SMED30027571

Overview
NameSMED30027571
Smed IDSMED30027571
Length (bp)2893
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027571 (SMED30027571) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027571 (SMED30027571) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027571 (SMED30027571) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027571 (SMED30027571) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027571

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30027571SMESG000072057.1 dd_Smed_v4_6054_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027571SMESG000074430.1 Contig45090newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027571SMESG000074430.1 Contig45090uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30027571SMESG000072057.1 dd_Smed_v4_6054_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30027571 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 59.6918 bits (143), Expect = 2.035e-8
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L+VKCP E C  K  +  L  H   C   L+ CP
Sbjct:   46 SSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30027571 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 59.6918 bits (143), Expect = 2.035e-8
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L+VKCP E C  K  +  L  H   C   L+ CP
Sbjct:   46 SSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30027571 vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 55.0694 bits (131), Expect = 5.215e-7
Identity = 45/224 (20.09%), Postives = 97/224 (43.30%), Query Frame = -2
Query: 2164 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAI 2811
            DET +      + T+D +G   + +   G E  ++T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + + N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  V  AW+ I+++ I       ++  +   E   +
Sbjct:  364 DETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVL 583          
BLAST of SMED30027571 vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 55.0694 bits (131), Expect = 5.215e-7
Identity = 45/224 (20.09%), Postives = 97/224 (43.30%), Query Frame = -2
Query: 2164 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAI 2811
            DET +      + T+D +G   + +   G E  ++T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + + N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  V  AW+ I+++ I       ++  +   E   +
Sbjct:  364 DETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVL 583          
BLAST of SMED30027571 vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 51.2174 bits (121), Expect = 1.087e-6
Identity = 35/134 (26.12%), Postives = 55/134 (41.04%), Query Frame = 3
Query:  159 AQVDSDNIFKFLQR--YKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGS------NEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDL-YCHLESCGNRLLRCP 533
            A V      + LQ    K ++  ++ ++Y C  CRN+L    QA CG  +C  C+   + +G   C+         E   +   S A  D    R++  L   CP + C+ K  + +   CH   C   L  CP
Sbjct:    4 ASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECP 137          
BLAST of SMED30027571 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 56.225 bits (134), Expect = 1.019e-7
Identity = 45/155 (29.03%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  231 SEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFEN--CSQKYNIMDLYCHLESCGNRLL------RCPFQSLGCSDGVSNDQID-LEKHLADSMEKHSKIVV-----NSIETWK 653
            S Y+C IC + L      SCG  FC+ C+   ++  +  C   N+  +LS       D    R+I +L   CP  +  CS   + ++L+ HL SC  R        +CPF  + C D V   + + LE+HL   M  H ++++      +I TW+
Sbjct:  100 SRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNK--RLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKC-DFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQ 251          
BLAST of SMED30027571 vs. Ensembl Zebrafish
Match: BX914205.2 (pep chromosome:GRCz11:4:64121772:64123545:-1 gene:ENSDARG00000099590.2 transcript:ENSDART00000170040.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX914205.2)

