CRAL-TRIO domain-containing protein

Overview
NameCRAL-TRIO domain-containing protein
Smed IDSMED30027542
Length (bp)1245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CRAL-TRIO domain-containing protein (SMED30027542) t-SNE clustered cells

Violin plots show distribution of expression levels for CRAL-TRIO domain-containing protein (SMED30027542) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CRAL-TRIO domain-containing protein (SMED30027542) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CRAL-TRIO domain-containing protein (SMED30027542) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027542

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027542SMESG000019717.1 Contig53672newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027542SMESG000019717.1 Contig53672uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30027542SMESG000019717.1 dd_Smed_v6_1619_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30027542SMESG000019717.1 dd_Smed_v6_1619_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027542SMESG000019717.1 dd_Smed_v4_1619_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: CLVS2 (clavesin 2 [Source:HGNC Symbol;Acc:HGNC:23046])

HSP 1 Score: 56.225 bits (134), Expect = 3.977e-8
Identity = 39/176 (22.16%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR+++  EA + L    E+R++   +F   ++    PG+    + GF       D  GR ++    +  +  + ++ + +  ++  +E   +  ++ ++ FV IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   49 TDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMF--KSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: SEC14L5 (SEC14 like lipid binding 5 [Source:HGNC Symbol;Acc:HGNC:29032])

HSP 1 Score: 55.4546 bits (132), Expect = 1.220e-7
Identity = 45/182 (24.73%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF----DESGRPVIYSSFSQANCR---KNSVEESIA-HVIYL-------IENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            DE +LRFL+A +++L +A + L  ++ WR++ +   +  T+    P L      G     D  GRP+      Q + +   K   EE++  HV+ +        E +T+ +   IS++  ++D  G+ ++       K    + +++ + YPE LG +  V   ++F  +W  I  F++ NT
Sbjct:  264 DEHILRFLRAHDFHLDKAREMLRQSLSWRKQHQVDLLLQTW--QPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENT 443          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: SEC14L1 (SEC14 like lipid binding 1 [Source:HGNC Symbol;Acc:HGNC:10698])

HSP 1 Score: 55.4546 bits (132), Expect = 1.309e-7
Identity = 42/181 (23.20%), Postives = 85/181 (46.96%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQANCR---KNSVEESIAHVIYLI--------ENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            DE +LRFL+AR++N+ +A + +  ++ WR++ +  +I  T+   +  L      G+   D+ GRP+      Q + +   +   EE++   +  I        E  TK     IS++  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  243 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQV-LQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNT 422          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: SEC14L1 (SEC14 like lipid binding 1 [Source:HGNC Symbol;Acc:HGNC:10698])

HSP 1 Score: 55.4546 bits (132), Expect = 1.309e-7
Identity = 42/181 (23.20%), Postives = 85/181 (46.96%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQANCR---KNSVEESIAHVIYLI--------ENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            DE +LRFL+AR++N+ +A + +  ++ WR++ +  +I  T+   +  L      G+   D+ GRP+      Q + +   +   EE++   +  I        E  TK     IS++  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  243 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQV-LQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNT 422          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: SEC14L1 (SEC14 like lipid binding 1 [Source:HGNC Symbol;Acc:HGNC:10698])

HSP 1 Score: 55.4546 bits (132), Expect = 1.418e-7
Identity = 42/181 (23.20%), Postives = 85/181 (46.96%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQANCR---KNSVEESIAHVIYLI--------ENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            DE +LRFL+AR++N+ +A + +  ++ WR++ +  +I  T+   +  L      G+   D+ GRP+      Q + +   +   EE++   +  I        E  TK     IS++  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  277 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQV-LQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNT 456          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Match: T23G5.2 (CRAL-TRIO domain-containing protein T23G5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03606])

HSP 1 Score: 59.6918 bits (143), Expect = 2.336e-9
Identity = 48/190 (25.26%), Postives = 90/190 (47.37%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRK----------TKPLFIDCTYCHNKPGL-HSMRQIGFDESGRPVIYSSFSQANC----RKNSVEESIAHVIYLIEN-------ATKTMKVGISNFVFIIDCSGVTIQAC-NPKLG--YEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ND  LLRFL+AR++++ +A+  +  +I WR++          T+P  I   +    PG  H+      D++GRP+    F Q +     R   VE  +   + + E+       AT+ +   IS++  ++D  G++++    P +    ++ +I+   YPE +G V  V   ++F  +W  I  F+   T
Sbjct:  276 NDAHLLRFLRARDFDVAKAKDMVHASIIWRKQHNVDKILEEWTRPTVIKQYF----PGCWHNS-----DKAGRPMYILRFGQLDTKGMLRSCGVENLVKLTLSICEDGLQRAAEATRKLGTPISSWSLVVDLDGLSMRHLWRPGVQCLLKIIEIVEANYPETMGQVLVVRAPRVFPVLWTLISPFIDEKT 456          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Match: T23G5.2 (CRAL-TRIO domain-containing protein T23G5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03606])

HSP 1 Score: 59.6918 bits (143), Expect = 2.336e-9
Identity = 48/190 (25.26%), Postives = 90/190 (47.37%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRK----------TKPLFIDCTYCHNKPGL-HSMRQIGFDESGRPVIYSSFSQANC----RKNSVEESIAHVIYLIEN-------ATKTMKVGISNFVFIIDCSGVTIQAC-NPKLG--YEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ND  LLRFL+AR++++ +A+  +  +I WR++          T+P  I   +    PG  H+      D++GRP+    F Q +     R   VE  +   + + E+       AT+ +   IS++  ++D  G++++    P +    ++ +I+   YPE +G V  V   ++F  +W  I  F+   T
Sbjct:  276 NDAHLLRFLRARDFDVAKAKDMVHASIIWRKQHNVDKILEEWTRPTVIKQYF----PGCWHNS-----DKAGRPMYILRFGQLDTKGMLRSCGVENLVKLTLSICEDGLQRAAEATRKLGTPISSWSLVVDLDGLSMRHLWRPGVQCLLKIIEIVEANYPETMGQVLVVRAPRVFPVLWTLISPFIDEKT 456          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG32485 (gene:FBgn0052485 transcript:FBtr0072985)

HSP 1 Score: 67.781 bits (164), Expect = 9.046e-13
Identity = 51/180 (28.33%), Postives = 91/180 (50.56%), Query Frame = 3
Query:  183 ILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRK---TKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFII-DCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNTS 710
            I+E +P+ + ND +L R+L+A +    +A + +L T +WR      K   +D +    K  L   R    D  GRPVIY   ++ +  +  ++E    ++Y +E A K     +++ + I+ D +  +    + +L   +  +L  ++PERLGV   +N   LF  IW AI++ L  NT+
Sbjct:   24 IVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMDRSQLDKKARLLRHR----DCIGRPVIYIP-AKNHSSERDIDELTRFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTA 197          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: retm (gene:FBgn0031814 transcript:FBtr0079272)

HSP 1 Score: 59.3066 bits (142), Expect = 3.774e-9
Identity = 47/206 (22.82%), Postives = 89/206 (43.20%), Query Frame = 3
Query:  147 LAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYC-HNKPGLHSMRQIG----FDESGRPVIYSSFSQANCRK-------NSVEESIAHV----IYLIENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            L E R  +  V  LE  P +    +T+LRFL AR+W++ +A   L  ++ WRR+ +   ID     ++KP +      G     D+ GRPV        + +        + +     H+    I  I  + + ++  + N+  ++D  G++++       K    + + +   YPE +G V  V   ++F   W  +  F+  +T
Sbjct:  225 LLELRKMLDGVDDLERVPSY----QTILRFLAARDWHVSQAYAMLCDSLRWRREHR---IDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHT 423          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: retm (gene:FBgn0031814 transcript:FBtr0339788)

