Death domain-containing protein

Overview
NameDeath domain-containing protein
Smed IDSMED30027567
Length (bp)3183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Death domain-containing protein (SMED30027567) t-SNE clustered cells

Violin plots show distribution of expression levels for Death domain-containing protein (SMED30027567) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Death domain-containing protein (SMED30027567) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Death domain-containing protein (SMED30027567) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027567

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30027567SMESG000007063.1 PL06020B1B12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Death domain-containing protein vs. TrEMBL
Match: R7TUB7 (Death domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221462 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 9.837e-30
Identity = 108/429 (25.17%), Postives = 195/429 (45.45%), Query Frame = 1
Query:  298 RIFGEKLDVEVT--KKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPP-KKPMEYFIPSIKE-TNRY-CFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSL--QFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGL------------------VFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTN 1509
            RIF  +L  E++  KKGGE  L  G  L I   +  KK V++  +V P+ R  +   L   E L+SEIFL+ + +   KKP+   +P  +E T+ Y   L+    E   W         S   +F +D  G F +      E  ++   G L+N+ +   VS+R PK +   D T  +Q           +   +P+++ ++L AS + +   PS+  +++R +TIKLPLP   +E       +    ++ ++      WE I+A I +TK++  FD+K    + +   +  R  +++ +   LE  N +++G ++ FL+ + K W +W+E +  E+   V + R + G                   VF + +   + +     EKK  RK +           +  +G +F+  + GDV + N ++ 
Sbjct:  130 RIF-HRLIAELSPGKKGGEFSLPFGGKLIIPSGLLGKKDVVTCCMVSPSDRHKYQPNLEADEHLLSEIFLIRTSMRCMKKPIFVSLPFYQENTDLYDSSLLWRKIETDDWNTKQCTTQKSRNFEFETDVGGIFVMTSHLKKEVFNVPVQGCLYNSTLSHQVSVRFPKKATDVDITCEIQITSLNRDNMPNLLRDFPHDMADLLVASDIFTIK-PSVAREYRRALTIKLPLPQMDDE-------DFPKDDIGVMQMTDAGWELIEAPIKFTKSSVMFDTKFLTKYCVALAKPGRRKRLKEAFKHLEAENCVVRGDVVAFLHLQEKLWTLWMECIPIERLAAVTEKRLKQGFVKVRVTEDYLQQEDASKPVFRQTWRSRRKQPVETEEKKVKRKDL-----------DFVNGKVFNVDVSGDVVVCNEDSQ 538          

HSP 2 Score: 79.337 bits (194), Expect = 3.195e-11
Identity = 41/112 (36.61%), Postives = 70/112 (62.50%), Query Frame = 1
Query: 2515 HKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSEVTYKILVNWK-KSVVAENRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFF 2847
             ++ ++ K+L+ RS   L+  +E GLTLA+HL +SDS ITG+GFD+L+   ++ ++TY+IL+ WK KS +     R +  LV++L+ M     + +V    + N+EL  + F
Sbjct:  661 RQIIRESKILTGRSLMNLAKEIEQGLTLAIHLDISDSCITGMGFDALANGFSLVDITYRILLLWKRKSGLRFKGDRQVQALVQALEEMGRRDTARVVAEQHKLNQELTPECF 772          
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A1S3IPS7 (uncharacterized protein LOC106166271 OS=Lingula unguis OX=7574 GN=LOC106166271 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.868e-23
Identity = 108/401 (26.93%), Postives = 176/401 (43.89%), Query Frame = 1
Query:  334 KKGGEIKLIGGCTLKIEENIF-NKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLV-FSKVPPKKPMEYFIPSIKETNRY--CFLISCTTENFQW--VAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISF--GFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPPKSEAARKSEKK-----NLRKSMIPSSADCG-RIVELSDGMIFHFKLEGDVQLK 1494
