Tumor necrosis factor receptor-associated factor 3

Overview
NameTumor necrosis factor receptor-associated factor 3
Smed IDSMED30027541
Length (bp)1203
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tumor necrosis factor receptor-associated factor 3 (SMED30027541) t-SNE clustered cells

Violin plots show distribution of expression levels for Tumor necrosis factor receptor-associated factor 3 (SMED30027541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tumor necrosis factor receptor-associated factor 3 (SMED30027541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tumor necrosis factor receptor-associated factor 3 (SMED30027541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30027541SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027541SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027541SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30027541SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027541SMESG000027280.1 SMESG000027263.1 SMESG000026967.1 SMESG000026956.1 SMESG000026954.1 SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025794.1 SMESG000025583.1 SMESG000025517.1 SMESG000025934.1 SMESG000025926.1 SMESG000025797.1 Contig3847uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027541SMESG000027280.1 SMESG000027263.1 SMESG000026967.1 SMESG000026956.1 SMESG000026954.1 SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025794.1 SMESG000025583.1 SMESG000025517.1 SMESG000025934.1 SMESG000025926.1 SMESG000025797.1 Contig3847newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027541 Contig11269newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027541 Contig11269uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30027541SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.929 bits (154), Expect = 1.877e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  206 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 446          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 2.773e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  264 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 504          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 2.773e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  264 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 504          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.123e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  289 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 529          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.123e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  289 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 529          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 68.5514 bits (166), Expect = 5.193e-12
Identity = 59/251 (23.51%), Postives = 120/251 (47.81%), Query Frame = 1
Query:  292 ELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKL----EIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWI------YSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            E++ +N Q +Q + ++++ + +  +K+ E+E  EL   R +              R++R E+ET  G++  +R  +  ++ +    +     +   +QQL  +  L    ++   + D++L Q      F   G   W+I    ++K++  +      YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L+WPFK  VT+  +D   A ++L       +   P  + +R+P+ + N
Sbjct:  306 EMREKNRQLEQKLVSMQMLMSSHSEKLLEVEM-ELRELRPL--------------RAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKL-QVLETASF--NGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHL----GDAFKPDPSSSSFRRPTGEMN 534          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 59.3066 bits (142), Expect = 3.734e-9
Identity = 35/152 (23.03%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY-PYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP + T+ +  +D           I+  +  P L  +++P+  RN   + F Y  F+ +    ++  V+ +  L++C +
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ----HHIEVMETKPDLQAFQRPTVMRNP--KGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 59.3066 bits (142), Expect = 3.734e-9
Identity = 35/152 (23.03%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY-PYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP + T+ +  +D           I+  +  P L  +++P+  RN   + F Y  F+ +    ++  V+ +  L++C +
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ----HHIEVMETKPDLQAFQRPTVMRNP--KGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 59.3066 bits (142), Expect = 3.734e-9
Identity = 35/152 (23.03%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY-PYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP + T+ +  +D           I+  +  P L  +++P+  RN   + F Y  F+ +    ++  V+ +  L++C +
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ----HHIEVMETKPDLQAFQRPTVMRNP--KGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 56.6102 bits (135), Expect = 2.825e-8
Identity = 46/183 (25.14%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  406 RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLI 930
            + +E +   M+A+  ++R  + ++E  +  + Q+   +   ++          Q+ E +Q LR     E++ C  D               G F W+I + S+++      R   ++S  FYS   GYKMCL +  N        ++ + F +M+GK+D  L+WPF   VT+  +D  NR  I
Sbjct:  335 KEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDL----------QLAESEQSLR-----ELQFCTYD---------------GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHI 487          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 63.1586 bits (152), Expect = 3.712e-10