HSP 1 Score: 59.3066 bits (142), Expect = 3.774e-9
Identity = 47/206 (22.82%), Postives = 89/206 (43.20%), Query Frame = 3
Query:  147 LAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYC-HNKPGLHSMRQIG----FDESGRPVIYSSFSQANCRK-------NSVEESIAHV----IYLIENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            L E R  +  V  LE  P +    +T+LRFL AR+W++ +A   L  ++ WRR+ +   ID     ++KP +      G     D+ GRPV        + +        + +     H+    I  I  + + ++  + N+  ++D  G++++       K    + + +   YPE +G V  V   ++F   W  +  F+  +T
Sbjct:  225 LLELRKMLDGVDDLERVPSY----QTILRFLAARDWHVSQAYAMLCDSLRWRREHR---IDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHT 423          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: retm (gene:FBgn0031814 transcript:FBtr0329951)

HSP 1 Score: 58.9214 bits (141), Expect = 4.367e-9
Identity = 47/206 (22.82%), Postives = 89/206 (43.20%), Query Frame = 3
Query:  147 LAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYC-HNKPGLHSMRQIG----FDESGRPVIYSSFSQANCRK-------NSVEESIAHV----IYLIENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            L E R  +  V  LE  P +    +T+LRFL AR+W++ +A   L  ++ WRR+ +   ID     ++KP +      G     D+ GRPV        + +        + +     H+    I  I  + + ++  + N+  ++D  G++++       K    + + +   YPE +G V  V   ++F   W  +  F+  +T
Sbjct:  225 LLELRKMLDGVDDLERVPSY----QTILRFLAARDWHVSQAYAMLCDSLRWRREHR---IDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHT 423          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 57.3806 bits (137), Expect = 1.096e-8
Identity = 55/213 (25.82%), Postives = 97/213 (45.54%), Query Frame = 3
Query:  135 TDKLLAEFRSKIKSVP-------------ILEGEPEFFS--NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPG-LHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTI-QACNPK--LGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            T +L+A+ R +++  P             IL+  P   +  +D  LLRFL+AR+++   A + LL     RR    +F D      KP  +  +  +GF       D  GR ++     +         ++I  +   +E   +  +  ++  V ++D +GV + QA NP   L  +V  IL + +P R+  V  +N  ++F+GI+  IK FL
Sbjct:   35 TPELVAKAREELQEKPEWRLRDVQALRDMILKDHPNLRTRLDDAFLLRFLRARKFDYDRALQLLLNYHASRRAWPEVFQDL-----KPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVGLSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFL 242          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 56.9954 bits (136), Expect = 1.192e-8
Identity = 47/172 (27.33%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPG-LHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTI-QACNPK--LGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            +D  LLRFL+AR+++   A + LL     RR    +F D      KP  +  +  +GF       D  GR ++     +         ++I  +   +E   +  +  ++  V ++D +GV + QA NP   L  +V  IL + +P R+  V  +N  ++F+GI+  IK FL
Sbjct:   14 DDAFLLRFLRARKFDYDRALQLLLNYHASRRAWPEVFQDL-----KPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVGLSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFL 180          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:566769])

HSP 1 Score: 55.8398 bits (133), Expect = 3.003e-8
Identity = 40/176 (22.73%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    E+R++   +F +       PG+    + GF       D  GR ++    +  +  + +  + +  ++  +E   +  ++ ++ FV IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   49 TDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT--DPGIKQALKDGFPGVLSNLDRYGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: SEC14L1 (si:dkey-237i9.1 [Source:ZFIN;Acc:ZDB-GENE-060503-441])

HSP 1 Score: 52.7582 bits (125), Expect = 5.662e-7
Identity = 42/180 (23.33%), Postives = 81/180 (45.00%), Query Frame = 3
Query:  219 ETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQAN----CRKNSVEESIAHVIYLIENA-------TKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            E +LRFL+AR++N+ +A + L  ++ WR++ +  ++  T+   +  LH     G+   D  GRP+        +     R    E  + HV+ + E         TK     IS +  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  180 EHILRFLRARDFNIDKAREILCQSLTWRKQHQVDYLLDTWSSPQV-LHDFYTGGWHHHDNDGRPLYILRLGHMDTKGLVRALGEESLLRHVLSINEEGLRRCEENTKVFGRPISCWTCLVDLEGLNMRHLWRPAVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENT 358          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: sec14l1 (SEC14-like lipid binding 1 [Source:NCBI gene;Acc:100124776])

HSP 1 Score: 60.8474 bits (146), Expect = 2.455e-9
Identity = 49/191 (25.65%), Postives = 93/191 (48.69%), Query Frame = 3
Query:  189 EGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIG----FDESGRPVIYSSFSQANCR---KNSVEESIA-HVIYLIENATK-----TMKVG--ISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            E +PE    DE +LRFL+AR++N+++A + L  ++ WR++ +  +I  T+    P +      G     D+ GRP+      Q + +   K   EE+I  HV+ + E   K     T + G  I ++  ++D  G+ ++       K    + +++   YPE LG +  V   ++F  +W  +  F++ N+
Sbjct:  274 EWKPEKIPKDEHILRFLRARDFNMEKAREMLCQSLSWRKQHQVDYILQTW--QPPRVLEEYYAGGWHYHDKDGRPLYILRLGQVDTKGLVKALGEEAILRHVLSINEEGQKRCEENTRQFGRPIWSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPFINENS 462          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: clvs1 (clavesin 1 [Source:NCBI gene;Acc:100037913])

HSP 1 Score: 57.7658 bits (138), Expect = 1.145e-8
Identity = 42/176 (23.86%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    ++R+    +F +     + PG+      GF       D  GR ++    +  +  +NS  + +  ++  +E   +  ++ I+ F+ IID S  + +  +   P +     + L + +P R G V  VN       ++  IK FL   T
Sbjct:   68 TDDAFILRFLRARKFNQMEAFRLLAQYFQYRQLNLDMFKNLKA--DDPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQASKLTPSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKT 241          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:NCBI gene;Acc:548930])

HSP 1 Score: 57.3806 bits (137), Expect = 1.542e-8
Identity = 44/171 (25.73%), Postives = 79/171 (46.20%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            +D  LLRFL+AR+++   A + L+     R+    +F D      KP L S    GF       D  GR ++         R   + E+I  +   +E   ++ +  ++  V + D +GV +   +   P +  +V  IL + +P R+  V  +N  ++F+GI+  +K FL
Sbjct:   74 DDSFLLRFLRARKFDYDRALQLLVNYYSCRKAWPEVFTDLRPSAVKPVLDS----GFLTVLPHTDTEGRRIVCIRPGCWIPRDYPITENIRAIYLSLEKLVESEETQVNGIVILADYNGVGLTHASHFGPFIAKKVIGILQDGFPIRIKAVNVINEPRIFKGIFAILKPFL 240          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: clvs1 (clavesin 1 [Source:NCBI gene;Acc:100037913])

HSP 1 Score: 57.3806 bits (137), Expect = 1.597e-8
Identity = 42/176 (23.86%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    ++R+    +F +     + PG+      GF       D  GR ++    +  +  +NS  + +  ++  +E   +  ++ I+ F+ IID S  + +  +   P +     + L + +P R G V  VN       ++  IK FL   T
Sbjct:   49 TDDAFILRFLRARKFNQMEAFRLLAQYFQYRQLNLDMFKNLKA--DDPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQASKLTPSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: thg1l (tRNA-histidine guanylyltransferase 1-like [Source:Xenbase;Acc:XB-GENE-966760])