HSP 1 Score: 79.7221 bits (195), Expect = 3.378e-15
Identity = 53/202 (26.24%), Postives = 97/202 (48.02%), Query Frame = -2
Query: 2308 FKTFMDN-LNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMF---PPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFK--------NYLLEEINIYIETKRERNV 2874
            F+T+  N +   + QP +I  MDE  +     V  T+++KGA+++SI  TG+E +  T +L    + +KL P++  K KT       + + +   +  W  ++ +   +  ++   P    H    LL+ DS   +   T+K  +   N    +IP G+T  LQ LDIG+N+ FK         ++ +  + + +T R+R  
Sbjct:  148 FRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFPAGVIIKANQKGWMDEEKMNEWLREVYVKRPDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTFTKTGRQRRA 349          
BLAST of SMED30027571 vs. Ensembl Zebrafish
Match: CR352209.1 (pep chromosome:GRCz11:24:26088143:26089609:1 gene:ENSDARG00000103972.2 transcript:ENSDART00000171129.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352209.1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.517e-15
Identity = 54/202 (26.73%), Postives = 97/202 (48.02%), Query Frame = -2
Query: 2308 FKTFMDN-LNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMF---PPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFK--------NYLLEEINIYIETKRERNV 2874
            F+T+  N +   + QP +I  MDE  +     V  T+++KGA+++SI  TG+E +  T +L    + +KL P++  K KT       + I +   +  W  ++ +   +  ++   P    H    LL+ DS   +   T+K  +   N    +IP G+T  LQ LDIG+N+ FK         ++ +  + + +T R+R  
Sbjct:  148 FRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFPAGIIIKANQKGWMDEEKMNEWLREVYVKRPDGFFHTSPSLLICDSMRAHLIATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTFTKTGRQRRA 349          
BLAST of SMED30027571 vs. Ensembl Zebrafish
Match: CR354398.1 (pep chromosome:GRCz11:7:64150332:64152087:-1 gene:ENSDARG00000101994.2 transcript:ENSDART00000165234.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354398.1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.617e-15
Identity = 53/202 (26.24%), Postives = 97/202 (48.02%), Query Frame = -2
Query: 2308 FKTFMDN-LNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMF---PPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFK--------NYLLEEINIYIETKRERNV 2874
            F+T+  N +   + QP +I  MDE  +     V  T+++KGA+++SI  TG+E +  T +L    + +KL P++  K KT       + + +   +  W  ++ +   +  ++   P    H    LL+ DS   +   T+K  +   N    +IP G+T  LQ LDIG+N+ FK         ++ +  + + +T R+R  
Sbjct:  148 FRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFPAGVIIKANQKGWMDEEKMNEWLREVYVKRPDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTFTKTGRQRRA 349          
BLAST of SMED30027571 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 53.5286 bits (127), Expect = 1.096e-6
Identity = 34/122 (27.87%), Postives = 52/122 (42.62%), Query Frame = 3
Query:  204 KRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSG------SNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGC 551
            + +++  +  +Y+C  C++IL    QA CG  FC  C      +G   C          EE  + N+++A  D    R+I  L  KCP E CS    + D     E       RC F+ + C
Sbjct:   45 REVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEG------RCAFERVKC 160          
BLAST of SMED30027571 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 53.5286 bits (127), Expect = 1.137e-6
Identity = 34/122 (27.87%), Postives = 52/122 (42.62%), Query Frame = 3
Query:  204 KRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSG------SNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGC 551
            + +++  +  +Y+C  C++IL    QA CG  FC  C      +G   C          EE  + N+++A  D    R+I  L  KCP E CS    + D     E       RC F+ + C
Sbjct:   32 REVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEG------RCAFERVKC 147          
BLAST of SMED30027571 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 58.151 bits (139), Expect = 5.183e-8
Identity = 42/139 (30.22%), Postives = 66/139 (47.48%), Query Frame = 3
Query:  180 IFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCSDGVSN-DQIDLEKH 593
            + + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L VKCP + C++   +     HLE     L+RC F  + CS   S+  +  L+KH
Sbjct:   51 VLEDVQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQL---FPDNFAKREILSLRVKCPSQGCTETMELR----HLE---RHLVRCDFAGVECSQCQSSFPKYSLQKH 179          
BLAST of SMED30027571 vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 59.3066 bits (142), Expect = 2.025e-8
Identity = 46/208 (22.12%), Postives = 92/208 (44.23%), Query Frame = -2
Query: 2212 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSL 2811
            DET +      + T+D +G   I +   G E  R+T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + N N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  +  AW+ I+++ I    
Sbjct:  383 DETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGF 586          
BLAST of SMED30027571 vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 59.3066 bits (142), Expect = 2.025e-8
Identity = 46/208 (22.12%), Postives = 92/208 (44.23%), Query Frame = -2
Query: 2212 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSL 2811
            DET +      + T+D +G   I +   G E  R+T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + N N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  +  AW+ I+++ I    
Sbjct:  383 DETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGF 586          
BLAST of SMED30027571 vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 58.9214 bits (141), Expect = 2.501e-8
Identity = 47/224 (20.98%), Postives = 97/224 (43.30%), Query Frame = -2
Query: 2164 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAI 2811
            DET +      + T+D +G   I +   G E  R+T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + N N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  +  AW+ I+++ I       ++  +   E   +
Sbjct:  371 DETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLEDEGDVL 590          
BLAST of SMED30027571 vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 58.9214 bits (141), Expect = 2.501e-8
Identity = 47/224 (20.98%), Postives = 97/224 (43.30%), Query Frame = -2
Query: 2164 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAI 2811
            DET +      + T+D +G   I +   G E  R+T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + N N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  +  AW+ I+++ I       ++  +   E   +
Sbjct:  371 DETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFRKCHISSNLEDEGDVL 590          
BLAST of SMED30027571 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 58.5362 bits (140), Expect = 3.497e-8
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L VKCP + C QK  +  L  H   C   L+ CP
Sbjct:   46 SSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCP 163          
BLAST of SMED30027571 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 6.272e-8
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L+VKCP E C  K  +  L  H   C   L+ CP
Sbjct:   47 SSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCP 164          