Identity = 67/257 (26.07%), Postives = 120/257 (46.69%), Query Frame = 1
Query:  280 NKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENA----RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEF--KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            N+M   + E  + K+ + N E +I  + Q++ E +A +L++     RN+ +T  E   +K+ Y SL++ +            Q+E +  N    +      QI  H Q L V+   +I   D D+R  Q    E     G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  V++  +D   + R+L       +   P  + ++KP+ + N
Sbjct:  263 NQMCSFEIEIERHKEQLRNNEARI-IQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLS-----------QLEVMAKNAASWNPGVLETQINRHDQMLSVH---DIRLADMDLRF-QVL--ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHL----GDAFKPDPNSSSFKKPTGEMN 497          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 62.7734 bits (151), Expect = 4.571e-10
Identity = 67/257 (26.07%), Postives = 120/257 (46.69%), Query Frame = 1
Query:  280 NKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENA----RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEF--KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            N+M   + E  + K+ + N E +I  + Q++ E +A +L++     RN+ +T  E   +K+ Y SL++ +            Q+E +  N    +      QI  H Q L V+   +I   D D+R  Q    E     G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  V++  +D   + R+L       +   P  + ++KP+ + N
Sbjct:  288 NQMCSFEIEIERHKEQLRNNEARI-IQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLS-----------QLEVMAKNAASWNPGVLETQINRHDQMLSVH---DIRLADMDLRF-QVL--ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHL----GDAFKPDPNSSSFKKPTGEMN 522          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 60.077 bits (144), Expect = 3.189e-9
Identity = 36/151 (23.84%), Postives = 75/151 (49.67%), Query Frame = 1
Query:  679 GFFEWQID------KISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G F W+I+      K  +++R   I+S+ FY+   GYK+CL ++++            +  H M+G++D  L WP + T+ +  +D +    +  +       P L  +++P+  RN   + F Y  F+ +    ++  V+N+  L++C++
Sbjct:  387 GIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNP--KGFGYVTFMHLQALKQRQYVKNDTLLVRCSV 535          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 59.3066 bits (142), Expect = 4.148e-9
Identity = 46/152 (30.26%), Postives = 75/152 (49.34%), Query Frame = 1
Query:  679 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYL--AGWRKPSNDRN--NPIRIFYYFGFI-SIKKAAVRNNNFLLKCNIE 1095
            G F W+I  ++ +       R   +YS  FY+   GYK+CL I  N        ++ + F +M+G++D  L WPFK+ VT   VD  NR+     S+  +  P +  A +++P ND N  +   +F     + S K A +R N   ++C I+
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRD-----SVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCIID 376          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 51.6026 bits (122), Expect = 1.478e-6
Identity = 30/89 (33.71%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  679 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANR 921
            G F W+I +  +++      R   ++S PFY+   GYKMCL I  N      + ++ + F +M+G  D  L WPF   VT+  +D  NR
Sbjct:  305 GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR 393          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 62.7734 bits (151), Expect = 3.042e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  263 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 503          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 62.7734 bits (151), Expect = 3.042e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  263 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 503          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 62.7734 bits (151), Expect = 3.395e-10
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  288 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 528          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 59.3066 bits (142), Expect = 4.262e-9
Identity = 62/292 (21.23%), Postives = 127/292 (43.49%), Query Frame = 1
Query:  280 NKMTELKTENSQF-----KQNIHNIELQIENKQQKMCEMEAKELENAR----NMEETNKEMKAL----KNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFI-KFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            N +     EN+Q       Q +HN+ L +     + C+  A      R    N EET K++++      ++ R L ++MET +  + +++  I  +E       D+  +             +E ++C           N I+I K G F   + K  +++R   I+S  FY+   GYK+C+ ++++            +  H M+G++D  L WPF+ T+ +  +D +   +  +        P L  +++P+  RN   + F Y  F+ +    +   ++++  L++C +
Sbjct:  256 NHLARHLQENTQLHMRLLAQAVHNVNLAL-----RPCDA-ASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLE-------DKVAE-------------MEAQQC-----------NGIYIWKIGNFGMHL-KSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNP--KGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 54.6842 bits (130), Expect = 1.017e-7
Identity = 57/272 (20.96%), Postives = 124/272 (45.59%), Query Frame = 1
Query:  340 ELQIENKQQKMCE----MEAKELENARNMEETNKEMKALKNEYRSLRSEMETN----TGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANR-NLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFI---SIKKAAVRNNNFLLKCNIE 1095
            +L+++  +   CE    +  + L   + + +  ++++   N    L  E+E +      +I+Q ++  E + ++ +++  E +Q    + Q+       + K ++ +RL++    +     G F W+I  ++++       R   ++S  FY+   GYK+CL +  N        ++ +   +MRG++D  L WPF+  VT   +D  NR + I +     S     A +++P ++ N       +F      S K A V+++   LKC ++