HSP 1 Score: 56.9954 bits (136), Expect = 2.236e-8
Identity = 40/176 (22.73%), Postives = 81/176 (46.02%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    E+R++   +F    +    PG+    + GF       D  GR ++    +  +  + ++ + +  ++  +E   +  ++ ++ FV IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   49 TDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMF--KNFKATDPGIKQGLKDGFPGVLSNLDHFGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Sec14l5 (SEC14-like lipid binding 5 [Source:MGI Symbol;Acc:MGI:3616084])

HSP 1 Score: 58.5362 bits (140), Expect = 1.080e-8
Identity = 47/182 (25.82%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQANCR---KNSVEES-IAHVIYLIENATK-----TMKVG--ISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
             DE +LRFL+AR+++L +A   L  ++ WR++ +   +  T+    P L      G+   D  GRP+      Q + +   K   EE+ + HV+ + E   K     T + G  IS++  ++D  G+ ++       K    + +++ + YPE LG +  V   ++F  +W  +  F++ NT
Sbjct:  263 KDEHILRFLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTW-RPPPPLQEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENT 443          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Sec14l5 (SEC14-like lipid binding 5 [Source:MGI Symbol;Acc:MGI:3616084])

HSP 1 Score: 58.5362 bits (140), Expect = 1.080e-8
Identity = 47/182 (25.82%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQANCR---KNSVEES-IAHVIYLIENATK-----TMKVG--ISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
             DE +LRFL+AR+++L +A   L  ++ WR++ +   +  T+    P L      G+   D  GRP+      Q + +   K   EE+ + HV+ + E   K     T + G  IS++  ++D  G+ ++       K    + +++ + YPE LG +  V   ++F  +W  +  F++ NT
Sbjct:  263 KDEHILRFLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTW-RPPPPLQEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENT 443          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Clvs2 (clavesin 2 [Source:MGI Symbol;Acc:MGI:2443223])

HSP 1 Score: 56.225 bits (134), Expect = 2.495e-8
Identity = 39/176 (22.16%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR+++  EA + L    E+R++   +F   ++    PG+    + GF       D  GR ++    +  +  + ++ + +  ++  +E   +  ++ ++ FV IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   49 TDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMF--KSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPNMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Sec14l1 (SEC14-like lipid binding 1 [Source:MGI Symbol;Acc:MGI:1921386])

HSP 1 Score: 55.0694 bits (131), Expect = 1.081e-7
Identity = 42/185 (22.70%), Postives = 84/185 (45.41%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYC-------HNKPGLHSMRQIGFDESGRPVIYSSFSQANCR---KNSVEESIAHVIYLI--------ENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            DE +LRFL+AR++N+ +A + +  ++ WR++ +  +I  T+        +   G H       D+ GRP+      Q + +   +   EE++   +  I        E  TK     IS++  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  277 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHH-----HDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNT 456          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Sec14l1 (SEC14-like lipid binding 1 [Source:MGI Symbol;Acc:MGI:1921386])

