MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30027539
Length (bp)1589
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30027539) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30027539) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30027539) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30027539) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027539

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 3 cellSMED30027539h1SMcG0013307 SmedASXL_018064SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30027539h1SMcG0013307 SmedASXL_018064SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30027539h1SMcG0013307 SmedASXL_018063SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027539h1SMcG0013307 SmedASXL_018063SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30027539 SmedASXL_077684SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027539 SmedASXL_077684SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30027539h1SMcG0013307 dd_Smed_v4_17804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027539h1SMcG0013307 dd_Smed_v4_17804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027539h1SMcG0013307 dd_Smed_v4_11835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027539h1SMcG0013307 dd_Smed_v4_11835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027539h1SMcG0013307 dd_Smed_v6_11835_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30027539h1SMcG0013307 dd_Smed_v6_11835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30027539h1SMcG0013313 dd_Smed_v6_11835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 177.178 bits (448), Expect = 9.449e-49
Identity = 132/460 (28.70%), Postives = 227/460 (49.35%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            T+++ +  IGFGRFH  L +++ S   +  ++I +++ + PV+ C W+L    + +  T +F G ++ S+L G   D+YGR   L+IS     Y + + + +P+  W       +G  V G    +  +  E+ P KYR   + ++      G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L     YY ++L    +      C    +    V       +     C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N + IYT E++PT++R+ GMG  G++ R+G  +AP ++ V++   S+L    +   + ++C   +F LP ETK + L Q
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of MFS domain-containing protein vs. Ensembl Human
Match: SVOP (SV2 related protein [Source:HGNC Symbol;Acc:HGNC:25417])

HSP 1 Score: 168.318 bits (425), Expect = 4.342e-45
Identity = 126/471 (26.75%), Postives = 223/471 (47.35%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFV-LNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +F+G +  S L G   D+YGRK  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     +L   ++P  GWR L+++SAV  ++  V    +PES RY +L+  +   +  +  +A  N A     + I   QE    +  ++DL  P++  TT+L+ FI   N  +YY +VL+   +      C           I  +   V+  C   C  ++  +Y  +L +T  E   +   + +I  +GRKKT+ +   I     + L  C+    L +LLF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++     L  T+ ++    L+    S  LP ETK + L +++   
Sbjct:   70 VEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE---DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC----------GISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL--TLAVYSGCCLLAALASCFLPIETKGRGLQESSHRE 524          
BLAST of MFS domain-containing protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 121.324 bits (303), Expect = 7.151e-30
Identity = 97/329 (29.48%), Postives = 160/329 (48.63%), Query Frame = 2
Query:  578 EWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            E+ P KYR   + ++      G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L     YY ++L    +      C    +    V       +     C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N + IYT E++PT++R+ GMG  G++ R+G  +AP ++ V++   S+L    +   + ++C   +F LP ETK + L Q
Sbjct:   11 EFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of MFS domain-containing protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 121.324 bits (303), Expect = 7.151e-30
Identity = 97/329 (29.48%), Postives = 160/329 (48.63%), Query Frame = 2
Query:  578 EWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            E+ P KYR   + ++      G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L     YY ++L    +      C    +    V       +     C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N + IYT E++PT++R+ GMG  G++ R+G  +AP ++ V++   S+L    +   + ++C   +F LP ETK + L Q