Sbjct:  152 DLEVDCYRAPCCESQEELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHI-LSLEQRVVELQQTLAQKDQV-------LGKLEHSLRLMEEASFD-----GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSS----ASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVD 406          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.500e-9
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  289 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 529          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 2.375e-9
Identity = 63/252 (25.00%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  322 QNIHN----IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLR---SEMETNTGAINQIRMQIEKVEINFQKQSDEF--------KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            Q++HN     E++IE +++ +   E+K L   R ++   +++K L  E R  R    E ++   ++  ++ ++ ++E +  K + +          Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D  S+ R+L       +   P  + ++KP+ + N
Sbjct:  288 QSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL----GDAFKPDPNSSSFKKPTGEMN 528          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 8.939e-9
Identity = 54/246 (21.95%), Postives = 116/246 (47.15%), Query Frame = 1
Query:  403 ARNMEE-TNKEMKALKNEYRSLRSEMETNTGAINQIR---MQIEKVEINFQKQSDEFKQI---YEHQQQLRVNKKLEIEKCDNDIRLIQTF-GNEIFI-KFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            AR+++E T   M+ L     SL   +  ++G I+++R     I ++E    +Q  + +++    E Q       K  I   ++ +  I+    N I+I K G F   + K  ++++   I+S  FY+   GYK+C+ ++++            +  H M+G++D  L WPF+ T+ +  +D +   +  +        P L  +++P+  RN   + F Y  F+ +    ++  ++++  L++C +
Sbjct:  259 ARHLQENTQSHMRMLAQAVHSL--SVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHL-KCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNP--KGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 9.360e-9
Identity = 61/292 (20.89%), Postives = 126/292 (43.15%), Query Frame = 1
Query:  280 NKMTELKTENSQF-----KQNIHNIELQI----ENKQQKMCEMEAKELENARNMEETNKEMKAL----KNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFI-KFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            N +     EN+Q       Q +HN+ L +     +   + C  E        N EET K+++       ++ R L ++MET +  +++++  I  +E       D+  +             +E ++C           N I+I K G F   + K  +++R   I+S  FY+   GYK+C+ ++++            +  H M+G++D  L WPF+ T+ +  +D +   +  +        P L  +++P+  RN   + F Y  F+ +    +   ++++  L++C +
Sbjct:  256 NHLARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRGCRPEDP------NYEETVKQLEGRLVRQDHQIRELTAKMETQSMHVSELKRTIRSLE-------DKVAE-------------MEAQQC-----------NGIYIWKIGNFGMHL-KSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNP--KGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 9.854e-9
Identity = 53/246 (21.54%), Postives = 116/246 (47.15%), Query Frame = 1
Query:  403 ARNMEE-TNKEMKALKNEYRSLRSEMETNTGAINQIR---MQIEKVEINFQKQSDEFKQI---YEHQQQLRVNKKLEIEKCDNDIRLIQTF-GNEIFI-KFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            AR+++E T   M+ L     SL   +  ++G ++++R     I ++E    +Q  + +++    E Q       K  I   ++ +  I+    N I+I K G F   + K  ++++   I+S  FY+   GYK+C+ ++++            +  H M+G++D  L WPF+ T+ +  +D +   +  +        P L  +++P+  RN   + F Y  F+ +    ++  ++++  L++C +
Sbjct:  259 ARHLQENTQSHMRMLAQAVHSL--SLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHL-KCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRNP--KGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. TrEMBL
Match: I3WEV1 (Tumor necrosis factor receptor-associated factor 3 OS=Pinctada fucata OX=50426 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.021e-9
Identity = 59/253 (23.32%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  283 KMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAK--ELENARNMEETNKEMKALKNEYRSLRSEMETNTG-AINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAV--DSANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            +M E+K      K  + +++L+I ++ +++  +E K  +L    +++   ++++ ++    S+   +    G A +Q    +  +E N         Q+ +H++QL + + + + + D   ++++T   +     G   W+I   S++K      R   +YS+PFY+  +GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +  D+  R+L    S  +   P  + +RKP+ + N
Sbjct:  254 QMAEIKRSMDDMKIQVRDVKLKIVSQTERIIHVERKVEDLAKKDSVDRHARDLQVIRETQASMSERIRQLEGRAPSQGNPAVPAIEGN---TGSVVPQVQQHERQLGL-QDIRLAELDLRFQVLETASYD-----GTLIWKIKDYSRRKQDAITGRTLSLYSQPFYTSRTGYKMCARVYLNGDGMGRGTHLSLFFVIMRGEYDTLLSWPFKQKVTLMLLDQDTGTRHL----SDTFRPDPSSSSFRKPTTEMN 493          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. TrEMBL
Match: S4RA88 (TNF receptor-associated factor OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.186e-9
Identity = 51/229 (22.27%), Postives = 113/229 (49.34%), Query Frame = 1
Query:  412 MEETNKEMKALKNEYRSLRSEMETNTGAINQ----IRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAA 1056
            + + N+++++L    R+   + + +T A+ +    +R ++  +E          ++ + H+Q+L ++  L ++  +  +++++T G       G   W+I   +++K      R   +YS+PFY+   GYKMC    +N        ++ + F +MRG++D  LEWPF+  VT+  +D  +A R+L    S  ++  P    +R+P  D N       +   ++++ ++
Sbjct:  183 LTQHNEQLQSLHVAQRA--PQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGL-LDTAERRLQVLETAGYS-----GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHL----SDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSS 399          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. TrEMBL
Match: Q6DEG0 (TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf3 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.162e-8
Identity = 59/251 (23.51%), Postives = 120/251 (47.81%), Query Frame = 1