HSP 1 Score: 55.0694 bits (131), Expect = 1.140e-7
Identity = 42/185 (22.70%), Postives = 84/185 (45.41%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYC-------HNKPGLHSMRQIGFDESGRPVIYSSFSQANCR---KNSVEESIAHVIYLI--------ENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            DE +LRFL+AR++N+ +A + +  ++ WR++ +  +I  T+        +   G H       D+ GRP+      Q + +   +   EE++   +  I        E  TK     IS++  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  277 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHH-----HDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNT 456          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QT51|SFH5_AJECN (Phosphatidylinositol transfer protein SFH5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) OX=339724 GN=SFH5 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.645e-13
Identity = 61/185 (32.97%), Postives = 85/185 (45.95%), Query Frame = 3
Query:  225 LLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFI--DCTYCHNK-PGLHSMRQIGFDESGRPV----IYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSG--------------VTIQACNPKLGYEVTQ---ILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            L++FL+A E N+K AE+QL   +EWR+K  PL +    TY  +K  GL  +        G+ V    IY S   AN     V+E I   + L+E A K +K  +S    +ID SG              V+    NP +     Q   + S  YPE L   F VN   L   ++ A+K+FL  NT
Sbjct:  161 LIKFLRANEGNVKLAEEQLRKALEWRKKMNPLALAEKATYSSSKFQGLGYVANYKDQNQGKVVFTWNIYGSVKDANRTFGDVDEFIKWRVALMEMAVKDLK--LSEATSVIDYSGEDPYQMIQVHDYQNVSFLRLNPTIKSATKQTIDVFSTAYPELLKEKFFVNVPALMGWVFTALKVFLSKNT 343          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UU99|YJX4_SCHPO (CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC23B6.04c PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.029e-13
Identity = 46/165 (27.88%), Postives = 84/165 (50.91%), Query Frame = 3
Query:  219 ETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGY--EVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            E +LR+L+A +W++  A+K+++ T+ WRR      +D      +        +G+D+ GRP +Y   ++ N + + ++  I H+++ +E A   M  G+     +I+    + ++ NP +G   EV  IL  +Y ERLG    +N      G +K I  F+ P T
Sbjct:  636 ECILRYLRATKWHVSNAKKRIVDTLVWRRHFGVNNMDPDEIQEENATGKQVLLGYDKDGRPCLYLYPARQNTKTSPLQ--IRHLVFSLECAIDLMPPGVETLALLINFKSSSNRS-NPSVGQGKEVLNILQTHYCERLGRALVINIPWAVWGFFKLISPFIDPIT 797          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q55CU8|PITC_DICDI (Phosphatidylinositol transfer protein 3 OS=Dictyostelium discoideum OX=44689 GN=pitC PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.408e-12
Identity = 49/175 (28.00%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  207 FSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMK--VGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLH 698
            F  D   LR+L+AR + + ++EK L  T+EWR+K +P  I             +R+IG          D+ GRP+I++       +    E    +++Y +E     M    GI  F FI+D         + K   E    L ++ PER+G    ++   LF   WK I  FL+
Sbjct:   70 FCTDMCFLRYLRARNYIVSKSEKMLRDTLEWRKKFRPQDIQLG--------GDIREIGSAGCVYVNKRDKKGRPIIFAVPRNDTLKNVPSELKFKNLVYWLEQGFSRMDEPKGIEQFCFIVDYKDFGSGNMDMKTNLEAMHFLLDHCPERMGQSLFLDPPALFWFAWKIISPFLN 236          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|F4JYJ3|SFH11_ARATH (Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana OX=3702 GN=SFH11 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.298e-11
Identity = 58/210 (27.62%), Postives = 95/210 (45.24%), Query Frame = 3
Query:  153 EFRSKIKSVPILEGE-PEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYC---------HNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIA-HVIYLIENATKTMKV-----------GISNFVFIIDCSGVTIQACNP---KLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            E     +++ +L G  P+   +  TL RFLK R+++L+++++  L  ++WR   K   I   +          H   G H +     D++GRP+        +        +I  +V Y I+   KTM +            +S+   I+D SGV +   +     L  E+ +I SNYYPE L  +F VN S  F+ +W A+K FL   T
Sbjct:   26 EMVEAFRNLLLLHGHLPDKHGDHNTLRRFLKMRDFDLEKSKEAFLNYMKWRVDYKVDLISQKFKFEEYGEVKKHYPHGFHKV-----DKTGRPIYIERLGMTDLNAFLKATTIERYVNYHIKEQEKTMSLRYPACSIASDKHVSSTTTILDVSGVGMSNFSKPARSLFMEIQKIDSNYYPETLHRLFVVNASSGFRMLWLALKTFLDART 230          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|P53844|PDR17_YEAST (Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDR17 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.451e-11
Identity = 47/184 (25.54%), Postives = 78/184 (42.39%), Query Frame = 3
Query:  201 EFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKT---------KPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSG------VTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            +F+ + E  LR+L+A +WN   A K L  T+ WRR+           PL  D     N+ G   +  +GFD + RP+ Y    + N    S    +  ++Y++E AT     G+     ++D         +T +A    +      ++ ++YPERL     +N         K +  FL P T
Sbjct:   87 KFWLSRECFLRYLRANKWNTANAIKGLTKTLVWRREIGLTHGKEDKDPLTADKVAVENETGKQVI--LGFDNAKRPLYYMKNGRQNTE--SSFRQVQELVYMMETATTVAPQGVEKITVLVDFKSYKEPGIITDKAPPISIARMCLNVMQDHYPERLAKCVLINIPWFAWAFLKMMYPFLDPAT 266          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: V3YXA0 (CRAL-TRIO domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_211338 PE=4 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 3.054e-103
Identity = 147/291 (50.52%), Postives = 206/291 (70.79%), Query Frame = 3
Query:  126 LSSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT-SXXXXXXXXXXXSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFW-CSHESHDPRGVASYVKKYCQ----NAPKSQCDYKPHPNIVDVLTGKL 980
            +S  +  + E R ++  +P LE E +FF ++ETL R+LK+  WN+ EAEK L  TIE+RRKT+PL++DC YCH +PG HSMRQ+GFDE GRPVIY++F+QA+  K  +++S+AHV YL+ENA +TMK GI+ +VF+IDC+G+T+ ACNPKLGY VTQ L+++YPERLG+V C+NH+ +F G+W AIK FLHP T SK   +     V   F K F+ E+ +WL +E+K NK K I   Q+ FW  +   HDPRG  SY+K+Y +    N   ++  +KPHPNI+D   G++
Sbjct:   11 MSEKEGQIEELRGRLSDIPPLEDEKDFFLSEETLARYLKSCNWNVAEAEKYLKDTIEYRRKTRPLYVDCKYCHERPGYHSMRQVGFDEMGRPVIYANFAQASTHKYMLDDSVAHVTYLVENAKRTMKAGITTWVFVIDCTGMTLSACNPKLGYGVTQALADHYPERLGLVLCINHNAVFHGVWHAIKSFLHPQTVSKMKFIRSKRKVLSSFHKYFSDELTDWLIKEIKNNKQKPIPSSQKEFWNGAKNGHDPRGCPSYIKEYIEPYFKNVGSAKPSHKPHPNIIDTSRGRV 301          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A210Q8L7 (CRAL-TRIO domain-containing protein C23B6.04c OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14555 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.734e-102
Identity = 168/342 (49.12%), Postives = 232/342 (67.84%), Query Frame = 3
Query:  147 LAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT-SXXXXXXXXXXXSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFW---CSHESHDPRGVASYVKKYCQNAPKSQ--CDYKPHPNIVDVLTGKLSL--------DQSLQILRNSSDCKIQSKTESEDGLDEWENLDDEDIIE--IPNEYQIP 1124
            +AEFR ++  VP L+ E +FF+ND+TL+RFLKAREWN+  AE  L + +E RR TKPL +DC +CH + G HSMRQ+GFDESGRPVIYSSF+QA+  KN+VE+S+ H  YLIENA +TM +G+S +V++IDCSG+T+ ACNPKLGY VTQ++SN+YPERLG+V C+NH+ LFQG+WKAIK+FLHPNT +K   +   +   + F+  FN+E+ EWL EE++LNK K +++ Q  FW       +HDPRG  SYV KY      +   C + PHPNIVD  +G +           +  ++L + S     +  E   G+   ++  ++DI E  I  E+QIP
Sbjct:    4 VAEFRLRMLEVPPLQDEEDFFNNDQTLVRFLKAREWNVDNAEVLLKSAVEHRRSTKPLHMDCHWCHERSGHHSMRQVGFDESGRPVIYSSFAQASTHKNTVEDSVTHCTYLIENAKRTMALGVSTWVWVIDCSGMTLTACNPKLGYGVTQVMSNFYPERLGLVICLNHNPLFQGVWKAIKVFLHPNTVAKMKLVRSKDKYMKLFEIYFNEELTEWLLEEIRLNKNKPLSKTQFEFWNPPVEQGTHDPRGCPSYVTKYIDTFKLTDYLCTHLPHPNIVDSKSGIVRTISVSSEEKRERDRLLADQSGLVSAADQELTGGIHVSDDEHEDDIAELKITQEFQIP 345          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267EHN2 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027418g1 PE=4 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 2.335e-99
Identity = 163/358 (45.53%), Postives = 221/358 (61.73%), Query Frame = 3
Query:  126 LSSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNTSXXXXXXXXXXX-SEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFWC------SHESHDPRGVASYVKKYCQNAPKSQCDYKPHPNIVDVLTGKLSLDQSLQILRNSSDCKIQSKTESEDGLDEWENLDDED-----------IIEIPNEYQIPEKSKTIN 1145
            +S+ D+LL E R +I +   L  E  +   DETLLRFLKAREWN+  AEKQL   I WRR  +PL  DC +C  +PG HSMRQ+GFDE GRPVIYS F+QA+   N VEESIAH  YLIENA +TM+ G++ ++F+IDC+G+++ ACNP+LGY VTQ+ SN+YPERLG VFCVNHS LF G+W AI+ FLHP T+ K+K+L+  +   + F+  F  ++ +WL EEM+LN+++     QR+FW       + + HDPRG A YV KY + A  S   + PHPNIV    G+L   Q              + +          + DDE+            +EIP E+ IPE ++ + 
Sbjct:    1 MSNHDQLLKELRIRIANEEPLPDE-NYIQEDETLLRFLKAREWNIDAAEKQLRDAIAWRRSYRPLTADCRWCQQQPGCHSMRQVGFDEFGRPVIYSCFAQASASSNGVEESIAHCTYLIENAKRTMRPGVTTWIFVIDCTGISLPACNPRLGYSVTQVFSNFYPERLGKVFCVNHSGLFHGVWCAIQRFLHPATAAKMKMLRGKSKIRDTFEAWFPADLADWLLEEMRLNRSRKHLPRQRQFWRGSAPGEAPDEHDPRGCAEYVTKYVEAAHPS--GHLPHPNIVAHREGRL---QQPVAAPPPMPSSSSAASLQSAASGAAADFDDEEQLELNGAAAAAALEIPEEFAIPEGAEVMT 352          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A0L8IGV2 (CRAL-TRIO domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005989mg PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 5.277e-96
Identity = 157/322 (48.76%), Postives = 210/322 (65.22%), Query Frame = 3
Query:  222 TLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT-SXXXXXXXXXXXSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFW---CSHESHDPRGVASYVKKYCQNAPKSQCD-------YKPHPNIVDVLTGKLSLDQSLQILRNSSDCKIQSKTESEDGL----DEWENLDDEDIIEIPNEYQIPEKSKTI 1142
            +L RFLKAR+W++  AEK L  TIE+RR  KPL +DC +CH++PG HS+RQ+GFDE GRPVIYSSF Q   RK +VE+SI HV YLIENA  TM+ G++ +VFIIDC+G+ +  CNP+LGY VTQI+SN+YPERLG+V C+NHS +FQG+W+AIK FLHPNT +K + +   + V + F K F+ E+ +WL EE++LNK K     QR FW     +  HDPRG ASYV  + +  P S+         +KPHP I+D + G L  D+   +  +  +       + ED L    DE  N+ D   I I  E+QIP+ S  I
Sbjct:   78 SLCRFLKARDWDIDVAEKALKATIEYRRTVKPLEVDCQWCHDRPGYHSIRQVGFDELGRPVIYSSFIQTTARKITVEDSIRHVTYLIENAKVTMRPGVTTWVFIIDCTGLRLPLCNPRLGYGVTQIMSNHYPERLGMVICLNHSPVFQGVWRAIKAFLHPNTVAKMLLIRSRSKVQQTFSKYFSPELTQWLLEEIRLNKQKPFPASQRTFWNKPAKNGDHDPRGCASYVANFIE--PYSEKSLILIPGFHKPHPTILDSIRGVLDSDKEASLDSSELESNSPLPADEEDTLSYSDDELSNMAD---ITIDEEFQIPKDSIPI 394          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A0X3PBA7 (CRAL-TRIO domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR123378 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 6.337e-95
Identity = 149/337 (44.21%), Postives = 212/337 (62.91%), Query Frame = 3
Query:  156 FRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT-SXXXXXXXXXXXSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFWCSHES--HDPRGVASYVKKYCQNAPKSQCDYKPHPNIVDVLTGKLSLDQSLQILRNSSDCKIQSKTESEDGLDEWENLDDED----IIEIPNEYQIPEKSKTIN 1145
             R K++ V + EGEP+   +D  L R+LKAR  N++EA+K +  +IEWRR  KP  IDC +CH KPGLHS+RQ+GFDE+GRPV+YSSF+QA   +N+  E+I+H+ Y++ENA K+M  G+S +V + DCSG++  AC+P+L Y+  QILSN+YPERLG  FC      FQ  WKAI+ FL  NT SK   +     +  +F+++F+ +M +W+  E++LNK KNI   QR FW    +  HDPRG + Y  K+  N P     ++PHPNIVD L   LS   ++ +  +S D    S   SED  +    LDDE     + ++P EYQIP  +  ++
Sbjct:    9 LREKLEDVELPEGEPDLLKDDSMLWRYLKARSGNIEEAQKMVRKSIEWRRTYKPYAIDCQWCHQKPGLHSLRQVGFDEAGRPVLYSSFTQAATSRNTAAEAISHLTYVLENAVKSMPDGVSQWVLVFDCSGMSTAACHPRLAYDCAQILSNHYPERLGKAFCALPGTAFQAAWKAIRGFLPINTVSKVKIINSKTKLRSYFEEIFSPDMTDWMLTEIELNKKKNITPDQRSFWLPPPAGVHDPRGSSEYTDKWLSNHPSG---HRPHPNIVDNLERGLSSPAAIPVSGSSGDLD-GSINSSEDEAE----LDDEKASDFLKQLPTEYQIPTDAGLLS 337          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:103043466])