Sbjct:   11 EFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of MFS domain-containing protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 116.701 bits (291), Expect = 6.255e-28
Identity = 90/301 (29.90%), Postives = 149/301 (49.50%), Query Frame = 2
Query:  662 LGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L     YY ++L    +      C    +    V       +     C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N + IYT E++PT++R+ GMG  G++ R+G  +AP ++ V++   S+L    +   + ++C   +F LP ETK + L Q
Sbjct:   71 LASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 370          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 169.859 bits (429), Expect = 2.826e-46
Identity = 121/464 (26.08%), Postives = 216/464 (46.55%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAE-----TIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQT 1561
            T+D  +  +GFGRF   L I+         +++ ++S + P L+C W ++++   +  T +F G ++ S   G+ CD++GR+  L  S  +      +   SP+ Y L  F    G  + G+P +V  LY E+ P   R   + +     + G     LL Y ++  FGWR LM +S++   I  V    +PES R+ + +      L  +   A+ NR +      +   +    ++ +I +L+ P+   TTIL+  I  +   +YY +VL   ++      C  +   FS        N      C  +  ++Y  +L +T  E   +   +++I + GRKKT+ +   +  I    L FCL+   + +L+FV R   + +     +YT E++PT++R+ G+G C A+ R+G  + P +A V   K SL     I     ++    S  LP ETK + +  +
Sbjct:   68 TVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSV-TLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDEC--HGGLFS--------NGTQMEVCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEK-SLSLPIGIYGTAAILGLIASLSLPIETKGRQMMDS 519          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 169.859 bits (429), Expect = 2.826e-46
Identity = 121/464 (26.08%), Postives = 216/464 (46.55%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAE-----TIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQT 1561
            T+D  +  +GFGRF   L I+         +++ ++S + P L+C W ++++   +  T +F G ++ S   G+ CD++GR+  L  S  +      +   SP+ Y L  F    G  + G+P +V  LY E+ P   R   + +     + G     LL Y ++  FGWR LM +S++   I  V    +PES R+ + +      L  +   A+ NR +      +   +    ++ +I +L+ P+   TTIL+  I  +   +YY +VL   ++      C  +   FS        N      C  +  ++Y  +L +T  E   +   +++I + GRKKT+ +   +  I    L FCL+   + +L+FV R   + +     +YT E++PT++R+ G+G C A+ R+G  + P +A V   K SL     I     ++    S  LP ETK + +  +
Sbjct:   68 TVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSV-TLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDEC--HGGLFS--------NGTQMEVCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEK-SLSLPIGIYGTAAILGLIASLSLPIETKGRQMMDS 519          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: hmit-1.1 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXR3])

HSP 1 Score: 68.9366 bits (167), Expect = 3.993e-12
Identity = 46/167 (27.54%), Postives = 84/167 (50.30%), Query Frame = 2
Query:  383 IGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYF-EWSPAKYRIIFIGIAAFTMSFGCFLGTLLG----YVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQE 868
            +GSL+ G   D  GR+  ++ ++ IF     VCAAS N   L +  + +GI+ +G    + P+Y  E +P   R + +   A  +SFG  +  + G    Y+     GWR++   +AV ++I  V  + +PE+PR+L  N  +++   V+  V   ++     ++ E
Sbjct:   80 VGSLMSGTSSDYIGRRKVILGASAIFTIGALVCAASVNKIMLLVGRVLLGIA-IGFASMIVPVYLGETAPTHVRGMLVAAFALMISFGQVVANITGGAFSYIDPYNVGWRLMFAFAAVPSIIQFVCFMFLPETPRWLYENGFETETREVLEKVYNGDKEWVEYEMAE 245          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: hmit-1.2 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXQ9])

HSP 1 Score: 63.929 bits (154), Expect = 1.650e-10
Identity = 58/224 (25.89%), Postives = 98/224 (43.75%), Query Frame = 2
Query:  383 IGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYF-EWSPAKYRIIFIGIAAFTMSFGCFLGTLLG----YVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWN--------------RAETIKDIQEPPVTKPNI-KDLIHPNYLST----TILVSFISL--VNYLTYYT 976
            +G+   G   D+YGRK  +I S  IF+    +CA +     + +  +F+G+  +G    V P+Y  E SP   R   +   A  +SFG  +  ++G    Y      GWR++   + +  +I  V  I +PE+PR+L  N       +V+  +   N                E  K ++E   + P I + L  P+ L      ++L +F  L  +N + YYT
Sbjct:   81 VGAWFSGAGSDRYGRKPIIIGSTLIFVCGAVICAVAWTKIVMLIGRIFLGVG-IGFASMVVPVYLGEASPTHVRGTLVSAFAMMISFGQVVANIMGGVFSYWEPYTIGWRLMFAFAGIPALIQFVCFIFLPETPRWLYENGHTEQAEQVLEKIYGGNTEWIEYELAEIKTYAEERQKQMEEEKKSGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYT 303          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 53.1434 bits (126), Expect = 4.164e-7