            KKGG+  L     L I  N    KK  I+  L+ P+ R      L   E L SEIFL  F+    K  + + +P  +    Y    L     E  +W  + MT  D     + F S+  G FAIV +   E+  I+  G ++N ++   +S+R PK + +      +Q      +    +   +P E    L A+ +  F    P   FKR +T+KLPL    EE     EN +   ++ ++ K    WE ++  + +T+   +FD K+F  F + + R  R+  +  +L  +E  +N IK   +  +  E K W I ++ V  +K   +   R+E G V I+    P++E  +          N R+   P     G +  E +DG     KL+G+VQ+K
Sbjct:   38 KKGGDFNLPLHGKLTIPPNCLQGKKDAITCTLLTPSDRNIHMPSLTRDEHLASEIFLFEFNGTKMKGSLVFILPYYEVDYTYYDIVLKQKKPEADEWESIDMTSSDAEKRLVTFESETLGAFAIVSRLKLESFDISPQGCIYNAKIGKYISIRFPKKATETPLLCGIQIHPTDQNQLQVIKSEHPTEFYEFLGATDIFEFRHNGPRPDFKRPVTMKLPLTSVFEED----ENTE---DICIMLKTVKGWEVLENPLKFTRQNVSFDVKIFTKFCIAKSRPGRQRCLPEALKIIEERSNKIKVDHVAMVKLEQKYWSILVQCVQKDKRDDIVAKRKEKGWVEIKL---PETETEQDDNSSGFPRFNSRRRHKPVEQKSGCKDTEYADGKEILLKLQGEVQVK 428          

HSP 2 Score: 81.2629 bits (199), Expect = 9.524e-12
Identity = 44/109 (40.37%), Postives = 65/109 (59.63%), Query Frame = 1
Query: 2521 VFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSEVTYKILVNWKKSVVAENRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFF 2847
            V K+ K +S RS   L+  +E GLTLAV+L + DS ITGIGFD+LS   ++ +VTYKIL+ WK+    E   R + +L   L+ M    ++ ++    ++N EL  D F
Sbjct:  600 VPKESKTMSGRSLMTLAKEIEQGLTLAVYLDIPDSTITGIGFDALSNGLSLIDVTYKILMYWKRKTKKE---RQVEELAYGLRGMGRPDVAAVLMERHKQNLELTPDCF 705          
BLAST of Death domain-containing protein vs. TrEMBL
Match: K1PQA4 (Death domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10007323 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 4.691e-23
Identity = 102/403 (25.31%), Postives = 182/403 (45.16%), Query Frame = 1
Query:  334 KKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPP-KKPMEYFIPSIK---ETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQ--FKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPPKSEAA---RKSEK--KNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTN 1509
            KKGG   L  G  L + E +F KK  I+  +  P++R  +   L   E + SEI+ + S + P KK +   IP  +   E N        + EN +WV +         ++   D+ G F +      E   +   G L+N  +   +S+R PK +        +Q    P+       +  P E  +++ A+  I    PS    FKR +++KLPLP   E   +N        ++ +L K +  WE +D++  +T+ T TFD+K    F +++ + +R+ ++  +   LE  NN  KG I+ FL  + K W++ +E +   K     +   E G   + +    K E     R+ +K  +  R+  +P +       E++DGM + F +  D+++ N+ +N
Sbjct:   71 KKGGNFGLPNGGKLILPEGLFGKKDTITCQVASPSQRWKYYPTLPSYEHITSEIYTLQSTMHPLKKSVIIQIPYYQIETEHNEINVKGKWSDEN-EWVDVGFLKKEDCSVELEVDRLGIFIVTFTPKKEIFDVTPQGCLYNAHISRYISVRFPKKAHDKPFQCAIQINPIPSDKLQLAKELSPGETADLILATEFIDL-IPSTPCVFKRAVSVKLPLPTGVEVEEEN-------DDIAVLQKTENGWELVDSKYKFTRTTVTFDTKSLTKFCVMQSKPDRKKRLPPAAQVLENRNNREKGEIVAFLNLQEKLWFLVLECMPQSKLESRVKEMSEKGFKHVVKEIVKKDEGTNFFRRPQKFQQPTRQLQVPPTC------EINDGMKWEFSVVDDIKV-NSESN 457          

HSP 2 Score: 84.3445 bits (207), Expect = 9.458e-13
Identity = 45/107 (42.06%), Postives = 69/107 (64.49%), Query Frame = 1
Query: 2527 KDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSEVTYKILVNWKKSVVAENRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFF 2847