HSP 1 Score: 57.7658 bits (138), Expect = 6.456e-9
Identity = 55/213 (25.82%), Postives = 98/213 (46.01%), Query Frame = 3
Query:  135 TDKLLAEFRSKIKSVP-------------ILEGEPEFFS--NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPG-LHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTI-QACNPK--LGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            T +L+A+ R +++  P             IL+ +P   +  +D  LLRFL+AR+++   A + LL     RR    +F D      KP  +  +  +GF       D  GR ++     +         ++I  +   +E   +  +  ++  V ++D +GV + QA NP   L  +V  IL + +P R+  V  +N  ++F+GI+  IK FL
Sbjct:   38 TPELVAKAREELQEKPEWRLRDVQALRDMILKEQPNLRTRLDDAFLLRFLRARKFDYDRAMQLLLNYHGSRRAWPEVFQDL-----KPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGVGLSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFL 245          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:103043466])

HSP 1 Score: 57.3806 bits (137), Expect = 9.126e-9
Identity = 55/213 (25.82%), Postives = 98/213 (46.01%), Query Frame = 3
Query:  135 TDKLLAEFRSKIKSVP-------------ILEGEPEFFS--NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPG-LHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTI-QACNPK--LGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            T +L+A+ R +++  P             IL+ +P   +  +D  LLRFL+AR+++   A + LL     RR    +F D      KP  +  +  +GF       D  GR ++     +         ++I  +   +E   +  +  ++  V ++D +GV + QA NP   L  +V  IL + +P R+  V  +N  ++F+GI+  IK FL
Sbjct:   39 TPELVAKAREELQEKPEWRLRDVQALRDMILKEQPNLRTRLDDAFLLRFLRARKFDYDRAMQLLLNYHGSRRAWPEVFQDL-----KPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGVGLSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFL 246          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:103047212])

HSP 1 Score: 56.225 bits (134), Expect = 1.978e-8
Identity = 40/176 (22.73%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    E+R++   +F +       PG+    + GF       D  GR ++    +  +  + +  + +  ++  +E   +  ++ ++ FV IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   49 TDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT--DPGIKQALKDGFPGVLSNLDRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:103047212])

HSP 1 Score: 55.8398 bits (133), Expect = 2.796e-8
Identity = 40/176 (22.73%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    E+R++   +F +       PG+    + GF       D  GR ++    +  +  + +  + +  ++  +E   +  ++ ++ FV IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   66 TDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT--DPGIKQALKDGFPGVLSNLDRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKT 239          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-237i9.1 (SEC14-like protein 1 [Source:NCBI gene;Acc:103027714])

HSP 1 Score: 56.6102 bits (135), Expect = 3.097e-8
Identity = 43/181 (23.76%), Postives = 83/181 (45.86%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQAN----CRKNSVEESIAHVIYLIENA-------TKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            D+ +LRFL+AR++N+ +A + L  ++ WR++ +  ++  T+   +  LH     G+   D  GRP+      Q +     R    E  + HV+ + E         TK     IS +  ++D  G+ ++       K    + +++   YPE LG +  +   ++F  +W  +  F+  NT
Sbjct:  281 DQHILRFLRARDFNMDKAREILCQSLTWRKQHQVDYLLDTWTSPQ-VLHDYYTGGWHHHDRDGRPLYILRLGQMDTKGLVRALGEESLLRHVLSINEEGLRRCEENTKVFGRPISCWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENT 460          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Match: PDR17 (Phosphatidylinositol transfer protein (PITP); downregulates Plb1p-mediated turnover of phosphatidylcholine; forms a complex with Psd2p which appears essential for maintenance of vacuolar PE levels; found in the cytosol and microsomes; homologous to Pdr16p; deletion affects phospholipid composition [Source:SGD;Acc:S000005208])

HSP 1 Score: 68.9366 bits (167), Expect = 2.089e-13
Identity = 47/184 (25.54%), Postives = 78/184 (42.39%), Query Frame = 3
Query:  201 EFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKT---------KPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSG------VTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            +F+ + E  LR+L+A +WN   A K L  T+ WRR+           PL  D     N+ G   +  +GFD + RP+ Y    + N    S    +  ++Y++E AT     G+     ++D         +T +A    +      ++ ++YPERL     +N         K +  FL P T
Sbjct:   87 KFWLSRECFLRYLRANKWNTANAIKGLTKTLVWRREIGLTHGKEDKDPLTADKVAVENETGKQVI--LGFDNAKRPLYYMKNGRQNTE--SSFRQVQELVYMMETATTVAPQGVEKITVLVDFKSYKEPGIITDKAPPISIARMCLNVMQDHYPERLAKCVLINIPWFAWAFLKMMYPFLDPAT 266          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Match: SEC14 (Phosphatidylinositol/phosphatidylcholine transfer protein; involved in regulating PtdIns, PtdCho, and ceramide metabolism, products of which regulate intracellular transport and UPR; has a role in localization of lipid raft proteins; functionally homologous to mammalian PITPs; SEC14 has a paralog, YKL091C, that arose from the whole genome duplication [Source:SGD;Acc:S000004684])