BLAST of SMED30027571 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 9.772e-8
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L+VKCP E C  K  +  L  H   C   L+ CP
Sbjct:   46 SSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30027571 vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.244e-7
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L+VKCP E C  K  +  L  H   C   L+ CP
Sbjct:   46 SSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of SMED30027571 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.504e-7
Identity = 38/121 (31.40%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  171 SDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCP 533
            S +  + +Q Y    +  + S+Y+C IC   L  A Q  CG  FC+ CI  ++++  + C   NE    + L     D    R+I  L+VKCP E C  K  +  L  H   C   L+ CP
Sbjct:   46 SSSFMEDIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL---FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of SMED30027571 vs. UniProt/SwissProt
Match: sp|Q80TC5|POGK_MOUSE (Pogo transposable element with KRAB domain OS=Mus musculus OX=10090 GN=Pogk PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 1.540e-7
Identity = 46/208 (22.12%), Postives = 92/208 (44.23%), Query Frame = -2
Query: 2212 DETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNI-SEIYVLETENAWCTQDVIKIRINLMFPPVLRHN------QKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEI-NIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSL 2811
            DET +      + T+D +G   I +   G E  R+T +L +  + +KL P +  +          S + +      W T+D+++  + +    V R        Q+ +L+ +    +   ++K  + N N + V+IP G+T+ LQ LD+ + KP  + +  +  N  +      +  G+  KP L   +  +  AW+ I+++ I    
Sbjct:  364 DETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEV----VWRRRTGAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGF 567          
BLAST of SMED30027571 vs. TrEMBL
Match: A0A087U540 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_09488 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.920e-89
Identity = 147/284 (51.76%), Postives = 203/284 (71.48%), Query Frame = -2
Query: 2050 IKRALFFKTFMDNLNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILREL---ESQTRPADFSILTD*HNVLEEDDM 2892
            +KRAL FK F+D ++F++YQ  N+IAMDET+VF  Q  QTT+  K ++SI +  TGY++ RVTCIL I  + KK++P L TK K + I  +S IYV+E+E AWCTQ VI+  ++ M PP+LR   + LLVWDSAST+RAK MK +L+ + I+Q+MIP+GMT YLQ+LDI INKPFK++L  EIN YIE +  RN +G+++KP L +V+  VK +W KIT+  + N+L  GYLD+ +SF  S IA+H+RFGP+I +E+   E+Q    +F I  D   V EEDDM
Sbjct:  116 VKRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIRLDGKKVSPFLITKGKKDQIQRVSGIYVIESEKAWCTQAVIRKWVDFMLPPLLRGQNRGLLVWDSASTHRAKDMKNFLAERKIDQIMIPAGMTGYLQTLDIAINKPFKDHLRMEINEYIENRMVRNHRGNFVKPGLQEVVNWVKNSWDKITDSDVSNALRTGYLDKKYSFNDSYIARHERFGPMIQQEMDLEENQNIIQNF-IYDD---VPEEDDM 395          
BLAST of SMED30027571 vs. TrEMBL
Match: A0A087UID4 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_21465 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 3.378e-89
Identity = 147/284 (51.76%), Postives = 203/284 (71.48%), Query Frame = -2
Query: 2050 IKRALFFKTFMDNLNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILREL---ESQTRPADFSILTD*HNVLEEDDM 2892
            +KRAL FK F+D ++F++YQ  N+IAMDET+VF  Q  QTT+  K ++SI +  TGY++ RV+CIL I  + KK++P L TK K + I  IS IYV+E+E AWCTQ VI+  ++ M PP+LR   + LLVWDSAST+RAK MK +L+ + I+Q+MIP+GMT YLQ+LDI INKPFK++L  EIN YIE +  RN +G+++KP L +V+  VK +W KIT+  + N+L  GYLD+ +SF  S IA+H+RFGP+I +E+   E+Q    +F I  D   V EEDDM
Sbjct:  116 VKRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVSCILAIRLDGKKVSPFLITKGKKDQIQRISGIYVIESEKAWCTQAVIRKWVDFMLPPLLRGQNRGLLVWDSASTHRAKDMKNFLAERKIDQIMIPAGMTGYLQTLDIAINKPFKDHLRMEINEYIENRMVRNHRGNFVKPGLQEVVNWVKNSWDKITDSDVSNALRTGYLDKKYSFNDSYIARHERFGPMIQQEMDLEENQNIIQNF-IYDD---VPEEDDM 395          
BLAST of SMED30027571 vs. TrEMBL
Match: A0A087TJ39 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_07293 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.778e-89
Identity = 147/284 (51.76%), Postives = 203/284 (71.48%), Query Frame = -2
Query: 2050 IKRALFFKTFMDNLNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILREL---ESQTRPADFSILTD*HNVLEEDDM 2892
            +KRAL FK F+D ++F++YQ  N+IAMDET+VF  Q  QTT+  K ++SI +  TGY++ RVTCIL I  + KK++P L TK K + I  +S IYV+E+E AWCTQ VI+  ++ M PP+LR   + LLVWDSAST+RAK MK +L+ + I+Q+MIP+GMT YLQ+LDI INKPFK++L  EIN YIE +  RN +G+++KP L +V+  VK +W KIT+  + N+L  GYLD+ +SF  S IA+H+RFGP+I +E+   E+Q    +F I  D   V EEDDM
Sbjct:  148 VKRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIRLDGKKVSPFLITKGKKDQIQRVSGIYVIESEKAWCTQAVIRKWVDFMLPPLLRGQNRGLLVWDSASTHRAKDMKNFLAERKIDQIMIPAGMTGYLQTLDIAINKPFKDHLRMEINEYIENRMVRNHRGNFVKPGLQEVVNWVKNSWDKITDSDVSNALRTGYLDKKYSFNDSYIARHERFGPMIQQEMDLEENQNIIQNF-IYDD---VPEEDDM 427          
BLAST of SMED30027571 vs. TrEMBL
Match: A0A087UBN2 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_11889 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 6.049e-89
Identity = 144/284 (50.70%), Postives = 203/284 (71.48%), Query Frame = -2
Query: 2050 IKRALFFKTFMDNLNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILREL---ESQTRPADFSILTD*HNVLEEDDM 2892
            +KRAL FK F+D ++F++YQ  N+IAMDET+VF  Q  QTT+  K ++SI +  TGY++ RVTCIL I  + KK++P L TK K + I  +S IYV+E+E AWCTQ VI+  ++ M PP+LR   + LLVWDSAST+RAK MK +L+ + I+Q+MIP+GMT YLQ+LDI INKPFK++L  EIN YIE +  RN +G+++KP L +V+  VK +W KIT+  + N+L  GYLD+ +SF  S IA+H+RFGP+I +E+   E+Q    +F      ++V E+DDM
Sbjct:  116 VKRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIRLDGKKVSPFLITKGKKDQIQRVSGIYVIESEKAWCTQAVIRKWVDFMLPPLLRGQNRGLLVWDSASTHRAKDMKNFLAERKIDQIMIPAGMTGYLQTLDIAINKPFKDHLRMEINEYIENRMVRNHRGNFVKPGLQEVVNWVKNSWDKITDSDVSNALRTGYLDKKYSFNDSYIARHERFGPMIQQEMDLEENQNIIPNFIY----YDVPEDDDM 395          
BLAST of SMED30027571 vs. TrEMBL
Match: A0A087TRQ1 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_26215 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 6.683e-89
Identity = 147/284 (51.76%), Postives = 203/284 (71.48%), Query Frame = -2
Query: 2050 IKRALFFKTFMDNLNFAQYQP*NIIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVLNTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILREL---ESQTRPADFSILTD*HNVLEEDDM 2892
            +KRAL FK F+D ++F++YQ  N+IAMDET+VF  Q  QTT+  K ++SI +  TGY++ RVTCIL I  + KK++P L TK K + I  +S IYV+E+E AWCTQ VI+  ++ M PP+LR   + LLVWDSAST+RAK MK +L+ + I+Q+MIP+GMT YLQ+LDI INKPFK++L  EIN YIE +  RN +G+++KP L +V+  VK +W KIT+  + N+L  GYLD+ +SF  S IA+H+RFGP+I +E+   E+Q    +F I  D   V EEDDM
Sbjct:  148 VKRALTFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIRLDGKKVSPFLITKGKKDQIQRVSGIYVIESEKAWCTQAVIRKWVDFMLPPLLRGQNRGLLVWDSASTHRAKDMKNFLAERKIDQIMIPAGMTGYLQTLDIAINKPFKDHLRMEINEYIENRMVRNHRGNFVKPGLQEVVNWVKNSWDKITDSDVSNALRTGYLDKKYSFNDSYIARHERFGPMIQQEMDLEENQNIIQNF-IYDD---VPEEDDM 427          
BLAST of SMED30027571 vs. Ensembl Nematostella
Match: EDO27426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A1])