Identity = 94/416 (22.60%), Postives = 170/416 (40.87%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA---------ETIKDIQEPPVTKP-----NIKDLIH-PNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQ--LNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEE 1570
            G  IG+ L G   DK+GR+ +  +   + I      + + +I    +   F G++   +    F +  E+     R IF G+   ++ FG  +  LLG V +    WR L            ++   +PESPR+ +     +D  + +  +AK N           +++K+ Q     K      N+ DL   PN    T++V++I ++N + Y                        + + ++  N  VDD          Y S +I+ + E+        L+   GR+ T+   + +  IG +S  F  +     +    F+ +    +   +I I+  E++PT VR+ GMG+   V   G  LAP + N  + K   +   +I+ ++ L    ++F LP ET    L  T E+
Sbjct:  147 GSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGR-IFSGLMT-SLFFGAAMA-LLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIY------------------------NGLTLNVSNLPVDD----------YWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVN--LGKIVKILPLLIMGLMALSAGILTFFLP-ETLGAPLPMTIED 522          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0343347)

HSP 1 Score: 135.961 bits (341), Expect = 2.469e-34
Identity = 110/454 (24.23%), Postives = 206/454 (45.37%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD---IQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYET 1537
            T+   +N  GFG FH  L +++        +++ I+S LGP L C W +         T +F+G ++ S    +  ++YGRK AL +   + +  + + + +P+  WL      +G ++  +P +V  LY E+ P K++   + +     + G     +L  V+ P +GWR L+ +SA   +I T+    + ES RY   N      ++V+  +A  N+   +       + P    + + L+ P+   TTIL+ F+ L +   YY +VL+                  +T  +  +N     + C+    +++  +L  T  E   I   I ++   G+KKTI +    +++  + L    +    ++ LF+ RG  +     I +YT EI+P ++RS G+  C  + R+G  L P +A V++   S +       ++ L+       LP ET
Sbjct:   41 TVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSV-TLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLV------------------TTELLVARNKESHPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLM-DSSRIQAMSTYAIVGLLASIACVFLPRET 474          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0072197)

HSP 1 Score: 135.961 bits (341), Expect = 2.469e-34
Identity = 110/454 (24.23%), Postives = 206/454 (45.37%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD---IQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYET 1537
            T+   +N  GFG FH  L +++        +++ I+S LGP L C W +         T +F+G ++ S    +  ++YGRK AL +   + +  + + + +P+  WL      +G ++  +P +V  LY E+ P K++   + +     + G     +L  V+ P +GWR L+ +SA   +I T+    + ES RY   N      ++V+  +A  N+   +       + P    + + L+ P+   TTIL+ F+ L +   YY +VL+                  +T  +  +N     + C+    +++  +L  T  E   I   I ++   G+KKTI +    +++  + L    +    ++ LF+ RG  +     I +YT EI+P ++RS G+  C  + R+G  L P +A V++   S +       ++ L+       LP ET
Sbjct:   41 TVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSV-TLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLV------------------TTELLVARNKESHPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLM-DSSRIQAMSTYAIVGLLASIACVFLPRET 474          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340268)

HSP 1 Score: 71.2478 bits (173), Expect = 9.127e-13
Identity = 54/215 (25.12%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  191 DNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRF-----------GWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSD 802
            +  +   G+G+FH+ LL +    +    + +  MSF+ P   C   LN       N+ +FIG ++G+   G   D +GRK  LI+ + +  +     + S    +  LF    G ++ G    ++  + E+ P   R   +   A   +FG      L ++IIPR             WRI +++ ++ + ++   L  +PESP++L L +GK D
Sbjct:  138 ERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFL-LTRGKKD 351          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340266)

HSP 1 Score: 71.2478 bits (173), Expect = 9.127e-13
Identity = 54/215 (25.12%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  191 DNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRF-----------GWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSD 802
            +  +   G+G+FH+ LL +    +    + +  MSF+ P   C   LN       N+ +FIG ++G+   G   D +GRK  LI+ + +  +     + S    +  LF    G ++ G    ++  + E+ P   R   +   A   +FG      L ++IIPR             WRI +++ ++ + ++   L  +PESP++L L +GK D