            ++ KVLS +S + LS  V  GLTLAVHL + DS ITG+GFD++S   +M++VTYKIL+ WK+ +  + +   ++ L  +L+ M  + I+ IV    + N+EL  D F
Sbjct:  588 RESKVLSGKSLRNLSKLVPEGLTLAVHLNLPDSTITGLGFDAISNGLSMADVTYKILLYWKR-MCKDKKDGAVNSLTNALRDMGREEIANIVFERHRDNKELSPDAF 693          
BLAST of Death domain-containing protein vs. TrEMBL
Match: V4BIQ2 (Death domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_234556 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.232e-22
Identity = 101/403 (25.06%), Postives = 177/403 (43.92%), Query Frame = 1
Query:  334 KKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVP-PKKPMEYFIPSIKETNRYCFL--ISCTTENFQWVA---MTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSL--QFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERF-TPPKSEAARKSEKKNL----RKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNN 1503
            KKGG   L  G  L + E  FNKK  I+  +  P+ R     +L   E + SEIF + S V   K P+   +P     N  C +          +WV    + K D     ++   D+ G F +      E  ++   G L N R+   +S R P+ + +++    ++ L  P    +E+   +  E  +++  +  I    PS+   F+R +T+KLPLP    EI K  E N     + +L K    WE +++   +T+ T + D K  G F +      R+ ++R ++  +E  N+  KG I+++L  + KSW   +E +   KA      R++ G   I +    PK E  R   ++ +     K + P   D      + DG+ +   +  D+++ N++
Sbjct:   51 KKGGNFGLPLGAKLTVPEGNFNKKESITCQVTSPSTRWRHCPQLPADEHITSEIFKLTSSVHIMKTPIIVQLPYYPLQNDKCEINVKGKWRGELEWVDVGFLKKSDTKPPSVELELDRLGQFIVTFTCKQEIFNVTSQGCLHNARISRYISCRFPRKATESNLQCAIKILPIPQEKLEEVKKEHARECNDLVTTTEFIDI-IPSIPCNFRRSVTVKLPLPS-GIEIEKEQEPN-----VGVLLKNGSAWELVESHQKFTRTTVSVDVKSLGRFCVAISNPERKPRLREAIRFVEGSNDTDKGEIVLYLSLQEKSWEGVVECLPEHKAKSRIADRQDRGFKVINKVKVVPKVEEKRVYSRRYIPPKETKPVEPEGFD------IYDGLSWEICVGSDIKITNDS 440          

HSP 2 Score: 86.6557 bits (213), Expect = 1.807e-13
Identity = 43/107 (40.19%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 2527 KDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSEVTYKILVNWKKSVVAENRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFF 2847
            ++ +V++ +S   LS  V  GLTLAVHL + DS ITG+GFD++S   TM++VTYKIL+ WK+  + + R   +++LV +L  M    I  I+ +    N+EL E++ 
Sbjct:  572 REARVITGKSLMNLSRKVPEGLTLAVHLDLPDSTITGLGFDAISNGLTMADVTYKILLYWKRK-LKDKRDSAVNELVSALGSMGRPDIGAIILHCHHDNKELTEEYL 677          
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A2T7P261 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12677 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.547e-16
Identity = 79/316 (25.00%), Postives = 146/316 (46.20%), Query Frame = 1
Query:  337 KGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPPK-KPMEYFIPSIKETNRYCFL---ISCTTENFQWVAMT---KFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGF-PSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYI 1260
            KGG   L  G  +++ E + +KK V+   +VPP++R  + +    +E++ SEIF++   V  K K + + +P    T+R   +   +  + E   WV +    K    +  ++   D+ G F + ++   E  S+   G L+N R+   +SLR PK +        ++    P      + D +P E  +I   + +I        +F+R  TIKLPLP   E         +   ++ +L K +  WE++     +T+ T   + K    F +V+ +  R+ K++ +L+ +E      KG + VFL  + KSW +