HSP 1 Score: 52.7582 bits (125), Expect = 8.849e-8
Identity = 35/115 (30.43%), Postives = 51/115 (44.35%), Query Frame = 3
Query:  225 IPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALR-----DYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCS 554
            +  EY C IC   L    Q  CG  FC++C+D+A +        S  EC +    + L+     D    R I   +VKCP + C  +  + DL   ++ CG   LR   + LG S
Sbjct:   19 VAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRR------KSRAECPMDREPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEVSMKGCGK--LRERGEVLGVS 125          
BLAST of SMED30027571 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 53.1434 bits (126), Expect = 3.590e-7
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  225 IPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALR-----DYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCSDGVSNDQIDLEKHL 596
            +  EY C IC   L    Q  CG  FC++C+D+A +        S  EC +    + L+     D    R I   +VKCP + C  +  + DL  H  +C   L+ C   +  CS  +   ++D+++HL
Sbjct:   19 VAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRR------KSRAECPMDREPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTC--SNPMCSAQLP--RMDVDEHL 137          
BLAST of SMED30027571 vs. Ensembl Medaka
Match: ENSORLT00000030675.1 (zinc finger protein 37 [Source:NCBI gene;Acc:101161026])

HSP 1 Score: 83.9593 bits (206), Expect = 4.724e-16
Identity = 62/210 (29.52%), Postives = 102/210 (48.57%), Query Frame = -2
Query: 2212 IIAMDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLTPVL---NTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPV-LRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYI--ETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSL 2823
            IIAMDETS +      TT +  G+ S  ++ +G+E +  T  L    N  KL P++   + K +   + ++ E  V  + N W  Q++ ++    +     LR   K LLVWD+   + +K  KE L   N++  +IP+G T Y+Q  DI   KPFK+ L E    ++  +  +E    G+   P L  ++  + +AW  I  + I  S 
Sbjct:  176 IIAMDETSAWFDMPGPTTAEPAGSRSDVMNASGHEKSHFTVTLAAKANGAKLKPLIVFRDAKREVARLQDVQEAAVATSINGWMNQELTEMWCQKVCSGFGLR---KSLLVWDADHCHISKETKEELKKYNVSMTVIPNGCTKYVQPADI-WGKPFKDKLRELYAKWMVGDEDKEWTSGGNLKAPALRLLVTWIISAWQDIPPETIRKSF 381          
BLAST of SMED30027571 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 59.6918 bits (143), Expect = 1.088e-8
Identity = 36/113 (31.86%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  192 LQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRC 530
            LQ Y    +  + S+Y+C IC   L NA Q  CG  FC+ CI+ ++++    C   NE      L     D    R+I  L V+CP  +C +K  +  L  HL  C    + C
Sbjct:   61 LQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDNEMLSEDQL---FPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPC 170          
BLAST of SMED30027571 vs. Planmine SMEST
Match: SMESG000072057.1 (SMESG000072057.1)

HSP 1 Score: 392.889 bits (1008), Expect = 0.000e+0
Identity = 191/195 (97.95%), Postives = 193/195 (98.97%), Query Frame = 3
Query:  156 MAQVDSDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCSDGVSNDQIDLEKHLADSMEKHSKIVVNSIETWKLRIEKLEAELASKQNKIEQMTAEMQTIKV 740
            MAQVDSDNIFKFLQRYK IIND+IPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESC NRLLRCPFQSLGCSDGVSNDQIDLEKHLADSMEKHSKIVVNSIETWKLRIEKLEAELASKQNKIEQMTAEMQTIK+
Sbjct:    1 MAQVDSDNIFKFLQRYKLIINDDIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCVNRLLRCPFQSLGCSDGVSNDQIDLEKHLADSMEKHSKIVVNSIETWKLRIEKLEAELASKQNKIEQMTAEMQTIKI 195          