Sbjct:  138 ERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFL-LTRGKKD 351          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340267)

HSP 1 Score: 71.2478 bits (173), Expect = 9.127e-13
Identity = 54/215 (25.12%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  191 DNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRF-----------GWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSD 802
            +  +   G+G+FH+ LL +    +    + +  MSF+ P   C   LN       N+ +FIG ++G+   G   D +GRK  LI+ + +  +     + S    +  LF    G ++ G    ++  + E+ P   R   +   A   +FG      L ++IIPR             WRI +++ ++ + ++   L  +PESP++L L +GK D
Sbjct:  138 ERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFL-LTRGKKD 351          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 179.104 bits (453), Expect = 1.547e-49
Identity = 135/462 (29.22%), Postives = 234/462 (50.65%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 1564
            T++  +  IGFG FH  L +++ S   +  ++I +++ + P + C W L    + + +T +F G ++  +L G   DKYGR   +        Y +F+ + S +  W       +G  V       F L  E+ PAKYR   + +A+     G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V   +YY  VL    +      C+ + +    ++ H +  T+    C+  N ++Y ++LIS  GE+  IP  IIL++ +GRK ++ I L +     + +N C   L   ILLF++R + + + N++ IYT E++PTSVRS GMG C +  R+GG +AP +A V++ K  +LA +       +IC    F LP ET+ + L Q A
Sbjct:   50 TVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIK-HIQEETL--CYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALSPFA-TACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 179.104 bits (453), Expect = 1.547e-49
Identity = 135/462 (29.22%), Postives = 234/462 (50.65%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 1564
            T++  +  IGFG FH  L +++ S   +  ++I +++ + P + C W L    + + +T +F G ++  +L G   DKYGR   +        Y +F+ + S +  W       +G  V       F L  E+ PAKYR   + +A+     G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V   +YY  VL    +      C+ + +    ++ H +  T+    C+  N ++Y ++LIS  GE+  IP  IIL++ +GRK ++ I L +     + +N C   L   ILLF++R + + + N++ IYT E++PTSVRS GMG C +  R+GG +AP +A V++ K  +LA +       +IC    F LP ET+ + L Q A
Sbjct:   50 TVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIK-HIQEETL--CYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALSPFA-TACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 178.333 bits (451), Expect = 3.014e-49
Identity = 134/460 (29.13%), Postives = 232/460 (50.43%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCC--MKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNL 1552
            T++  +  IGFGRFH  L +++ S   +  ++I +++ + P + C W L    + + +T +F G ++  +L G   DKYGR   +        Y +F+ + S +  W       +G  V       F L  E+ PAKYR   + +A+     G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V   +YY  VL    +      C+ + +       HQ  +  ++  C  +  N ++Y ++LIS  GE+  IP  IIL++ +GRK ++ I L +     + +N C   L   ILLF++R + + + N++ IYT E++PTSVRS GMG C +  R+GG +AP +A V++ K  +LA +       +IC    F LP ET+ + L
Sbjct:   50 TVEEAVESIGFGRFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDL-----EHQIKHIQEEMLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALSPFA-TACIICAIGVFFLPIETRGRAL 502          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 157.918 bits (398), Expect = 1.321e-41
Identity = 123/476 (25.84%), Postives = 215/476 (45.17%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFC------VSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG F + L I+   +     +++ I+S L P L C W L +  + +  + +FIG +I S L G   DKYGRK  L +S    ++   + A +P   W+      +G  + G P +V  LY E+ P + R   I +     + G     LL  +++P  GWR L+ +S +   I       +PES RY +L   +   L  +  +A  N       + I   QE    +  I+DL  P++  TT+L+ FI   N  +YY +VL+   +      C              K + ++  C   C  +N ++Y  +L +T  E   +   +  I  +GR+KT+ +  F+  + I+ L  C+    L + +F+ R           +YT E++PT+ R+ G+G    + RVG  + P +A V++        + +   L++ C C       S  LP ET  + L +++   
Sbjct:   69 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQE---DRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTELFQEGGVC-----------GGAKGSKMEPGCSLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-------ESSVYLTLSVYCCCCLLAAIASCALPIETTGRGLQESSHRE 522          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 157.532 bits (397), Expect = 1.817e-41