Query:  292 ELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKL----EIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWI------YSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            E++ +N Q +Q + ++++ + +  +K+ E+E  EL   R +              R++R E+ET  G++  +R  +  ++ +    +     +   +QQL  +  L    ++   + D++L Q      F   G   W+I    ++K++  +      YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L+WPFK  VT+  +D   A ++L       +   P  + +R+P+ + N
Sbjct:  306 EMREKNRQLEQKLVSMQMLMSSHSEKLLEVEM-ELRELRPL--------------RAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKL-QVLETASF--NGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHL----GDAFKPDPSSSSFRRPTGEMN 534          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. TrEMBL
Match: A0A315W1S9 (Uncharacterized protein OS=Gambusia affinis OX=33528 GN=CCH79_00007768 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.457e-8
Identity = 64/260 (24.62%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  280 NKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEY---RSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-------QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD-SANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            ++++EL+++N + ++    +E ++ N Q           E+ + M   ++ + AL+ E    R LR E+ET  G ++ +R ++  +E   +  S           Q+  H   L V+   EI   D D+R  Q    E     G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +M+G++D  L WPFK  VT+  +D + +R  +      +   P+ + +R+P+ + N
Sbjct:  407 SRLSELESQNEELREKNRQMEQKLANLQVG---------EDGKMMSSHSETLMALEIELGSLRRLREEVETLRGTMDNVRTRLATLEQGGRSGSGSTHTFASLETQLNRHDDMLSVH---EIRLADMDLRF-QVL--ETASYNGTLIWKIRDYKRRKQEAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMKGEYDALLPWPFKQKVTLMLMDQTPSRKHL---GDAFKPDPHSSSFRRPTAEMN 648          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. TrEMBL
Match: A0A444SFZ4 (TNF receptor-associated factor 3 (Fragment) OS=Armadillidium vulgare OX=13347 GN=Avbf_18874 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.708e-8
Identity = 52/161 (32.30%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  613 IEKCDNDIRLIQTFGNEIFIKF--GFFEWQIDKISQ-----QKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY--------PYLAGWRKPSNDRNNPIRIFYYFGFISIKK 1050
            ++K D   + ++T   E+  KF  G F W+I   S+     +++  W YS PFYS   GY+ CL INV     D Y+ +  H M+ + D  L WPF   +T+  +D       CS+SIK SD+        PY A +++P   R+  I+ + +  FIS+ +
Sbjct:  366 VKKIDRITQNMRTISMEMNGKFCNGKFVWKIPNFSEILAMMKEKNRWFYSSPFYSSQFGYRFCLRINVTVVDGDPYLSLHIHTMQSENDDFLSWPFSGVITLMILD-------CSESIKKSDFIECMEIESPYEA-FQRPKTIRS--IKGYGFKEFISVSQ 516          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 61.6178 bits (148), Expect = 5.646e-10
Identity = 68/286 (23.78%), Postives = 136/286 (47.55%), Query Frame = 1
Query:  286 MTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEE---TNKEMKALKNEYRSLRSEMETNTGAINQ-IRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKL--EIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRK-EWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFH--LMRGKFDYKLEWPFKYTVTVDAVD-SANRNLICSKSIKYSDYPYLAG--WRKPSNDRNNPI---RIFYYFGFISIKKAA-VRNNNFLLKCNIE 1095
            ++ LK E S+    +  ++  +E +Q+++     +EL++ R++ E   T +E+ +L+    SLR ++     A+ Q +R  +  +    Q  +   + +  H QQL+ +++   ++E    D +LI               W++    ++K     + S PFY+  SGYK+   + +          +  +  LMRG FD  L WPF+  VT+  +D S NRN +   S+ ++  P LA   +R+P+++ N  +   R   +    + + AA VR++   +K  ++
Sbjct:  287 VSNLKREVSKCDTTVSAMQRSVE-EQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQV-----AMTQSLREHLGALGQTCQSHT---RLLDIHVQQLQCSEQRFQQLESTSYDGKLI---------------WKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHV---SLSFT--PDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 61.6178 bits (148), Expect = 7.227e-10
Identity = 35/152 (23.03%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY-PYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP + T+ +  +D A         ++  +  P L  +++P+  RN   + F Y  F+ +    ++  VR++  +++C +
Sbjct:  375 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ----HHVEVMETKPDLQAFQRPTVQRNP--KGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 61.6178 bits (148), Expect = 7.227e-10
Identity = 35/152 (23.03%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY-PYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP + T+ +  +D A         ++  +  P L  +++P+  RN   + F Y  F+ +    ++  VR++  +++C +
Sbjct:  375 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ----HHVEVMETKPDLQAFQRPTVQRNP--KGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 61.2326 bits (147), Expect = 7.451e-10
Identity = 35/152 (23.03%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDY-PYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP + T+ +  +D A         ++  +  P L  +++P+  RN   + F Y  F+ +    ++  VR++  +++C +
Sbjct:  351 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ----HHVEVMETKPDLQAFQRPTVQRNP--KGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 496          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 58.9214 bits (141), Expect = 4.944e-9
Identity = 53/198 (26.77%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  361 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLI 930
            QQKM  +E       R +E T   ++AL  + +  + ++E  +  + Q+   +   ++          Q+ E +Q LR     E++ C  D               G F W+I   S+++      R   ++S  FYS   GYKMCL +  N        ++ + F +MRGK+D  L+WPF   VT+  +D  NR  I