HSP 2 Score: 360.918 bits (925), Expect = 0.000e+0
Identity = 167/168 (99.40%), Postives = 167/168 (99.40%), Query Frame = 3
Query: 1086 EIECQSEMKMSKLCEREKVNQYDFEKRLSEVEKNLNLIDGIFMWKINKIEEIKKCGYIWSEYFYSNANSYRQRLRLDAYGDHLWIRFCLYSSPVDIDLDWPFQAEVTLKVASKLWPNSGKAITKNCTIDKPPFGSCECSDEFKFSYSDFILKGLTLNDIFFVECHIKQ 1589
            EIECQSEMKMSKLCEREKVNQYDFEKRLSEVEKNLNLIDGIFMWKINKIEEIKKCGYIWSEYFYSNANSYRQRLRLDAYGDHLWIRFCLYSSPVDIDLDWPFQAEVTLKVASKLWPNSGK ITKNCTIDKPPFGSCECSDEFKFSYSDFILKGLTLNDIFFVECHIKQ
Sbjct:  277 EIECQSEMKMSKLCEREKVNQYDFEKRLSEVEKNLNLIDGIFMWKINKIEEIKKCGYIWSEYFYSNANSYRQRLRLDAYGDHLWIRFCLYSSPVDIDLDWPFQAEVTLKVASKLWPNSGKTITKNCTIDKPPFGSCECSDEFKFSYSDFILKGLTLNDIFFVECHIKQ 444          

HSP 3 Score: 140.969 bits (354), Expect = 0.000e+0
Identity = 68/69 (98.55%), Postives = 68/69 (98.55%), Query Frame = 2
Query:  827 KPTVENKINEISAELANLVRDDRIDSIWNEIDLMKAEGQNMSRGFEVIKHDIGEKFKLEMNGKLKAMQA 1033
            KPTVENKINEISAEL NLVRDDRIDSIWNEIDLMKAEGQNMSRGFEVIKHDIGEKFKLEMNGKLKAMQA
Sbjct:  208 KPTVENKINEISAELVNLVRDDRIDSIWNEIDLMKAEGQNMSRGFEVIKHDIGEKFKLEMNGKLKAMQA 276          
BLAST of SMED30027571 vs. Planmine SMEST
Match: SMESG000042352.1 (SMESG000042352.1)

HSP 1 Score: 198.364 bits (503), Expect = 6.952e-54
Identity = 93/194 (47.94%), Postives = 139/194 (71.65%), Query Frame = -2
Query: 2050 ISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQKKLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFKNYLLEEINIYIETKRERNVKGDYIKPKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILREL---ESQTRPADFSILTD*HNVLEEDDM 2622
            +  IYV+E+E AWCTQ VI+  ++ + PP+LR   + LLVWDSAST+RAK MK +L+ + I+Q+MIP+G++ YLQ+LDI INKPFK++L  EIN Y E +  RN +G+++KP L +V+  +K +W KIT+ C+ N+L   YLD+ + F  S IA+ +RFGP+I +E+   E+Q R  + +++ D  +V EEDDM
Sbjct:  148 VKRIYVIESEKAWCTQAVIRTWVDFILPPLLRGRNRDLLVWDSASTHRAKDMKNFLAERRIDQIMIPAGISGYLQTLDIAINKPFKDHLRMEINDYFENRMVRNHRGNFVKPGLQEVVNWIKNSWDKITDSCVSNALRTSYLDKKYIFNDSYIARQERFGPMIQQEMDLEENQNR--NQNLIYD--DVPEEDDM 337          
BLAST of SMED30027571 vs. Planmine SMEST
Match: SMESG000029457.1 (SMESG000029457.1)

HSP 1 Score: 119.783 bits (299), Expect = 6.513e-32
Identity = 58/70 (82.86%), Postives = 63/70 (90.00%), Query Frame = -2
Query: 2080 PKL*DVIGSVKAAWSKITNKCIFNSLSAGYLDRSFSFETSAIAKHQRFGPLILRELESQTRPADFSILTD 2289
            PKL DV   VKAAWSKITN+C+ NSL AGYLDRSFSFETSAIAKH+RFGPLIL+ELESQTRPADFSIL +
Sbjct:   26 PKLQDV---VKAAWSKITNECVLNSLHAGYLDRSFSFETSAIAKHERFGPLILKELESQTRPADFSILNE 92          
BLAST of SMED30027571 vs. Planmine SMEST
Match: SMESG000049663.1 (SMESG000049663.1)

HSP 1 Score: 119.783 bits (299), Expect = 9.018e-30
Identity = 69/204 (33.82%), Postives = 114/204 (55.88%), Query Frame = 3
Query:  114 LFRNLYKQFRKSKFMAQVDSDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMAL---RDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCS-DGVSNDQIDLEKHLADSMEKHSKIVVNSIETWKLRIEKLEAELASKQNKIEQM 713
            +F NL+K  R++KF    +SDN              EI S+  C IC+ ++I AC A CGC FC  CI+  +K  DNFC G  + C++  ++       D+  N +IS++IVKCP +NC  K  +  +  H+ +C  R + CPF S+GC  + ++N++I  + HL DS   HSK++++ I  +   +E L+ E    +N++ ++
Sbjct:    1 MFTNLWKMMRENKF----ESDN--------------EISSDLLCRICKRLMIKACNAPCGCRFCSDCIEQYLKENDNFCPGVAKYCQVQKINFTRNVSEDHPANLRISEVIVKCPTQNCETKTELSMMEEHIRTCDKRPISCPFISIGCEINEIANEEI--KAHLNDSNYSHSKLIIDLINNFHNEMESLKNENMELRNEMTEL 184          
BLAST of SMED30027571 vs. Planmine SMEST
Match: SMESG000049621.1 (SMESG000049621.1)