Identity = 123/476 (25.84%), Postives = 215/476 (45.17%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFC------VSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG F + L I+   +     +++ I+S L P L C W L +  + +  + +FIG +I S L G   DKYGRK  L +S    ++   + A +P   W+      +G  + G P +V  LY E+ P + R   I +     + G     LL  +++P  GWR L+ +S +   I       +PES RY +L   +   L  +  +A  N       + I   QE    +  I+DL  P++  TT+L+ FI   N  +YY +VL+   +      C              K + ++  C   C  +N ++Y  +L +T  E   +   +  I  +GR+KT+ +  F+  + I+ L  C+    L + +F+ R           +YT E++PT+ R+ G+G    + RVG  + P +A V++        + +   L++ C C       S  LP ET  + L +++   
Sbjct:   59 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQE---DRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTELFQEGGVC-----------GGAKGSKMEPGCSLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-------ESSVYLTLSVYCCCCLLAAIASCALPIETTGRGLQESSHRE 512          
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 170.629 bits (431), Expect = 9.861e-46
Identity = 124/470 (26.38%), Postives = 221/470 (47.02%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGR+  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N  +YY +VL+                   T ++ Q  + V   C   C  + + +Y  +L +T  E   +   + +I  +GRKKT+ I   +  +  + L  C+    L + LF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++ + S+    ++     ++    S  LP ETK + L +++   
Sbjct:  116 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLL-------------------TTELFQAGDAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQESSHRE 561          
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 168.703 bits (426), Expect = 2.815e-45
Identity = 124/470 (26.38%), Postives = 220/470 (46.81%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGR+  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N  +YY +VL+   +      C           I  +   V   C   C  + + +Y  +L +T  E   +   + +I  +GRKKT+ I   +  +  + L  C+    L + LF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++ + S+    ++     ++    S  LP ETK + L +++   
Sbjct:   69 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC----------SISNQRKAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQESSHRE 523          
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 167.162 bits (422), Expect = 7.343e-45
Identity = 123/470 (26.17%), Postives = 217/470 (46.17%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGR+  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N  +YY +V             L     F    +      V   C   C  + + +Y  +L +T  E   +   + +I  +GRKKT+ I   +  +  + L  C+    L + LF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++ + S+    ++     ++    S  LP ETK + L +++   
Sbjct:   64 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLV-------------LLTTELFQAGDVCSSKKAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQESSHRE 515          
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 163.31 bits (412), Expect = 2.203e-43
Identity = 121/467 (25.91%), Postives = 223/467 (47.75%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGR+  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N  +YY +VL+   +      C    ++  +  + +   ++    C  + + +Y  +L +T  E   +   + +I  +GRKKT+ I   +  +  + L  C+    L + LF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++ + S+    ++     ++    S  LP ETK + L +++   
Sbjct:   70 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCS---SKLKSKTMCRPKCSL---ACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQESSHRE 525          
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 143.665 bits (361), Expect = 1.780e-36
Identity = 121/465 (26.02%), Postives = 212/465 (45.59%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGR+  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA+    L +F I    S  YL L           +   K N    +K+       +  I+DL  P +  TT+L+ FI   N  +YY +VL+   +      C           I  +   V   C   C  + + +Y  +L +T  E   +   + +I  +GRKKT+ I   +  +  + L  C+    L + LF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++ + S+    ++     ++    S  LP ETK + L +++   
Sbjct:   63 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSAL---PLFLFAILCFVSLFYLKL-------YFYFSFTMKRNILFVLKE------DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC----------SISNQRKAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQESSHRE 499          