HSP 1 Score: 68.1662 bits (165), Expect = 2.483e-13
Identity = 57/212 (26.89%), Postives = 94/212 (44.34%), Query Frame = 3
Query:  129 SSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRK--TKPLFIDCTYCHNKPGLHSMRQIGF---DESGRPVIYSSFSQANCR------------KNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGY--EVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            S+ +K LAE R  ++    +E       +D TLLRFL+AR+++++ A++      +WR+   T  +  D  Y   KP +       +   D+ GRPV +      N              KN V E  + V Y +   ++     +     I+D  G++I +    + Y  E + I  NYYPER+G  + +N    F   ++  K FL P T
Sbjct:   31 SAQEKALAELRKLLEDAGFIER-----LDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTDTILQDFHY-DEKPLIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYSVMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVT 236          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Match: PDR16 (Phosphatidylinositol transfer protein (PITP); controlled by the multiple drug resistance regulator Pdr1p; localizes to lipid particles and microsomes; controls levels of various lipids, may regulate lipid synthesis; homologous to Pdr17p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005175])

HSP 1 Score: 68.5514 bits (166), Expect = 3.138e-13
Identity = 50/192 (26.04%), Postives = 82/192 (42.71%), Query Frame = 3
Query:  186 LEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRK----------TKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCS---GVTIQACNPKL-----GYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            LE E + +   E  LR+L+A +W LK+   ++  T+ WRR+             +  D     N+ G   +  +G++   RP++Y    + N +  +    + H+++++E     M  G  +   +ID      V     N K+     G EV  IL  +YPERLG     N   L     K I  F+ P T
Sbjct:   77 LEEEEKAWLTRECFLRYLRATKWVLKDCIDRITMTLAWRREFGISHLGEEHGDKITADLVAVENESGKQVI--LGYENDARPILYLKPGRQNTK--TSHRQVQHLVFMLERVIDFMPAGQDSLALLIDFKDYPDVPKVPGNSKIPPIGVGKEVLHILQTHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLT 264          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Match: YKL091C (Putative phosphatidylinositol/phosphatidylcholine transfer protein; possibly involved in lipid metabolism; localizes to the nucleus; contains a CRAL/TRIO domain and binds several lipids in a large-scale study; YKL091C has a paralog, SEC14, that arose from the whole genome duplication [Source:SGD;Acc:S000001574])

HSP 1 Score: 64.3142 bits (155), Expect = 5.992e-12
Identity = 47/189 (24.87%), Postives = 81/189 (42.86%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPG----------LHSMRQIGFDESGRPVIYSSFSQANCRK------------NSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGY--EVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            +D TLLRFL+AR++++  + +  + T  WR +     I   Y +NK            ++       D+ GRP+ +      N +K            N V+E      Y +   ++     I     ++D  G+++      L Y  +V  I  NYYPER+G  + ++    F  ++K +K FL P T
Sbjct:   50 DDSTLLRFLRARKFDINASVEMFVETERWREEYGANTIIEDYENNKEAEDKERIKLAKMYPQYYHHVDKDGRPLYFEELGGINLKKMYKITTEKQMLRNLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYHVLSYIKDVADISQNYYPERMGKFYIIHSPFGFSTMFKMVKPFLDPVT 238          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Match: CSR1 (Phosphatidylinositol transfer protein; has a potential role in regulating lipid and fatty acid metabolism under heme-depleted conditions; interacts specifically with thioredoxin peroxidase; may have a role in oxidative stress resistance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004372])

HSP 1 Score: 48.9062 bits (115), Expect = 7.975e-7
Identity = 41/173 (23.70%), Postives = 71/173 (41.04%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFID----CTYCHNKPG------LHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGI-SNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHP 701
            D T+L+F++AR+WN  +    L   + WR+ T    I+      Y +N+ G      L      G+D   RPVI       +    + +E     + +IE +    K    ++   + D +G ++   +      +      +YPE LG +       +F  IW  IK +L P
Sbjct:  109 DATILKFIRARKWNADKTIAMLGHDLYWRKDTINKIINGGERAVYENNETGVIKNLELQKATIQGYDNDMRPVILVRPRLHHSSDQTEQELEKFSLLVIEQSKLFFKENYPASTTILFDLNGFSMSNMDYAPVKFLITCFEAHYPESLGHLLIHKAPWIFNPIWNIIKNWLDP 281          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Match: EDO43833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE8])

HSP 1 Score: 62.003 bits (149), Expect = 2.972e-11
Identity = 55/191 (28.80%), Postives = 96/191 (50.26%), Query Frame = 3
Query:  222 TLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHS-------MRQIGF---DESGRP--VIYSSFSQANC--------------RKN--SVEESIAHVIYLIENATKTMKVGISNFVFIIDCS-GVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            TLL FL+AR ++++ A KQ L+T+EWR+K     ID     +KP  HS       +   GF   D+ GRP  + Y+  +  +               R++  + E  IA +  L +N+  +++   S  + +++C  G   +A N  +   + ++  ++YPER+G +F VN   +F  +WK  ++FL P T
Sbjct:    1 TLLGFLRARGFDVQAAYKQYLSTVEWRKKNG---IDSIL--DKPVNHSECLLITQVMSCGFHKQDKEGRPCYIEYTGRTDVSALVKVHTILPVDQVIRRHIWNCEYQIARMAELSQNSVSSLEENTS-IITLLNCRFGGFRKALN--IFKRLAKLDQDHYPERMGKIFIVNTPWVFPVLWKIARVFLDPKT 183          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Match: EDO48390 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK1])

HSP 1 Score: 52.7582 bits (125), Expect = 2.014e-7
Identity = 44/184 (23.91%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  213 NDETLLRFLKAREWNLKEAEKQLLTTIEWRR-----------KTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANC-RKNSVEESIAHV----IYLIENATKTMKVGISNFVFIIDCSGVTIQAC---NPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ND  LLRFL+AR+ +L++A + L  ++ WRR           K     +D  YC        +RQ+  D  G+   +++  + +C ++ S+ +S+  +    +   E  TK     +S++  + D  G++++       K    V +++   YPE +G +  V   ++F  +W  +  F+  NT
Sbjct:  269 NDAHLLRFLRARDLHLEKAYEMLCQSLAWRRHHHIDNILEIWKPPEPLLD-YYCGGWHHQDKVRQM--DRQGKKGRWTNKERVDCTQRRSINQSVVSINEEGLKKTEILTKETGKPVSSWTCLCDLEGLSMRHLWRPGIKALLRVIEMVEVNYPETMGRLLIVRAPRIFGVLWTLVSPFIDENT 449          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:101167039])