HSP 1 Score: 116.701 bits (291), Expect = 2.598e-28
Identity = 66/204 (32.35%), Postives = 114/204 (55.88%), Query Frame = 3
Query:  114 LFRNLYKQFRKSKFMAQVDSDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFCQQCIDDAVKNGDNFCSGSNEECKLSNLSMAL---RDYRMNRQISKLIVKCPFENCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCS-DGVSNDQIDLEKHLADSMEKHSKIVVNSIETWKLRIEKLEAELASKQNKIEQM 713
            +F NL+K  R++KF    +SDN              EI S+  C IC+ ++I AC   CGC FC  CI+  +K  DNFC G  + C++  ++       D+  N +IS++IVKCP +NC  K  +  +  H+ +C  R + CPF S+GC  + ++N++++   HL +S   HSK++++ I  ++  +E L+ E    +N++ ++
Sbjct:    1 MFTNLWKMMRENKF----ESDN--------------EISSDLLCRICKCLMIKACHTPCGCRFCSDCIEQYLKEDDNFCPGEAKYCQVQKINFTRNVSEDHPANLRISEVIVKCPTQNCETKTELSMMEEHIRTCDKRPISCPFNSIGCEMNEIANEEMNA--HLNESNYWHSKLIIDLINNFRNEMESLKNENMELRNEMTEL 184          
The following BLAST results are available for this feature:
BLAST of SMED30027571 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF62.035e-831.40TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF62.035e-831.40TNF receptor associated factor 6 [Source:HGNC Symb... [more]
POGK5.215e-720.09pogo transposable element derived with KRAB domain... [more]
POGK5.215e-720.09pogo transposable element derived with KRAB domain... [more]
TRAF21.087e-626.12TNF receptor associated factor 2 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30027571 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027571 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf61.019e-729.03gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of SMED30027571 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX914205.23.378e-1526.24pep chromosome:GRCz11:4:64121772:64123545:-1 gene:... [more]
CR352209.13.517e-1526.73pep chromosome:GRCz11:24:26088143:26089609:1 gene:... [more]
CR354398.13.617e-1526.24pep chromosome:GRCz11:7:64150332:64152087:-1 gene:... [more]
traf2b1.096e-627.87Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.137e-627.87Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30027571 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egf5.183e-830.22epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of SMED30027571 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pogk2.025e-822.12pogo transposable element with KRAB domain [Source... [more]
Pogk2.025e-822.12pogo transposable element with KRAB domain [Source... [more]
Pogk2.501e-820.98pogo transposable element with KRAB domain [Source... [more]
Pogk2.501e-820.98pogo transposable element with KRAB domain [Source... [more]
Traf63.497e-831.40TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30027571 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZCC3|TRAF6_BOVIN6.272e-831.40TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|Q9Y4K3|TRAF6_HUMAN9.772e-831.40TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|B6CJY4|TRAF6_CERAT1.244e-731.40TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU1.504e-731.40TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|Q80TC5|POGK_MOUSE1.540e-722.12Pogo transposable element with KRAB domain OS=Mus ... [more]
back to top
BLAST of SMED30027571 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087U5402.920e-8951.76Pogo transposable element with KRAB (Fragment) OS=... [more]
A0A087UID43.378e-8951.76Pogo transposable element with KRAB (Fragment) OS=... [more]
A0A087TJ394.778e-8951.76Pogo transposable element with KRAB (Fragment) OS=... [more]
A0A087UBN26.049e-8950.70Pogo transposable element with KRAB (Fragment) OS=... [more]
A0A087TRQ16.683e-8951.76Pogo transposable element with KRAB (Fragment) OS=... [more]
back to top