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Match: Svopl (SV2 related protein homolog (rat)-like [Source:MGI Symbol;Acc:MGI:2444335])

HSP 1 Score: 171.4 bits (433), Expect = 7.807e-47
Identity = 132/462 (28.57%), Postives = 230/462 (49.78%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVTKP-NIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRC-LQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            T+++ +  IGFGRFH  L +++ S   +  ++I +++ + PV+ C W+L    +    T +F G ++ S+L G   D+YGR   L++S     Y + + + SP+  W       +G  V G    +  +  E+ P KYR   + ++      G  L   +  V+IP  GWR L+ I+++  +IL +    IPES R+ +        L  +  +AK NR+   +  + EP + K     DL+   YL TT+ +  I L     YY ++L    +      C  ++ +    V+    +      C C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N I IYT E++PT +R+ GMG  G++ R+G  +AP ++ V++   S L    +   + ++C   +F LP ETK + L Q
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVEPILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVILASAELLERDLVCGSKSESEPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAPFISQVLM-SASFLGALCLFSSVCVVCAISAFTLPIETKGRALQQ 492          
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Match: Svop (SV2 related protein [Source:MGI Symbol;Acc:MGI:1915916])

HSP 1 Score: 160.614 bits (405), Expect = 1.615e-42
Identity = 128/471 (27.18%), Postives = 223/471 (47.35%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFV-LNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFGRF + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGRK  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA   ++  V    +PES RY +L+  +   +  +  +A  N A     + I   QE    +  ++DL  P++  TT+L+ FI   N  +YY +VL+   +      C           I  +   V+  C   C  ++  +Y  +L +T  E   +   + +I  +GRKKT+ +   I  +  + L  C+    L +LLF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++     L  T+ ++    L+    S  LP ETK + L +++   
Sbjct:   70 VEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPSLGWRWLLLLSAAPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE---DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC----------SISSRKKAVEAKCSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL--TLAVYSGCCLLAGVASCFLPIETKGRALQESSHRE 524          
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 88.5817 bits (218), Expect = 2.020e-18
Identity = 96/418 (22.97%), Postives = 182/418 (43.54%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLI-------HPNYLS--TTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFL-------QLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNK 1579
            G ++G+++ G   D++GR+  L+++    +    + AAS N        +  G ++ G  + V PL  EW   ++R +   I+    + G  L TL+GY+I     WR L++ + +  V   + +  +PES R+L+      +  + ++I AK N     + I E  +++  +  +I        P+YL    T  +  +SL                      C+  W     V       T+D S    + +  Y + L+  + E+        L+  +GR+ T        M+   +L F ++ L        +  L+ + +  S A+     ++T+E++PT +R  GMG    +GR+G +LAPL+  V++    LL   +    ++ +  C   LLP ETK   L +T ++  +
Sbjct:   28 GVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLI---RSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNG----RPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLC---------------------CMMMWF---GVNFSYYGLTLDAS---GLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLT-----EAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLV--VLLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPETIQDVER 403          
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 88.5817 bits (218), Expect = 4.345e-18
Identity = 94/410 (22.93%), Postives = 181/410 (44.15%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLV-NYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFL-------QLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNK 1579
            G ++G+++ G   D++GR+  L+++    +    + AAS N        +  G ++ G  + V PL  EW   ++R +   I+    + G  L TL+GY+I     WR L++ + +  V   + +  +PES R+L+      +  + ++I AK N              +P  +D +    L+  I +  +S   +YL  +    +  +       C+  W     V       T+D S    + +  Y + L+  + E+        L+  +GR+ T        M+   +L F ++ L        +  L+ + +  S A+     ++T+E++PT +R  GMG    +GR+G +LAPL+  V++    LL   +    ++ +  C   LLP ETK   L +T ++  +
Sbjct:  152 GVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLI---RSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLN-------------GRPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLC----CMMMWF---GVNFSYYGLTLDAS---GLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLT-----EAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLV--VLLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPETIQDVER 527          