Sbjct:  110 KGGIFLLAMGAKVEMPEGVTSKKEVVECLVVPPSQRWQYELSFP-EEYVTSEIFVLSGNVRCKDKKILFHLPYYPPTDRMREINVKVRWSGEA-NWVDINFPRKQKDEAPVVELELDRLGTFVVTQRHRREEFSVTPYGCLYNPRIARHLSLRFPKKALDTTVNYAIRVYPIPEERVQFVKDKFPLECADIQKVTEIIDITPDKECEFRRPATIKLPLPEGVEV------EEEDSNDVFVLRKVKNLWENVGNIHKFTRYTVAVEVKNPSRFCVVKSKPERDRKMKEALAVVEEHLEREKGEVSVFLSIKEKSWMV 417          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 1548.1 bits (4007), Expect = 0.000e+0
Identity = 829/983 (84.33%), Postives = 842/983 (85.66%), Query Frame = 1
Query:   67 MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVXXXXXXXXXXXXXXAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFXXXXXXXXXXXXXXEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSXXXXXXXXXXXXESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSEVTYKILVNWKKSVVAENRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSKNKRRDSHIKAER----KKSKTLDMDNILNSMAD 3003
            MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKT+                               F KVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL                               F +  S +              VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQ    Y  + +   V                                  +   V +NRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSKNKRRDSHIKAE+    ++   +D+   LN + D
Sbjct:    1 MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTI-------------------------------FHKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL-------------------------------FFFILSLNH-------------VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQC---YYRNWVRFVVR---------------------------------RPDNVGKNRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSKNKRRDSHIKAEQDICSRQKADIDLIQDLNEIQD 872          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 1528.07 bits (3955), Expect = 0.000e+0
Identity = 820/974 (84.19%), Postives = 833/974 (85.52%), Query Frame = 1
Query:   94 MNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVXXXXXXXXXXXXXXAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFXXXXXXXXXXXXXXEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSXXXXXXXXXXXXESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSEVTYKILVNWKKSVVAENRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSKNKRRDSHIKAER----KKSKTLDMDNILNSMAD 3003
            MNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKT+                               F KVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL                               F +  S +              VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQ    Y  + +   V                                  +   V +NRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSKNKRRDSHIKAE+    ++   +D+   LN + D
Sbjct:    1 MNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTI-------------------------------FHKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL-------------------------------FFFILSLNH-------------VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQC---YYRNWVRFVVR---------------------------------RPDNVGKNRPRMISDLVESLKIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSKNKRRDSHIKAEQDICSRQKADIDLIQDLNEIQD 863          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 1493.02 bits (3864), Expect = 0.000e+0
Identity = 787/871 (90.36%), Postives = 790/871 (90.70%), Query Frame = 1
