATTCGATTCATTCACCAACAAGGCATACTTCATAG
GGATATTAGGCCTGATAATATAATTGTAACAGAAAGGGGTCATCTAAAGT
TAACTGATCTTGGATTGAACGCAGAAATTTACACAGTCAAATCAACTACC
GGTGACTCCATCATTTCTTACGAATGCAAAAATTGTTTTACTGAATTACC
GGAAACCATTCTTTTACCAGATCCATTTGATACTAGACGTCGAAATTATA
ATAATCGCCATTCATATCCATTTCGAAATTTTGGTGCTGTTGCATATTCG
GCACCTGAACTTCATTCGAGTGCAACTATTGCTGAATATACTTCCAAATG
CGATTATTGGTCAGCTGGGTGTGTCTTCTTCTATATGTTATTCATGATAA
ATCCATTTGACGTGTGCTACGACGCAATTGAAGAAGCAAAATTATTGTTA
GCTGAAAAAAGCTTGCTTAATCCTACAATCATTGAACGAAGATGTTGGAA
TGTTCCTTCAGCTAAACAACTATTACTTGAAGTTTTGTGTGTTGAACCTG
TGAGAAGATTAGATGATAACTTTCATGAAAATACTTGGCTTCCAGAGACT
TTGGAGTTTTTTAAATCTGTAGATTTTAAAAATCTTCTCAACATGGAACC
TCTATTCAAGCCAATAGTTTCAGATCCGGATCTGTGCTTTAATCTTATTC
CAATGGACAATGATGACATAATTTATGATGTTTTGAGAGATCATCATGAC
TCTTTACTTCTCCCATTTACTACTCCACCTATTAATGCATATTCACATAA
TAAAGGATGTGGGTCACAAAGCACAAGTTTTCCTTCACCCACATTAACAA
TGAAATCTTTATTTGATACGTTCACTTAATGGTAAATATTATTTATATAG
GCATAAAATCTTATGTTATCGGTATTGTTTTGAAAGAATATTAATTTGAA
AATAAACAAAATATCCCCAGTGATTTCAGTTTGGACTTCGTTTAAACAAC
TTACAAGCAATTATTACTGTGAATAAAATAAATTTAGATTTTATTCAGTG
TACTGGTACATTTTATAAATTAATAGCATAAATGACCATCTTTCAAGTTC
GATGCCACCGTTCATCCTATTAATTCAATGAAATATCCAATTACTTGTGT
GTGTGGATATAGTTTGTTTAGAAAGTCAAATAATTTCCATACTATATACT
TTGTTTTAAAATAAACATCGATTTCTCAGTAATCGCAAACATTCATCTAG
TTTGATGCAGCATTTCTATATAGTATTACTGTTTTAATACAGACTCGTTA
CTTATTATTTTGTCTTTATGGGGATTTTATTCGACATCAAAATATCCTTA
TCAGCTACTTATAAGAAATAGTAATTAAAACTACGTTGAATTTGGTACTC
GTTATACTCTACAATGAGCCTGAGTTATGTGCAACTTATCCCATTTGTTA
ATCGATTTTTCATGCTAGTTTTACTACGTAAATAGTTTTTATAAAATGTG
TATAATCTATTAATTTTCTCTTTTTTGCGTATGCCAAATAAA
back to top

protein sequence of SMED30027574-orf-1

>SMED30027574-orf-1 ID=SMED30027574-orf-1|Name=SMED30027574-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MMCSLPFHKCRLILSEHSKFHIKKHLCPKFKFAEYFFYNKEIISRQKLVK
IHDPHSLNLLLKKTRLSKVKLSDFSLVGLNSCGSFGKRYIIKRKKKSYYL
STISSKSSKFKSPIDFMVTYYIGLIRERDALLNCGGLWTPKVFQSFDIHN
IPIVVITEATVGWPLNKCIHIIHVGSCSGCLIYSKRNQITIKAQSALLTG
SAEFIEPIQMDIVPIITFWMAELLVAIRFIHQQGILHRDIRPDNIIVTER
GHLKLTDLGLNAEIYTVKSTTGDSIISYECKNCFTELPETILLPDPFDTR
RRNYNNRHSYPFRNFGAVAYSAPELHSSATIAEYTSKCDYWSAGCVFFYM
LFMINPFDVCYDAIEEAKLLLAEKSLLNPTIIERRCWNVPSAKQLLLEVL
CVEPVRRLDDNFHENTWLPETLEFFKSVDFKNLLNMEPLFKPIVSDPDLC
FNLIPMDNDDIIYDVLRDHHDSLLLPFTTPPINAYSHNKGCGSQSTSFPS
PTLTMKSLFDTFT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008266Tyr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 74..418
e-value: 2.0E-10
score: 14.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 216..408
e-value: 1.7E-22
score: 80.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 74..418
score: 21.842
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 217..447
NoneNo IPR availablePANTHERPTHR24356:SF185SERINE/THREONINE-PROTEIN KINASE WARTScoord: 217..447
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 235..247
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 69..446