Sbjct:  306 QQKMTALENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDL----------QLAESEQALR-----ELQFCTYD---------------GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHI 473          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 2.448e-13
Identity = 51/229 (22.27%), Postives = 113/229 (49.34%), Query Frame = 1
Query:  412 MEETNKEMKALKNEYRSLRSEMETNTGAINQ----IRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAA 1056
            + + N+++++L    R+   + + +T A+ +    +R ++  +E          ++ + H+Q+L ++  L ++  +  +++++T G       G   W+I   +++K      R   +YS+PFY+   GYKMC    +N        ++ + F +MRG++D  LEWPF+  VT+  +D  +A R+L    S  ++  P    +R+P  D N       +   ++++ ++
Sbjct:  183 LTQHNEQLQSLHVAQRA--PQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGL-LDTAERRLQVLETAGYS-----GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHL----SDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSS 399          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 62.3882 bits (150), Expect = 8.172e-11
Identity = 38/180 (21.11%), Postives = 76/180 (42.22%), Query Frame = 1
Query:  658 NEIFIKFGFFEWQIDKIS----------------QQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXX---------------FHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISI----KKAAVRNNNFLLKCNI 1092
            +E  +  G F W++++ S                       ++S  FY+   GY++CL + V                            HL++G +D++L WPFK  + +  VD   R+ +    +  +D P L+ +++PS  RN   + F Y  F+ I     ++ +R++  +++C +
Sbjct:  386 SESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDAD-PQLSAFQRPSVHRNP--KGFGYMNFMDINTLHHRSYLRDDCLVVRCEV 562          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.324e-10
Identity = 65/323 (20.12%), Postives = 134/323 (41.49%), Query Frame = 1
Query:  181 ERKNDQINQQLNTIKVRMCRVSLKA----------ADNTELSINKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQ--TFGNEIFIKFGFFE---------WQIDKISQQK------RKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVD--SANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAA 1056
            E ++    Q L+ +  R   + LK           A++ +L   ++ EL+ E     Q     E  +   Q+ +     + L    +M+ T +     + ++ +LR +++     ++++  ++  +E        E      H         L+     +D +L    T   E+ ++F   E         W+I   +++K      R   +YS+PFY+   GY+MC    +N        ++ + F +MRG++D  L WPF+  VT+  +D  +A R L    S  +   P  + +R+P++D N       +   ++++ A+
Sbjct:  151 EHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQESMQGTTR-----RADHDALRGDLDGTAATLHELGTRVAAIE--------ESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQL----SDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESAS 456          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 61.6178 bits (148), Expect = 1.837e-10
Identity = 43/156 (27.56%), Postives = 74/156 (47.44%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXF--HLMRGKFDYKLEWPFKYTVTVDAVDSAN----RNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAA----VRNNNFLLKCNIEK 1098
            G F W++D   Q +          I+S PFY+   GYKMCL +N+          +    H+M+G +D  LEWPF   +T+  +D ++    R  I   S      P L  +++P++ RN+  + + Y  F  I +      ++NN+ L++  I +
Sbjct:  332 GTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPI---SETLVAKPNLLAFQRPTSPRNH--KGYGYVEFCPIDQLTEGQYIKNNSILVRIQISR 482          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 57.7658 bits (138), Expect = 4.068e-9
Identity = 34/88 (38.64%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  679 GFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSAN 918
            G F W+IDK +++           IYS PFY+   GYK+C  L  N      D+Y+ I   LMRG++D  L WPF+ T+T+  +D  N
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDN 467          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 54.6842 bits (130), Expect = 3.846e-8
Identity = 37/148 (25.00%), Postives = 70/148 (47.30%), Query Frame = 1
Query:  679 GFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIK-KAAVRNNNFLLKCNIE 1095
            G + W+ID+ +++       +   IYS PFY    GYK C  +  N        ++ + F LMRG+FD  L WPF+  VT   +D    + I      +   P  + +++P+++ N       +    +++ +A VR++   +K  ++
Sbjct:  378 GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDI---GDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKIAVD 522          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 50.8322 bits (120), Expect = 5.223e-7
Identity = 38/155 (24.52%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  493 AINQIRMQIEKVEINFQKQSDEFKQI---YEHQQQLRVNKKLEIEKCDNDIRLIQ--TFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSAN 918
            A++++R ++ ++ +  Q+  D  +++    E   Q    + L I   +  +  +Q  TF + +        W+I  ++ ++      R    YS  F++   GYKMC  I  N      + ++ + F +MRG+FD  L WPF+  VT+  +D  N
Sbjct:  273 AVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLL-------WKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN 420          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 45.0542 bits (105), Expect = 2.413e-6
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:  679 GFFEWQI-------DKISQQKRKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANR 921
            G F W+I       D+      +  I+S PFY+   GYK+ L   +N RD     ++ +   +M+G +D  LEWPFK  +T   +D + +
Sbjct:    2 GIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEK 91          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 61.6178 bits (148), Expect = 4.789e-10
Identity = 52/192 (27.08%), Postives = 89/192 (46.35%), Query Frame = 1