Query:   67 MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVXXXXXXXXXXXXXXAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFXXXXXXXXXXXXXXEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSXXXXXXXXXXXXESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSE 2679
            MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKT+                               F KVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL                               F +  S +              VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSE
Sbjct:    1 MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTI-------------------------------FHKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL-------------------------------FFFILSLNH-------------VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSE 796          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 1467.6 bits (3798), Expect = 0.000e+0
Identity = 776/860 (90.23%), Postives = 779/860 (90.58%), Query Frame = 1
Query:  100 MISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVXXXXXXXXXXXXXXAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFXXXXXXXXXXXXXXEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSXXXXXXXXXXXXESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSE 2679
            MISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKT+                               F KVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL                               F +  S +              VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSE
Sbjct:    1 MISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTSNVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGGCTLKIEENIFNKKTI-------------------------------FHKVPPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPLPVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL-------------------------------FFFILSLNH-------------VVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQSPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHIVINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSSMERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKIFLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYENQKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADIAKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPTLESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTMSE 785          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000078437.1 (SMESG000078437.1)

HSP 1 Score: 143.665 bits (361), Expect = 8.925e-35
Identity = 93/330 (28.18%), Postives = 166/330 (50.30%), Query Frame = 1
Query:  565 NRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFP---------SLQFKRHITIKLPLPVWAEEI-------RKNCENNQKGGE--LMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWIEMVSFEKATVVRQSREESGLVFIERFTPP-KSEAAR---KSEKKNLRKSMIPSSADCGRIVELSDGMIFHFKLEGDVQ 1488
            + YC+      E+ QW  + +++  ++ IK ++  + +  IV++ P + ISI+  GGL  T++ P++SLR+ K + + +    +Q    P    D+       +L + LN S++   G           +  F+R IT++LPLP W   I        KN   +QK  +     L K    W  +++ + +TKN+  FD K FG+F+ V+ R NRE K+  +++ +E +  I  G+IL FL+ +S +W++W E+V   K    R   E  G V++E++  P K E  R   K ++K  R  +I       +  EL + + F  K+ G+++