HSP 1 Score: 58.5362 bits (140), Expect = 3.965e-9
Identity = 49/184 (26.63%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  183 ILEGEPEFFS--NDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPG-LHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTI-QACNPK--LGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            IL+ +P   +  +D  LLRFL+AR+++   A + LL     RR    +F D      KP  +  +  +GF       D SGR ++     +         +++  +   +E   +  +  ++  + ++D +GV + QA NP   L  +V  IL + +P R+  V  +N   +F+GI+  IK FL
Sbjct:   66 ILKEQPNLHTRLDDAFLLRFLRARKFDYDRALQLLLNYHAGRRAWPEVFQDL-----KPSTVKHVLDLGFLTVLPRPDPSGRYILCLRPGKWKPNDYPFVDNVRAIYLTLEKLIQPEETQVNGIIILVDYTGVGMSQASNPGPFLAKKVVSILQDGFPIRIKAVNIINEPLIFKGIFAIIKPFL 244          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:101159632])

HSP 1 Score: 56.6102 bits (135), Expect = 1.628e-8
Identity = 39/176 (22.16%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D  +LRFL+AR++N  EA + L    E+R++   +F +       PG+    + GF       D+ GR ++    +  +  + +  + +  ++  +E+  +  ++ ++ F+ IID S  T +  +   P +     + L + +P R G +  VN       ++  I+ FL   T
Sbjct:   49 TDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT--DPGIKQALKDGFPGVLSNLDKYGRKILVLFAANWDQSRYTFVDILRAILLSLESMIEDPELQVNGFILIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: CLVS1 (clavesin-1 [Source:NCBI gene;Acc:101158238])

HSP 1 Score: 52.7582 bits (125), Expect = 2.850e-7
Identity = 39/176 (22.16%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  210 SNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACN---PKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
            ++D+ +LRFL+AR+++  E  + L    ++R++   +F   ++  +  G+      GF       D+ GR ++    S  +  +NS  + +  ++  +E   +  ++ I+ F+ IID S  + +  +   P +     + L + +P R G +  VN       ++  IK FL   T
Sbjct:   49 TDDDFILRFLRARKFDQLETFRLLAQYFQFRQQNLDMF--QSFKVDDLGIKRALMDGFPGVLESPDQHGRKILILFASNWDQSRNSFIDILRAILLSLEVLIENPELQINGFILIIDWSNFSFKQASKLTPNILKLAIEGLQDSFPARFGGIHFVNQPWYIHAMYTIIKPFLKDKT 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002803.2 (retinaldehyde-binding protein 1-like [Source:NCBI gene;Acc:101170080])