Query:  457 RSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIR--LIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRN 1002
            R LR EME+  G ++ +R ++  +E   +   +   Q+  H   L V+   EI   D D+R  +++T         G   W+I    ++K+         +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+  +D          + K    P  + +R+P  + N
Sbjct:  232 RQLRDEMESLRGTLDTVRTRLSALEQGGRASLE--TQLNRHDDMLSVH---EIRLADMDLRFQVLETASYN-----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMN 411          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 60.4622 bits (145), Expect = 1.571e-9
Identity = 67/269 (24.91%), Postives = 121/269 (44.98%), Query Frame = 1
Query:  163 ERSEIPERKNDQINQQLNTIKVRMCRVSLKAADNTELSINKMTELKTENSQFKQNIHN-IELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAI----NQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLI 930
            +R E+  +K  +++Q L  +++RM    L  +    L       L T  +     +   +ELQ+++++ K+ E+       +R  +E   ++   +N    L  E+E +   +     Q R+  +K+EI     S++ +Q+ E    LR    +E+E    D+    T+        G F W+I   ++++      R   ++S  FY+   GYKMCL I  N        ++ + F +MRG  D  L+WPF   VT+  +D  NR  I
Sbjct:  265 QRLEVASQKLHELHQSLRDLELRM--SQLGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTKVAEL-------SRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEI----LSNKVRQL-ERTVSLRDLSIVEMEGKMKDMS-AATYD-------GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHI 511          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 58.151 bits (139), Expect = 7.554e-9
Identity = 38/151 (25.17%), Postives = 70/151 (46.36%), Query Frame = 1
Query:  679 GFFEWQIDKISQQKRKEWI------YSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFIS----IKKAAVRNNNFLLKCNI 1092
            G F W++   S   R +        +S  FY+   GYK+CL ++++            +  H M+G FD +L WPF+ T+ +  +D         + ++    P L  ++KP N RN   + F Y  F+      ++A V+++  L++C +
Sbjct:  396 GIFIWRLKAFSTHLRSQEAGIPVVEHSPGFYTGRPGYKLCLRLHLQTPTAPRCSNFISLFVHTMQGVFDSQLTWPFQGTIRLAILDQGPEGQHHMEVMETK--PDLQAFQKPINQRNP--KGFGYVTFMHRSLLSQRAYVKDDTLLIRCEV 542          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 57.7658 bits (138), Expect = 1.126e-8
Identity = 52/183 (28.42%), Postives = 91/183 (49.73%), Query Frame = 1
Query:  418 ETNKEMKALKNEYRSLRSEMETNTGAI----NQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLI 930
            + +K++ AL+N    L  E+E ++  +    +Q R+  EK+E      S++ +Q+   ++ L V K L++ + +  +R +Q    +     G F W+I   S ++      R   ++S  FYS   GYKMCL +  N        ++ + F +MR K+D  L+WPF   VT+  +D  NR  I
Sbjct:  289 DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIE----NLSNKIRQL---ERSLTV-KDLQLSEAEQMVRELQYCTYD-----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHI 458          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 57.3806 bits (137), Expect = 1.197e-8
Identity = 52/183 (28.42%), Postives = 91/183 (49.73%), Query Frame = 1
Query:  418 ETNKEMKALKNEYRSLRSEMETNTGAI----NQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLI 930
            + +K++ AL+N    L  E+E ++  +    +Q R+  EK+E      S++ +Q+   ++ L V K L++ + +  +R +Q    +     G F W+I   S ++      R   ++S  FYS   GYKMCL +  N        ++ + F +MR K+D  L+WPF   VT+  +D  NR  I
Sbjct:  296 DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIE----NLSNKIRQL---ERSLTV-KDLQLSEAEQMVRELQYCTYD-----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHI 465          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 518.464 bits (1334), Expect = 0.000e+0
Identity = 269/301 (89.37%), Postives = 278/301 (92.36%), Query Frame = 1
Query:  220 IKVRMCRVSLKAADNTELSI-------NKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 1101
            ++ RM R+  K ADNT +S        +++T L  EN QFKQ I NI+ Q  N+QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL
Sbjct:  170 LRQRMGRMEAKEADNTVVSRSQIQLFRDEITVLSRENRQFKQQIDNIDSQSTNQQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 470          

HSP 2 Score: 62.7734 bits (151), Expect = 1.929e-10
Identity = 33/56 (58.93%), Postives = 41/56 (73.21%), Query Frame = 2
Query:    2 MNEVVCDEMNSHLNESNYSHIKLLIDRIDNLQYQVESMKEENKQLTQRMCQMEEKD 169
            +NEV  DEMN+HLNESNY H  LLI  I+NL  Q+ES+  EN +L QRM +ME K+
Sbjct:  126 INEVASDEMNAHLNESNYCHSNLLIAMINNLNSQMESLMNENMELRQRMGRMEAKE 181          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 517.309 bits (1331), Expect = 0.000e+0
Identity = 269/301 (89.37%), Postives = 278/301 (92.36%), Query Frame = 1
Query:  220 IKVRMCRVSLKAADNTELSI-------NKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 1101
            ++ RM R+  K ADNT +S        +++T L  EN QFKQ I NI+ Q  N+QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL
Sbjct:  177 LRQRMGRMEAKEADNTVVSRSQIQLFRDEITVLSRENRQFKQQIDNIDSQSTNQQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 477          

HSP 2 Score: 62.7734 bits (151), Expect = 1.869e-10
Identity = 33/56 (58.93%), Postives = 41/56 (73.21%), Query Frame = 2
Query:    2 MNEVVCDEMNSHLNESNYSHIKLLIDRIDNLQYQVESMKEENKQLTQRMCQMEEKD 169
            +NEV  DEMN+HLNESNY H  LLI  I+NL  Q+ES+  EN +L QRM +ME K+
Sbjct:  133 INEVASDEMNAHLNESNYCHSNLLIAMINNLNSQMESLMNENMELRQRMGRMEAKE 188          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 470.7 bits (1210), Expect = 6.544e-165
Identity = 253/301 (84.05%), Postives = 262/301 (87.04%), Query Frame = 1
Query:  220 IKVRMCRVSLKAADNTELSI-------NKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 1101
            ++ RM R+  K ADNT +S        +++T L  EN QFKQ I NI+ Q  N+QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMR                VDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL
Sbjct:  170 LRQRMGRMEAKEADNTVVSRSQIQLFRDEITVLSRENRQFKQQIDNIDSQSTNQQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMR----------------VDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 454          

HSP 2 Score: 62.7734 bits (151), Expect = 1.885e-10
Identity = 33/56 (58.93%), Postives = 41/56 (73.21%), Query Frame = 2
Query:    2 MNEVVCDEMNSHLNESNYSHIKLLIDRIDNLQYQVESMKEENKQLTQRMCQMEEKD 169
            +NEV  DEMN+HLNESNY H  LLI  I+NL  Q+ES+  EN +L QRM +ME K+
Sbjct:  126 INEVASDEMNAHLNESNYCHSNLLIAMINNLNSQMESLMNENMELRQRMGRMEAKE 181          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Planmine SMEST
Match: SMESG000049844.1 (SMESG000049844.1)

HSP 1 Score: 329.717 bits (844), Expect = 4.871e-109
Identity = 190/336 (56.55%), Postives = 236/336 (70.24%), Query Frame = 1
Query:  118 GRK*AVDAENVPDGRERSEIPERKNDQINQQLNTIKVRMCRVSLKAADNT-------ELSINKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQ-TFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 1101
            GR  A + +N    RE  E  + +N++INQ+L+ IKVRM R++LK ADNT       +L  +++T L  EN QFKQ I +I+ Q  N+QQKM EMEA+E ENA  +E   +E+  LKNEYRS+ S+METN  AINQIRMQIE++EIN Q+QSD  KQ  E QQQL+ NK LE+EKC N+IR IQ TFG E  +K GFFEW+I+KIS+  RKEWIYSKPFYS    YKMCLA+ +        I + F+LMRG FD  LEWPFKY+VT+D +DSAN N+I SKSIKYSD P  AGWRKP+++RN PIR +     IS   AAV+NN  LLKC IEKL
Sbjct:  175 GRMEAKELQN----REEIERLKGENNKINQKLDKIKVRMVRMALKEADNTVVSRTQIQLLRDEITVLSRENRQFKQQIDDIDSQSTNQQQKMGEMEAREQENAGEIELLKEEILVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCE-QQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEINKISELMRKEWIYSKPFYSRPFEYKMCLALFI--GSDIGGIAVGFNLMRGDFDKNLEWPFKYSVTIDVIDSANGNIIDSKSIKYSDNPDAAGWRKPASNRNCPIRTYNSIPIIS---AAVKNNKLLLKCKIEKL 500          

HSP 2 Score: 63.5438 bits (153), Expect = 1.140e-10
Identity = 34/56 (60.71%), Postives = 42/56 (75.00%), Query Frame = 2
Query:    2 MNEVVCDEMNSHLNESNYSHIKLLIDRIDNLQYQVESMKEENKQLTQRMCQMEEKD 169
            +NEV  DEMN+HLNES+Y H KLLI  I+NL  Q+ESM  EN +L QRM +ME K+
Sbjct:  126 INEVARDEMNAHLNESSYCHSKLLIAMINNLNRQMESMMNENMKLRQRMGRMEAKE 181          
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Planmine SMEST
Match: SMESG000049844.1 (SMESG000049844.1)

HSP 1 Score: 329.331 bits (843), Expect = 6.611e-109
Identity = 190/336 (56.55%), Postives = 236/336 (70.24%), Query Frame = 1
Query:  118 GRK*AVDAENVPDGRERSEIPERKNDQINQQLNTIKVRMCRVSLKAADNT-------ELSINKMTELKTENSQFKQNIHNIELQIENKQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQ-TFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL 1101
            GR  A + +N    RE  E  + +N++INQ+L+ IKVRM R++LK ADNT       +L  +++T L  EN QFKQ I +I+ Q  N+QQKM EMEA+E ENA  +E   +E+  LKNEYRS+ S+METN  AINQIRMQIE++EIN Q+QSD  KQ  E QQQL+ NK LE+EKC N+IR IQ TFG E  +K GFFEW+I+KIS+  RKEWIYSKPFYS    YKMCLA+ +        I + F+LMRG FD  LEWPFKY+VT+D +DSAN N+I SKSIKYSD P  AGWRKP+++RN PIR +     IS   AAV+NN  LLKC IEKL
Sbjct:  174 GRMEAKELQN----REEIERLKGENNKINQKLDKIKVRMVRMALKEADNTVVSRTQIQLLRDEITVLSRENRQFKQQIDDIDSQSTNQQQKMGEMEAREQENAGEIELLKEEILVLKNEYRSMSSQMETNAEAINQIRMQIERIEINSQQQSDALKQNCE-QQQLQANKNLEMEKCANEIRQIQSTFGYENLLKSGFFEWEINKISELMRKEWIYSKPFYSRPFEYKMCLALFI--GSDIGGIAVGFNLMRGDFDKNLEWPFKYSVTIDVIDSANGNIIDSKSIKYSDNPDAAGWRKPASNRNCPIRTYNSIPIIS---AAVKNNKLLLKCKIEKL 499          

HSP 2 Score: 57.7658 bits (138), Expect = 7.402e-9
Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = 2
Query:    2 MNEVVCDEMNSHLNESNYSHIKLLIDRIDNLQYQVESMKEENKQLTQRMCQMEEKD 169
            +NEV  DEMN+HLNES+Y H KLLI  I+NL  Q+ESM  EN +L +RM +ME K+
Sbjct:  126 INEVARDEMNAHLNESSYCHSKLLIAMINNLNRQMESMMNENMKL-RRMGRMEAKE 180          
The following BLAST results are available for this feature:
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF31.877e-1025.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.773e-1025.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.773e-1025.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.123e-1025.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.123e-1025.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.193e-1223.51TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf63.734e-923.03TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf63.734e-923.03TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf63.734e-923.03TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf2b2.825e-825.14Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh23.712e-1026.07slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh24.571e-1026.07slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf3.189e-923.84epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
hspb64.148e-930.26heat shock protein family B (small) member 6 [Sour... [more]
TRAF21.478e-633.71TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf33.042e-1025.00TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.042e-1025.00TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.395e-1025.00TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf64.262e-921.23TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf11.017e-720.96TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13114|TRAF3_HUMAN1.500e-925.00TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE2.375e-925.00TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q9Y4K3|TRAF6_HUMAN8.939e-921.95TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|B5DF45|TRAF6_RAT9.360e-920.89TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