Sbjct:  115 DNYCY--PLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSSFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQR-----KTFELLENLQFKLKINGEIE 437          

HSP 2 Score: 65.4698 bits (158), Expect = 2.105e-10
Identity = 41/111 (36.94%), Postives = 65/111 (58.56%), Query Frame = 1
Query: 2527 KDLKVLSNRSFQVLSHYVEHGLTLAVHLQMSDSVITGIGFDSLSADQTM---SEVTYKILVNWKKSVVAENRPR---MISDLVESLKIMKLDLISEIVNYAAQRNEELVED 2841
            K+ K++S RSF  L+  +  GL LAV+L + D+ I GIGFD+LS   TM   +  TYKIL+ WKK +++ N+ +    +  LV  LK +  + + E+V     + +E+  D
Sbjct:  690 KEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQ-MTMNGSNNTTYKILILWKK-MISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITID 798          
The following BLAST results are available for this feature:
BLAST of Death domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TUB79.837e-3025.17Death domain-containing protein OS=Capitella telet... [more]
A0A1S3IPS71.868e-2326.93uncharacterized protein LOC106166271 OS=Lingula un... [more]
K1PQA44.691e-2325.31Death domain-containing protein OS=Crassostrea gig... [more]
V4BIQ23.232e-2225.06Death domain-containing protein OS=Lottia gigantea... [more]
A0A2T7P2612.547e-1625.00Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Death domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007063.10.000e+084.33SMESG000007063.1[more]
SMESG000007063.10.000e+084.19SMESG000007063.1[more]
SMESG000007063.10.000e+090.36SMESG000007063.1[more]
SMESG000007063.10.000e+090.23SMESG000007063.1[more]
SMESG000078437.18.925e-3528.18SMESG000078437.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027567 ID=SMED30027567|Name=Death domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3183bp
ACAAATCAATGATTGCATAACAAAATTAAGAGATAGACAAAAAATGACTG
GAAATTTATATGGTTAATGGGCCTCGATCGAAACTTTAAATATATGAATA
TGATTTCAACATCAAGATGTCATGAAACTTTTAAAGAAAGATCAAACCAA
ACCGATAGTTCATTGCCGCGTTACGAAATCGGAATTAAATTAGAAAAATT
CAATCTTAACACTTCGAATGTTAAAAAAAAACACAAAACAAAAAAAGGAA
CTTCTAAAAAGAAAGCTGTTGAATTTCAACCTTTAATCATTCCAGCTAGA
ATTTTTGGAGAAAAACTTGACGTTGAAGTTACTAAAAAAGGGGGAGAAAT
AAAGCTAATTGGAGGATGCACATTGAAAATAGAAGAAAATATTTTCAATA
AAAAGACAGTAATCTCAAGTTATCTAGTACCACCAAACAAAAGACAAGAT
TTTCCAGTTAAATTAAATTATCAAGAATTTTTAATAAGCGAAATATTTCT
GGTTTTCAGCAAGGTTCCACCAAAAAAGCCAATGGAATACTTTATTCCAA
GTATTAAAGAAACTAATCGCTACTGCTTTTTGATATCCTGCACTACTGAA
AACTTTCAATGGGTCGCGATGACAAAATTTGATTTTACTTCCGAAGGAAT
AAAATTTTCCAGTGATAAATGGGGCTATTTTGCAATCGTAGAGAAGCAGC
CTTTTGAAAATATAAGTATAAATTTTAATGGAGGTCTTTTTAATACTAGA
GTTCACCCTATGGTGTCATTACGAATACCAAAAAACTCATGCCAAGCAGA
TGAAACAATTTATCTTCAATATTTACAAAATCCAACTTCAACTTTTGACG
AGATGTCTGATTGCTATCCATATGAATTGGGAAACATTCTAAATGCATCA
TCAATGATATCATTTGGATTTCCATCACTTCAATTTAAAAGGCACATAAC
AATTAAGTTGCCTTTGCCTGTTTGGGCAGAAGAAATAAGGAAAAATTGTG
AAAATAATCAAAAGGGTGGAGAACTAATGCTTCTTTGTAAGCGTCAAGGT
ACGTGGGAATCTATTGACGCAAGAATCAATTATACAAAAAACACATTTAC
ATTTGACTCTAAAGTCTTCGGAACATTTATTTTAGTTGAGCCACGTAGTA
ACCGAGAGGGCAAGATTCGGCATTCTTTATCTCGATTAGAATATGTGAAT
AACATAATTAAAGGAGTTATATTAGTTTTTCTTTATTTTGAGTCTAAATC
ATGGTATATTTGGATTGAAATGGTTTCTTTTGAAAAGGCAACAGTTGTTA
GGCAATCTAGAGAAGAAAGCGGATTAGTATTTATTGAAAGGTTTACTCCT
CCAAAATCTGAAGCAGCAAGAAAATCTGAAAAAAAGAATCTTCGAAAATC
AATGATACCATCATCGGCCGATTGCGGTAGAATTGTTGAACTATCCGATG