BLAST of SMED30027571 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027571 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027571 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027571 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO274268.849e-830.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412433.590e-728.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027571 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000030675.14.724e-1629.52zinc finger protein 37 [Source:NCBI gene;Acc:10116... [more]
traf61.088e-831.86TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30027571 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072057.10.000e+097.95SMESG000072057.1[more]
SMESG000042352.16.952e-5447.94SMESG000042352.1[more]
SMESG000029457.16.513e-3282.86SMESG000029457.1[more]
SMESG000049663.19.018e-3033.82SMESG000049663.1[more]
SMESG000049621.12.598e-2832.35SMESG000049621.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027571 ID=SMED30027571|Name=SMED30027571|organism=Schmidtea mediterranea sexual|type=transcript|length=2893bp
ATTCAAAAATTATTTCTAACCAATTCATCTTATTTGCAACTTGAATTAAG
TTTGAAAAACTAATATTTTAATAAATAATTCAATTATTATGAACTAAGAT
TTTCTGACGTAAATTATTTAGAAATTTATATAAACAATTTAGAAAATCAA
AGTTTATGGCTCAAGTTGATTCTGATAACATTTTTAAATTTCTTCAACGT
TATAAACGGATAATAAATGATGAAATTCCTAGTGAATATAAATGCGTAAT
TTGTCGGAATATTCTAATCAACGCTTGCCAAGCTTCTTGTGGCTGCAATT
TCTGCCAGCAATGTATCGATGACGCCGTTAAAAATGGAGACAATTTCTGT
TCTGGTAGCAATGAAGAATGTAAATTATCTAATTTATCAATGGCGTTGAG
AGATTATCGAATGAATAGACAGATTTCTAAATTAATAGTGAAATGCCCGT
TTGAAAACTGTTCACAGAAATACAATATAATGGATTTATATTGTCATTTG
GAATCGTGTGGGAATCGATTGTTGCGATGTCCATTTCAATCTCTCGGCTG
TTCAGATGGCGTATCAAATGATCAAATCGATTTGGAGAAACACTTGGCAG
ATTCAATGGAGAAACATAGCAAAATTGTCGTAAACTCTATAGAAACTTGG
AAGCTGCGAATTGAGAAACTTGAAGCCGAATTAGCGAGCAAACAGAACAA
AATCGAACAAATGACAGCGGAAATGCAAACAATTAAAGTAGTAAAAGGAT
AATTTGGTAAACGCAATTAAGGGAATTTCTCATTTAGATTGAGCAGCAAG
AATTGCTCAATGAAATGGAGAATTTGAAACCGACAGTCGAGAACAAGATC
AATGAGATCTCGGCTGAACTTGCTAACTTAGTGAGAGATGATCGGATTGA
TAGTATTTGGAATGAGATTGACTTAATGAAGGCAGAGGGACAGAACATGA
GTCGAGGATTCGAGGTAATTAAGCATGACATTGGTGAGAAATTCAAATTA
GAAATGAATGGCAAATTGAAAGCGATGCAAGCGGTATGGAGATATATTGG
GAAATCGGGATCAGATTATAATATTGATTGTGTAGGAGATCGAATGTCAA
TCCGAGATGAAAATGTCGAAGCTTTGTGAAAGAGAGAAAGTGAATCAATA
TGACTTTGAGAAACGACTAAGTGAGGTAGAGAAGAACTTGAATTTGATTG
ACGGGATATTTATGTGGAAAATCAATAAAATAGAGGAAATCAAAAAGTGC
GGATACATCTGGAGTGAATATTTTTACTCGAATGCAAATAGCTACAGACA
GAGGCTGCGATTGGATGCTTATGGGGATCATTTATGGATTCGATTCTGTC
TTTATTCCTCCCCGGTTGACATTGATCTCGACTGGCCATTCCAAGCTGAA
GTCACTTTGAAGGTTGCTAGCAAACTCTGGCCCAATTCCGGCAAGGCTAT
CACAAAGAATTGCACAATCGATAAACCACCATTCGGTTCCTGTGAGTGCA
GTGATGAGTTCAAATTTTCATATTCAGATTTCATCTTGAAGGGCTTGACA
CTCAATGACATTTTCTTTGTCGAGTGTCACATTAAGCAGTGAATCTTTTG
TCATTTCATTATGCGATTTTCATTCTGATATTATCGATTTTGTGCATCAT
CATTTCATTGATTTTCACGTTTATTGAGTATCAGTCATCAACGGATTTTG
TTTTCCGCATCTGATTTATTTCTGCTGAAATATTGATTAACTTTGATAGA
AAAATTATTACAGATCAAAGTGGTAATATTACGGTAGATTGATGTTCAAA
ATTTTGAAATTTGATTTTATCATTTCTAAAAGAATAAAATAATGTTAATT
AAATGTTGCTAATACCGTATTTCTCCAAAATTTAACCCCGGGCTTAAATA
TTTTTTTTTTTTAAATTTTTGTCAAGATACACTTAGGGCTTAATTTCGGG
ATGTTTTCTATTTTTTGGAATAAAAATAAACTTTAAAAAATTAAACAAAT
ATTCAAAATAAAAATATAATCAATTAAAATGTTTTTATTCTAGTACATAC
ATATCATCTTCTTCTAAAACATTATGTTAATCAGTTAAAATTGAAAAATC
AGCAGGTCTTGTTTGCGATTCTAACTCCCTTAAAATCAACGGACCAAAAC
GTTGATGTTTAGCAATTGCTGAAGTCTCGAATGAAAAGGATCTGTCCAAA
TAACCGGCACTTAAAGAGTTGAAAATGCATTTATTTGTGATTTTACTCCA
AGCTGCTTTTACCGAACCAATAACATCCTATAATTTAGGTTTGATATAAT
CACCTTTCACATTACGTTCTCTTTTGGTTTCAATATAGATGTTAATTTCT
TCCAGAAGATAATTCTTAAATGGCTTATTTATGCCAATATCCAAACTTTG
TAAATATGCTGTCATGCCGGATGGAATCATGACTTGATTAATATTCTGAT
TCGAGAGATACTCTTTCATTGTTTTAGCTCGGTATGTACTGGCAGAGTCC
CACACCAGTAGTTTCTTTTGATTGTGCCGTAAAACTGGTGGAAACATCAA
ATTGATCCTTATTTTAATAACATCTTGGGTACACCAAGCATTTTCAGTTT
CTAAGACGTAAATTTCAGAAATATTATTGATCATTTCCGTTTTTTCTTTC
GTATTCAGCACAGGAGTTAATTTCTTGCTATTACAATCAATGACAAGAAT
ACATGTAACTCTTGTATTTTCATACCCGGTTAATGAAATACTGATCGACG
TAGCCCCTTTTCGATCAATTGTTGTTTGTACAGCCTGGGCAGAAAATACC
GATGTTTCGTCCATAGCAATTATATTTTATGGTTGATATTGTGCAAAATT
TAAATTATCCATGAACGTTTTAAAAAATAATGCTCGTTTGATG
back to top