HSP 1 Score: 48.1358 bits (113), Expect = 9.311e-6
Identity = 39/173 (22.54%), Postives = 77/173 (44.51%), Query Frame = 3
Query:  216 DETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGF-------DESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQI------LSNYYPERLGVVFCVNHSQLFQGIWKAIKIFL 695
            D  LLRFL+AR++N+  A + L   + +R+    LF + T       + S  + G+       D+ GR V+  +    +  + + +E +     ++E   +  +  I+ FV I +  G T+Q  +   G + T++      L + +P R   V  ++    F   +  +K F+
Sbjct:   84 DSLLLRFLRARKFNVVRAHELLKGYVRFRKDYPELFENLT----PEAVRSTIEAGYPVVLPSRDKYGRVVLLFNIENWDLEEITFDEVLRAYCVILEKLLENEETQINGFVLIENFKGFTMQHAS---GIKTTELKKMVDMLQDSFPARFKAVHVIHQPWYFTTTYNVVKPFM 249          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000019717.1 (SMESG000019717.1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 340/341 (99.71%), Postives = 340/341 (99.71%), Query Frame = 3
Query:  123 MLSSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNTSXXXXXXXXXXXSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFWCSHESHDPRGVASYVKKYCQNAPKSQCDYKPHPNIVDVLTGKLSLDQSLQILRNSSDCKIQSKTESEDGLDEWENLDDEDIIEIPNEYQIPEKSKTIN 1145
            MLSSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNTSKKVKLLKNNNVSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFWCSHESHDPRGVASYVKKYCQNAPKSQ DYKPHPNIVDVLTGKLSLDQSLQILRNSSDCKIQSKTESEDGLDEWENLDDEDIIEIPNEYQIPEKSKTIN
Sbjct:    1 MLSSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAEKQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNTSKKVKLLKNNNVSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFWCSHESHDPRGVASYVKKYCQNAPKSQSDYKPHPNIVDVLTGKLSLDQSLQILRNSSDCKIQSKTESEDGLDEWENLDDEDIIEIPNEYQIPEKSKTIN 341          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000081079.1 (SMESG000081079.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.687e-9
Identity = 29/109 (26.61%), Postives = 51/109 (46.79%), Query Frame = 3
Query:  381 FDESGRPVIYSSFSQANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNPKLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNT 707
             D+  RPV+Y S      +  +++     ++Y+IE A +           I D +  +I   +     ++  + S YYPERLG+   +N   +FQG W  +K +L  +T
Sbjct:   87 LDKLNRPVVYISVKNHIVQNRNIDSVTKFMVYVIERACEKCIENQDQLCIIFDLNSFSIGNMDYAFVRQLIHLFSTYYPERLGICLIINSPLIFQGCWTVVKRWLSDHT 195          
The following BLAST results are available for this feature:
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLVS23.977e-822.16clavesin 2 [Source:HGNC Symbol;Acc:HGNC:23046][more]
SEC14L51.220e-724.73SEC14 like lipid binding 5 [Source:HGNC Symbol;Acc... [more]
SEC14L11.309e-723.20SEC14 like lipid binding 1 [Source:HGNC Symbol;Acc... [more]
SEC14L11.309e-723.20SEC14 like lipid binding 1 [Source:HGNC Symbol;Acc... [more]
SEC14L11.418e-723.20SEC14 like lipid binding 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T23G5.22.336e-925.26CRAL-TRIO domain-containing protein T23G5.2 [Sour... [more]
T23G5.22.336e-925.26CRAL-TRIO domain-containing protein T23G5.2 [Sour... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG324859.046e-1328.33gene:FBgn0052485 transcript:FBtr0072985[more]
retm3.774e-922.82gene:FBgn0031814 transcript:FBtr0079272[more]
retm3.774e-922.82gene:FBgn0031814 transcript:FBtr0339788[more]
retm4.367e-922.82gene:FBgn0031814 transcript:FBtr0329951[more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ttpal1.096e-825.82tocopherol (alpha) transfer protein-like [Source:Z... [more]
ttpal1.192e-827.33tocopherol (alpha) transfer protein-like [Source:Z... [more]
clvs23.003e-822.73clavesin 2 [Source:NCBI gene;Acc:566769][more]
SEC14L15.662e-723.33si:dkey-237i9.1 [Source:ZFIN;Acc:ZDB-GENE-060503-4... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec14l12.455e-925.65SEC14-like lipid binding 1 [Source:NCBI gene;Acc:1... [more]
clvs11.145e-823.86clavesin 1 [Source:NCBI gene;Acc:100037913][more]
ttpal1.542e-825.73tocopherol (alpha) transfer protein-like [Source:N... [more]
clvs11.597e-823.86clavesin 1 [Source:NCBI gene;Acc:100037913][more]
thg1l2.236e-822.73tRNA-histidine guanylyltransferase 1-like [Source:... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec14l51.080e-825.82SEC14-like lipid binding 5 [Source:MGI Symbol;Acc:... [more]
Sec14l51.080e-825.82SEC14-like lipid binding 5 [Source:MGI Symbol;Acc:... [more]
Clvs22.495e-822.16clavesin 2 [Source:MGI Symbol;Acc:MGI:2443223][more]
Sec14l11.081e-722.70SEC14-like lipid binding 1 [Source:MGI Symbol;Acc:... [more]
Sec14l11.140e-722.70SEC14-like lipid binding 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QT51|SFH5_AJECN2.645e-1332.97Phosphatidylinositol transfer protein SFH5 OS=Ajel... [more]
sp|Q9UU99|YJX4_SCHPO3.029e-1327.88CRAL-TRIO domain-containing protein C23B6.04c OS=S... [more]
sp|Q55CU8|PITC_DICDI1.408e-1228.00Phosphatidylinositol transfer protein 3 OS=Dictyos... [more]
sp|F4JYJ3|SFH11_ARATH1.298e-1127.62Phosphatidylinositol/phosphatidylcholine transfer ... [more]
sp|P53844|PDR17_YEAST1.451e-1125.54Phosphatidylinositol transfer protein PDR17 OS=Sac... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3YXA03.054e-10350.52CRAL-TRIO domain-containing protein OS=Lottia giga... [more]
A0A210Q8L71.734e-10249.12CRAL-TRIO domain-containing protein C23B6.04c OS=M... [more]
A0A267EHN22.335e-9945.53CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
A0A0L8IGV25.277e-9648.76CRAL-TRIO domain-containing protein OS=Octopus bim... [more]
A0A0X3PBA76.337e-9544.21CRAL-TRIO domain-containing protein OS=Schistoceph... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal6.456e-925.82alpha tocopherol transfer protein like [Source:NCB... [more]
ttpal9.126e-925.82alpha tocopherol transfer protein like [Source:NCB... [more]
clvs21.978e-822.73clavesin 2 [Source:NCBI gene;Acc:103047212][more]
clvs22.796e-822.73clavesin 2 [Source:NCBI gene;Acc:103047212][more]
si:dkey-237i9.13.097e-823.76SEC14-like protein 1 [Source:NCBI gene;Acc:1030277... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDR172.089e-1325.54Phosphatidylinositol transfer protein (PITP); down... [more]
SEC142.483e-1326.89Phosphatidylinositol/phosphatidylcholine transfer ... [more]
PDR163.138e-1326.04Phosphatidylinositol transfer protein (PITP); cont... [more]
YKL091C5.992e-1224.87Putative phosphatidylinositol/phosphatidylcholine ... [more]
CSR17.975e-723.70Phosphatidylinositol transfer protein; has a poten... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO438332.972e-1128.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483902.014e-723.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ttpal3.965e-926.63alpha tocopherol transfer protein like [Source:NCB... [more]
clvs21.628e-822.16clavesin 2 [Source:NCBI gene;Acc:101159632][more]
CLVS12.850e-722.16clavesin-1 [Source:NCBI gene;Acc:101158238][more]
ENSORLT00000002803.29.311e-622.54retinaldehyde-binding protein 1-like [Source:NCBI ... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019717.10.000e+099.71SMESG000019717.1[more]
SMESG000081079.11.687e-926.61SMESG000081079.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027542 ID=SMED30027542|Name=CRAL-TRIO domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1245bp
GTTATGCTTGTTCTTATATAAATATAATTTATGTCTGTATTGTGCTTACA
TTTACTGACAAGAGTTATCACATTTATTTGCTGAGTAGCCGGTTTAACAG
GTTTAAACTTATTAGATAAATCATGTTATCGTCCACTGACAAGTTGCTGG
CAGAATTTCGTTCAAAAATAAAATCTGTTCCCATTTTGGAAGGCGAACCA
GAATTTTTTTCAAACGATGAAACTTTGCTACGATTTCTCAAGGCCCGAGA
ATGGAACCTGAAAGAAGCCGAAAAACAGTTATTAACCACAATAGAATGGC
GAAGAAAAACAAAACCTCTATTTATAGATTGTACTTATTGTCACAACAAA
CCGGGATTACATAGCATGCGACAAATAGGTTTTGATGAATCTGGAAGACC
AGTCATTTATTCATCATTTTCTCAAGCAAATTGTCGCAAAAATTCTGTGG
AAGAATCAATCGCCCATGTGATTTATTTGATTGAAAATGCTACCAAAACT
ATGAAAGTTGGCATCAGCAATTTCGTGTTTATTATAGATTGTAGCGGAGT
GACAATTCAAGCATGCAATCCAAAGTTAGGATACGAAGTCACCCAAATAT
TGTCTAATTATTATCCTGAAAGATTAGGAGTTGTATTCTGTGTAAATCAC
AGTCAATTATTTCAAGGAATTTGGAAAGCAATTAAAATATTCCTCCATCC
AAACACATCAAAAAAAGTGAAACTATTAAAAAACAATAACGTTTCCGAGC
ATTTTCAAAAATTATTTAATCAGGAAATGGTTGAATGGTTAACGGAGGAA
ATGAAGCTCAATAAAACGAAAAATATCAACGAATATCAAAGAAGGTTTTG
GTGTAGTCATGAAAGTCACGATCCAAGAGGTGTGGCTAGTTATGTCAAAA
AATACTGTCAAAATGCCCCTAAAAGTCAATGTGATTACAAACCCCATCCA
AATATTGTTGATGTTCTGACTGGGAAATTATCTCTAGACCAGAGCTTACA
GATTTTACGAAATTCATCAGATTGTAAAATACAAAGTAAAACTGAATCAG
AAGATGGTTTAGATGAATGGGAGAACCTCGATGATGAGGATATTATCGAA
ATTCCTAATGAATATCAAATCCCAGAAAAATCTAAAACAATCAATTAATG
TTTTAATGGGGGAAACGGGAAGAATTATAATTATTATTATTCTAAGTGCC
GTTGTGTACTATAAATAAAAATTTATATCTATATTTTCAAAACAA
back to top

protein sequence of SMED30027542-orf-1

>SMED30027542-orf-1 ID=SMED30027542-orf-1|Name=SMED30027542-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MLSSTDKLLAEFRSKIKSVPILEGEPEFFSNDETLLRFLKAREWNLKEAE
KQLLTTIEWRRKTKPLFIDCTYCHNKPGLHSMRQIGFDESGRPVIYSSFS
QANCRKNSVEESIAHVIYLIENATKTMKVGISNFVFIIDCSGVTIQACNP
KLGYEVTQILSNYYPERLGVVFCVNHSQLFQGIWKAIKIFLHPNTSKKVK
LLKNNNVSEHFQKLFNQEMVEWLTEEMKLNKTKNINEYQRRFWCSHESHD
PRGVASYVKKYCQNAPKSQCDYKPHPNIVDVLTGKLSLDQSLQILRNSSD
CKIQSKTESEDGLDEWENLDDEDIIEIPNEYQIPEKSKTIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015914phospholipid transport
GO:0006810transport
GO:0006869lipid transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR036273CRAL/TRIO_N_dom_sf
IPR001251CRAL-TRIO_dom
IPR011074CRAL/TRIO_N_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0031090organelle membrane
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011074CRAL/TRIO, N-terminal domainSMARTSM01100CRAL_TRIO_N_2coord: 31..56
e-value: 2.8E-5
score: 33.6
IPR011074CRAL/TRIO, N-terminal domainPFAMPF03765CRAL_TRIO_Ncoord: 6..53
e-value: 1.4E-8
score: 34.7
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 74..229
e-value: 2.7E-14
score: 63.5
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 86..220
e-value: 6.4E-28
score: 97.5
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 85..235
score: 14.268
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 86..221
e-value: 2.97119E-20
score: 83.9738
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 3..248
e-value: 5.4E-46
score: 159.0
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 80..220
NoneNo IPR availablePANTHERPTHR45824FAMILY NOT NAMEDcoord: 11..243
IPR036273CRAL/TRIO, N-terminal domain superfamilySUPERFAMILYSSF46938CRAL/TRIO N-terminal domaincoord: 7..71