GAATGATATTTCACTTCAAATTAGAAGGAGATGTTCAATTAAAAAATAAC
AACACAAATATTCCAATAATCTCCAGAGCCTTTCAAAAAACGATAGATGC
TATGTTGAAAAAACAGTCTCCAACTCCTCTTACAAATTTACAGAGACAGA
TCTCTCACGATTTGATTGATGTCGATGAACCCGATCATTTTTTGCTAAAT
TTAGGTAAAAAGAAAGTGGACGAGAGTCATCTTTTACCAACTACAGATAA
TGAAGAGTCACATATTGTTATAAATGGGCCCCAAAATGTTTCGATTATTT
TTTATAGAACGTTGTCTGAAAACTATCGAATAATTGAAATCGAGCCTTTA
CTGAAGGCAAATATTGAAGACGATGTCGCTTCACGTTGGACTCAAAAAGA
AATAATTAAAAGCAGCATGGAGCGAATGTCTGAAGCAGAAACCGAAACTA
TTCAATCAGAAGATCTGAATGAAGTTGACACAGTTAACAAGGATAGATTC
AGCATTGCATCTGATAGTAGTGATATAAGCAGCAGTGTGAGTGAAATAAT
GACTGTCAATAAAATATTTCTGTCACAATCTCCTCAAGCAAAATGTCGAG
TGGCTCTCGAAAATGACGAAGAAATCGACCATACATTTACTGGTTTACTG
ACAATAACTAGAGATTCTTTCTGTTTCCAATTTCCTCCAAATCAGTTAGG
GCCTGAATATGAAAATCAAAAAATGATTAACAATGAAACTAAAATGAAAA
TTTTGAAATCATATTTATCACATGAACTTCAATCAACTTACCAATATAAA
TTTTATTTAGAACCAGAAGAAATGAGAGAATATTTAGGATTCCCAAAACC
TTCAGCTGCAGACATTGCTAAGGCAAAACAGATCAAAGCTGAAAGTCTTG
TAAATGTTTACTTGAAAGACGTCAATTTAACTGATGTTGATTCCAAAATC
TTAAATAAAGCAAAGAAAAGCGCAATGAAGCACATTGTTGATAAAAGTAG
TATGACTTTTCCAACGTTAGAATCGACAGATGCAAATATGAAAAAACCAA
AAAACAGCGTTCAACATAAAGTTTTTAAGGATCTCAAAGTATTATCTAAT
CGCAGTTTTCAAGTACTTTCTCATTATGTTGAACATGGATTGACATTGGC
TGTTCATTTACAAATGTCTGATAGTGTTATTACCGGAATTGGGTTCGATT
CGTTGTCCGCAGACCAGACAATGTCGGAAGTAACATATAAAATTCTCGTT
AATTGGAAGAAATCGGTTGTTGCAGAAAATCGGCCCAGGATGATTTCAGA
TTTAGTTGAATCATTAAAAATAATGAAATTAGATTTAATATCTGAAATTG
TTAATTATGCAGCTCAAAGAAATGAAGAACTTGTTGAAGATTTCTTTCTA
AAACCACAAGAGTATTTGGTTAGAAAACCGAGTCCAGATCATGGCAAACA
TACTAAAGATTCCAAAAACAAAAGAAGAGATTCACACATTAAAGCAGAAC
GTAAAAAATCCAAAACCCTGGACATGGACAACATATTAAATTCGATGGCA
GACAAATAAACCTGCAGATTATAAATTGATATAAATAGTTTAAATAATCA
GAAATTATCTGATAGATTTAGATGTGTTATTAAACATCTTTTTTTAAATT
TCTGTAAATTTAAATATAAGACAGCTTAAATATATTATATCATTATGCTG
TATTAATAGTTATTATAAAACAAAAATTTGAAA
back to top

protein sequence of SMED30027567-orf-1

>SMED30027567-orf-1 ID=SMED30027567-orf-1|Name=SMED30027567-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=981bp
MGLDRNFKYMNMISTSRCHETFKERSNQTDSSLPRYEIGIKLEKFNLNTS
NVKKKHKTKKGTSKKKAVEFQPLIIPARIFGEKLDVEVTKKGGEIKLIGG
CTLKIEENIFNKKTVISSYLVPPNKRQDFPVKLNYQEFLISEIFLVFSKV
PPKKPMEYFIPSIKETNRYCFLISCTTENFQWVAMTKFDFTSEGIKFSSD
KWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYL
QYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFPSLQFKRHITIKLPL
PVWAEEIRKNCENNQKGGELMLLCKRQGTWESIDARINYTKNTFTFDSKV
FGTFILVEPRSNREGKIRHSLSRLEYVNNIIKGVILVFLYFESKSWYIWI
EMVSFEKATVVRQSREESGLVFIERFTPPKSEAARKSEKKNLRKSMIPSS
ADCGRIVELSDGMIFHFKLEGDVQLKNNNTNIPIISRAFQKTIDAMLKKQ
SPTPLTNLQRQISHDLIDVDEPDHFLLNLGKKKVDESHLLPTTDNEESHI
VINGPQNVSIIFYRTLSENYRIIEIEPLLKANIEDDVASRWTQKEIIKSS
MERMSEAETETIQSEDLNEVDTVNKDRFSIASDSSDISSSVSEIMTVNKI
FLSQSPQAKCRVALENDEEIDHTFTGLLTITRDSFCFQFPPNQLGPEYEN
QKMINNETKMKILKSYLSHELQSTYQYKFYLEPEEMREYLGFPKPSAADI
AKAKQIKAESLVNVYLKDVNLTDVDSKILNKAKKSAMKHIVDKSSMTFPT
LESTDANMKKPKNSVQHKVFKDLKVLSNRSFQVLSHYVEHGLTLAVHLQM
SDSVITGIGFDSLSADQTMSEVTYKILVNWKKSVVAENRPRMISDLVESL
KIMKLDLISEIVNYAAQRNEELVEDFFLKPQEYLVRKPSPDHGKHTKDSK
NKRRDSHIKAERKKSKTLDMDNILNSMADK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 977..980
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 212..366
e-value: 9.0E-12
score: 46.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 937..980