protein sequence of SMED30027571-orf-1

>SMED30027571-orf-1 ID=SMED30027571-orf-1|Name=SMED30027571-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MAQVDSDNIFKFLQRYKRIINDEIPSEYKCVICRNILINACQASCGCNFC
QQCIDDAVKNGDNFCSGSNEECKLSNLSMALRDYRMNRQISKLIVKCPFE
NCSQKYNIMDLYCHLESCGNRLLRCPFQSLGCSDGVSNDQIDLEKHLADS
MEKHSKIVVNSIETWKLRIEKLEAELASKQNKIEQMTAEMQTIKVVKG*
back to top

protein sequence of SMED30027571-orf-2

>SMED30027571-orf-2 ID=SMED30027571-orf-2|Name=SMED30027571-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MKMSKLCEREKVNQYDFEKRLSEVEKNLNLIDGIFMWKINKIEEIKKCGY
IWSEYFYSNANSYRQRLRLDAYGDHLWIRFCLYSSPVDIDLDWPFQAEVT
LKVASKLWPNSGKAITKNCTIDKPPFGSCECSDEFKFSYSDFILKGLTLN
DIFFVECHIKQ*
back to top

protein sequence of SMED30027571-orf-3

>SMED30027571-orf-3 ID=SMED30027571-orf-3|Name=SMED30027571-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=179bp
MDETSVFSAQAVQTTIDRKGATSISISLTGYENTRVTCILVIDCNSKKLT
PVLNTKEKTEMINNISEIYVLETENAWCTQDVIKIRINLMFPPVLRHNQK
KLLVWDSASTYRAKTMKEYLSNQNINQVMIPSGMTAYLQSLDIGINKPFK
NYLLEEINIYIETKRERNVKGDYIKPKL*
back to top

protein sequence of SMED30027571-orf-4

>SMED30027571-orf-4 ID=SMED30027571-orf-4|Name=SMED30027571-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MENLKPTVENKINEISAELANLVRDDRIDSIWNEIDLMKAEGQNMSRGFE
VIKHDIGEKFKLEMNGKLKAMQAVWRYIGKSGSDYNIDCVGDRMSIRDEN
VEAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013323SIAH-type
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR008974TRAF-like
IPR004875DDE_SF_endonuclease_dom
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0005164tumor necrosis factor receptor binding
GO:0016740transferase activity
GO:0019901protein kinase binding
GO:0031435mitogen-activated protein kinase kinase kinase binding
GO:0031624ubiquitin conjugating enzyme binding
GO:0031625ubiquitin protein ligase binding
GO:0031996thioesterase binding
GO:0042802identical protein binding
GO:0042826histone deacetylase binding
GO:0043422protein kinase B binding
GO:0046872metal ion binding
GO:0047485protein N-terminus binding
GO:0061630ubiquitin protein ligase activity
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0002376immune system process
GO:0002726positive regulation of T cell cytokine production
GO:0002755MyD88-dependent toll-like receptor signaling pathway
GO:0002756MyD88-independent toll-like receptor signaling pathway
GO:0006461protein complex assembly
GO:0006955immune response
GO:0006974cellular response to DNA damage stimulus
GO:0007165signal transduction
GO:0007249I-kappaB kinase/NF-kappaB signaling
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0007254JNK cascade
GO:0009887animal organ morphogenesis
GO:0045084positive regulation of interleukin-12 biosynthetic process
GO:0016579protein deubiquitination
GO:0019221cytokine-mediated signaling pathway
GO:0019886antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0030316osteoclast differentiation
GO:0031293membrane protein intracellular domain proteolysis
GO:0031398positive regulation of protein ubiquitination
GO:0031666positive regulation of lipopolysaccharide-mediated signaling pathway
GO:0032147activation of protein kinase activity
GO:0032743positive regulation of interleukin-2 production
GO:0034162toll-like receptor 9 signaling pathway
GO:0038095Fc-epsilon receptor signaling pathway
GO:0042088T-helper 1 type immune response
GO:0042102positive regulation of T cell proliferation
GO:0042475odontogenesis of dentin-containing tooth
GO:0042981regulation of apoptotic process
GO:0043011myeloid dendritic cell differentiation
GO:0043065positive regulation of apoptotic process
GO:0043066negative regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043507positive regulation of JUN kinase activity
GO:0045410positive regulation of interleukin-6 biosynthetic process
GO:0045453bone resorption
GO:0045672positive regulation of osteoclast differentiation
GO:0045892negative regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0046849bone remodeling
GO:0048468cell development
GO:0048661positive regulation of smooth muscle cell proliferation
GO:0050852T cell receptor signaling pathway
GO:0050870positive regulation of T cell activation
GO:0051023regulation of immunoglobulin secretion
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0051865protein autoubiquitination
GO:0070423nucleotide-binding oligomerization domain containing signaling pathway
GO:0070498interleukin-1-mediated signaling pathway
GO:0070534protein K63-linked ubiquitination
GO:0070555response to interleukin-1
GO:0071222cellular response to lipopolysaccharide
GO:2000679positive regulation of transcription regulatory region DNA binding
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0000187activation of MAPK activity
GO:0000209protein polyubiquitination
GO:0001503ossification
GO:0001843neural tube closure
GO:0002223stimulatory C-type lectin receptor signaling pathway
GO:0002224toll-like receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005811lipid particle
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005938cell cortex
GO:0009898cytoplasmic side of plasma membrane
GO:0010008endosome membrane
GO:0035631CD40 receptor complex
GO:0043234protein complex
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 162..196
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 13..126
coord: 113..193
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 21..100
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..128
e-value: 5.0E-15
score: 57.5
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 13..126
coord: 113..193
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 95..141
score: 8.679
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 92..156