sp|B6CJY5|TRAF6_MACMU9.854e-921.54TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I3WEV12.021e-923.32Tumor necrosis factor receptor-associated factor 3... [more]
S4RA883.186e-922.27TNF receptor-associated factor OS=Petromyzon marin... [more]
Q6DEG01.162e-823.51TNF receptor-associated factor OS=Danio rerio OX=7... [more]
A0A315W1S91.457e-824.62Uncharacterized protein OS=Gambusia affinis OX=335... [more]
A0A444SFZ41.708e-832.30TNF receptor-associated factor 3 (Fragment) OS=Arm... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf55.646e-1023.78TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf67.227e-1023.03TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf67.227e-1023.03TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf67.451e-1023.03TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf2b4.944e-926.77TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.12.448e-1322.27pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf68.172e-1121.11TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000000074.13.324e-1020.12pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO487731.837e-1027.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352374.068e-938.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494643.846e-825.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388735.223e-724.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291452.413e-631.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf34.789e-1027.08TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.21.571e-924.91TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf67.554e-925.17TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf2b1.126e-828.42TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.197e-828.42TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of Tumor necrosis factor receptor-associated factor 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049895.11.929e-1089.37SMESG000049895.1[more]
SMESG000049895.11.869e-1089.37SMESG000049895.1[more]
SMESG000049895.16.544e-16584.05SMESG000049895.1[more]
SMESG000049844.14.871e-10956.55SMESG000049844.1[more]
SMESG000049844.16.611e-10956.55SMESG000049844.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027541 ID=SMED30027541|Name=Tumor necrosis factor receptor-associated factor 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1203bp
AATGAATGAAGTGGTGTGTGACGAAATGAATTCCCATCTCAATGAGAGCA
ATTATTCCCATATCAAATTGCTGATTGATCGGATCGATAATTTGCAGTAT
CAGGTGGAATCTATGAAGGAAGAAAATAAGCAGTTGACGCAGAGAATGTG
CCAGATGGAAGAGAAAGATCGGAAATACCAGAGAGAAAAAATGATCAAAT
CAATCAGCAATTAAATACAATAAAAGTGAGAATGTGCCGCGTGTCACTGA
AGGCCGCTGACAACACGGAACTAAGCATCAATAAAATGACAGAATTAAAG
ACAGAAAACAGCCAATTCAAACAAAACATTCATAATATCGAGCTGCAAAT
AGAAAATAAACAACAGAAAATGTGTGAGATGGAAGCGAAAGAACTGGAAA
ACGCCAGGAATATGGAGGAAACAAATAAAGAAATGAAGGCATTAAAAAAT
GAGTATCGATCATTGAGAAGCGAAATGGAGACAAATACTGGAGCAATCAA
TCAAATCCGGATGCAGATCGAGAAGGTTGAGATAAATTTCCAAAAGCAAA
GTGATGAATTTAAACAAATATATGAGCATCAGCAGCAGTTACGAGTCAAT
AAAAAACTGGAAATAGAGAAATGTGACAATGACATTCGGCTTATTCAAAC
ATTTGGAAATGAAATTTTTATAAAATTTGGATTTTTTGAATGGCAAATTG
ATAAAATTTCACAGCAAAAGAGAAAGGAATGGATATACAGCAAGCCATTT
TATTCTGAGTCATCCGGGTACAAAATGTGTTTGGCGATTAATGTTAGGGA
TTATTATATTGATGATTATATTGATATTGATTTCCATTTGATGCGTGGTA
AATTCGATTATAAATTGGAATGGCCATTTAAATATACAGTGACAGTAGAT
GCGGTAGATTCAGCAAATAGAAACCTTATTTGCAGCAAATCAATAAAATA
TTCCGATTACCCTTATCTCGCTGGATGGAGAAAGCCATCAAATGACAGAA
ATAATCCAATTCGCATATTTTATTATTTTGGTTTTATCTCAATCAAAAAA
GCAGCTGTGAGAAATAATAATTTTCTACTGAAGTGTAACATCGAAAAATT
ATGAAACATTTAAACAAATTATTCAACAATCACAGTTTTTATTAAAACTT
TTGTTCCTATTTTGTTAATTTGTCATGGTGAATGTATGGTTATTTTTTTA
AAA
back to top

protein sequence of SMED30027541-orf-1

>SMED30027541-orf-1 ID=SMED30027541-orf-1|Name=SMED30027541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MCRVSLKAADNTELSINKMTELKTENSQFKQNIHNIELQIENKQQKMCEM
EAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVE
INFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFG
FFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDID
FHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWR
KPSNDRNNPIRIFYYFGFISIKKAAVRNNNFLLKCNIEKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0004871signal transducer activity
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0019901protein kinase binding
GO:0019903protein phosphatase binding
GO:0031625ubiquitin protein ligase binding
GO:0031996thioesterase binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0002224toll-like receptor signaling pathway
GO:0002376immune system process
GO:0006915apoptotic process
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0016567protein ubiquitination
GO:0016579protein deubiquitination
GO:0030162regulation of proteolysis
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0032480negative regulation of type I interferon production
GO:0032648regulation of interferon-beta production
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0035666TRIF-dependent toll-like receptor signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005768endosome
GO:0005829cytosol
GO:0009898cytoplasmic side of plasma membrane
GO:0035631CD40 receptor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..63
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 2..242
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 60..243
e-value: 6.3E-24
score: 86.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 104..241
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 2..242