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Match: Slc22a19 (solute carrier family 22 (organic anion transporter), member 19 [Source:MGI Symbol;Acc:MGI:2442751])

HSP 1 Score: 71.2478 bits (173), Expect = 1.301e-12
Identity = 110/427 (25.76%), Postives = 178/427 (41.69%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIP---IPESPRYLILNKGKSDCLRVMNIVAKWNRAET-------------IKDIQEPPVTKPNIKDLIH-PNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-----CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQ-LNILLFVIRG-ISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEE-RNK 1579
            G  IG ++ G   DK+GRKL    S      +    A +P+           GI    +      L  EW+  K++ + + +       G    TLLG +      W  L +    L+V + + LIP   + ES R+LI+       L+ +   A  NR +              +K+  E   TKP+  DL   PN      L+SF+  V+ ++   +              L N    S       NN     C     C+  N+    SM                  +++GR+ T  IF+ ++ I I+++ F    +Q L + L  + G IS+ASI   +++  E+ PT +R+  +G+ G  G  GGAL+PLL  +I+  YS     +I  +L  +   V+ LLP ETK+Q L  + ++  NK
Sbjct:  155 GIFIGYIMGGHLSDKFGRKLIFTCSLLKMAITETCVAFAPSFLIYCSLRFLSGIFSSTLRTNSALLILEWTSPKFQALVMALIFIASGVG---QTLLGGLAFAFRNWHHLQL---ALSVPMFLLLIPTRWLSESARWLIMANKPQKSLKELKKAACVNRIKNSGDALTLEVVKTIMKEELEAAQTKPSPLDLFRTPNLRKRICLLSFVRFVSVMSLLGL--------------LINIQYLS-------NNVFLLQCLYGVVCIPANVLGNFSM------------------NYMGRRMTQLIFMSVLGISILAVVFLPQEMQILRVFLSTLGGAISSASITSTLVHANELVPTIIRATALGVVGIAGSAGGALSPLL--MILTTYSASLPWIIYGILPFLGGLVALLLP-ETKNQPLPDSIQDIENK 533          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1LVS8|SVOPL_DANRE (Putative transporter SVOPL OS=Danio rerio OX=7955 GN=svopl PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.168e-48
Identity = 135/462 (29.22%), Postives = 234/462 (50.65%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 1564
            T++  +  IGFG FH  L +++ S   +  ++I +++ + P + C W L    + + +T +F G ++  +L G   DKYGR   +        Y +F+ + S +  W       +G  V       F L  E+ PAKYR   + +A+     G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V   +YY  VL    +      C+ + +    ++ H +  T+    C+  N ++Y ++LIS  GE+  IP  IIL++ +GRK ++ I L +     + +N C   L   ILLF++R + + + N++ IYT E++PTSVRS GMG C +  R+GG +AP +A V++ K  +LA +       +IC    F LP ET+ + L Q A
Sbjct:   50 TVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIK-HIQEETL--CYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALSPFA-TACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N434|SVOPL_HUMAN (Putative transporter SVOPL OS=Homo sapiens OX=9606 GN=SVOPL PE=1 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 4.538e-48
Identity = 132/460 (28.70%), Postives = 227/460 (49.35%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            T+++ +  IGFGRFH  L +++ S   +  ++I +++ + PV+ C W+L    + +  T +F G ++ S+L G   D+YGR   L+IS     Y + + + +P+  W       +G  V G    +  +  E+ P KYR   + ++      G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L     YY ++L    +      C    +    V       +     C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N + IYT E++PT++R+ GMG  G++ R+G  +AP ++ V++   S+L    +   + ++C   +F LP ETK + L Q
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PDF3|SVOPL_MOUSE (Putative transporter SVOPL OS=Mus musculus OX=10090 GN=Svopl PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.461e-46
Identity = 132/462 (28.57%), Postives = 230/462 (49.78%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVTKP-NIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRC-LQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            T+++ +  IGFGRFH  L +++ S   +  ++I +++ + PV+ C W+L    +    T +F G ++ S+L G   D+YGR   L++S     Y + + + SP+  W       +G  V G    +  +  E+ P KYR   + ++      G  L   +  V+IP  GWR L+ I+++  +IL +    IPES R+ +        L  +  +AK NR+   +  + EP + K     DL+   YL TT+ +  I L     YY ++L    +      C  ++ +    V+    +      C C     ++Y +M+IST GEI   P  I+ I+F+GR+ ++ I +    +  + LN C +   L   LF++R +  A+ N I IYT E++PT +R+ GMG  G++ R+G  +AP ++ V++   S L    +   + ++C   +F LP ETK + L Q
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVEPILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVILASAELLERDLVCGSKSESEPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAPFISQVLM-SASFLGALCLFSSVCVVCAISAFTLPIETKGRALQQ 492          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2XWK0|SVOP_XENLA (Synaptic vesicle 2-related protein OS=Xenopus laevis OX=8355 GN=svop PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.827e-45
Identity = 125/470 (26.60%), Postives = 220/470 (46.81%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG+F + L ++         +++ I+S L P L C W+L +  + +  + +FIG +  S L G   D+YGR+  L IS    +Y   + A +P   W+ +    +G  + G+P +V  LY E+ P K R   I +     + G     LL   ++P  GWR L+++SA+  ++  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N  +YY +VL+   +      C           I  +   V   C   C  + + +Y  +L +T  E   +   + +I  +GRKKT+ I   I     + L  C+    L + LF+ R   +       +YT E++PT+ R+ G+G C  + RVG  + P +A V++ + S+    ++     ++    S  LP ETK + L +++   
Sbjct:   70 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVIWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEIFWALGTVFEVLLAIFVMPTLGWRWLLILSALPLMLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRCTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC----------SISNQRKAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGLLVTLWIIDRVGRKKTMAICFIIFSFSALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAAVASCFLPIETKGRGLQESSHRE 524          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|P30638|SVOP_CAEEL (Putative transporter svop-1 OS=Caenorhabditis elegans OX=6239 GN=svop-1 PE=3 SV=5)

HSP 1 Score: 169.859 bits (429), Expect = 3.595e-45
Identity = 121/464 (26.08%), Postives = 216/464 (46.55%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAE-----TIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQT 1561
            T+D  +  +GFGRF   L I+         +++ ++S + P L+C W ++++   +  T +F G ++ S   G+ CD++GR+  L  S  +      +   SP+ Y L  F    G  + G+P +V  LY E+ P   R   + +     + G     LL Y ++  FGWR LM +S++   I  V    +PES R+ + +      L  +   A+ NR +      +   +    ++ +I +L+ P+   TTIL+  I  +   +YY +VL   ++      C  +   FS        N      C  +  ++Y  +L +T  E   +   +++I + GRKKT+ +   +  I    L FCL+   + +L+FV R   + +     +YT E++PT++R+ G+G C A+ R+G  + P +A V   K SL     I     ++    S  LP ETK + +  +
Sbjct:   68 TVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSV-TLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDEC--HGGLFS--------NGTQMEVCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEK-SLSLPIGIYGTAAILGLIASLSLPIETKGRQMMDS 519          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A177BET0 (Putative transporter SVOPL OS=Intoshia linei OX=1819745 GN=A3Q56_00019 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.348e-54
Identity = 142/465 (30.54%), Postives = 246/465 (52.90%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD---IQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDD--SC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQT 1561
            T+++ +  IGFG+F  +L+ V    +    L++ ++S L P L C +KL  + +    T +F+G   GS L G   DKYGR + + +S+   +Y     A SPN YW+ +    +G +  G  +  F L  E+ P+KYR   + I +   + G      +  +IIPR+GWR+L+ +SA+  ++ +V +  +PES R+L+ +   +    V+N +A +   +T+     I    + KPN+ DL   +YL T++ V FI  +   +YY ++L    I    H            ++H + + V +   C C  ++ ++YNSM+I+T GE + IPF +  I ++GRK T+ I   I  +  + +    N + L   +F++R  ++   N I IYT E++PT VRS G+GI  ++ R+G  L P ++ V++  YSL A   +  VL ++C   +F L +ET  + + QT
Sbjct:   47 TVEDAVEHIGFGKFQLWLIFVCGLFSATDALEMLLLSVLSPALRCDFKLTEVQVAFITTIVFVGMFSGSFLWGTISDKYGRLITMFVSSIWILYFGIGTAFSPNYYWMLILRGIVGFAFGG-AIQSFTLISEYLPSKYRAKVLIIYSLMWAVGSLFEIGMASIIIPRWGWRVLVAVSALPMLLTSVCVWTLPESARFLVASGRHNQAYNVLNYIA-YKNGKTLPSKNLISLVQIKKPNVMDLFRGDYLRTSLQVWFIWFLVAFSYYGMILGQSEILEFKH----------ITRVHTETSPVHEISQCHCNSLSSSDYNSMVIATLGEFVAIPFNLFTIDWLGRKYTLMINFLIAGLAFLLILVSSNKMVLTFFVFLVRAFTSGLFNCIYIYTIEVYPTIVRSSGLGIGSSMARIGAMLTPFVSQVLL-NYSLTAAISLYGVLCILCAVNAFYLKHETSGKKMKQT 498          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1S3N013 (putative transporter SVOPL OS=Salmo salar OX=8030 GN=svopl PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.859e-53
Identity = 137/470 (29.15%), Postives = 242/470 (51.49%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPP--VTKPNIKD------LIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCC--MKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 1564
            +++  +  IGFGRFH  L I++ S +    ++I +++ + P + C W L+   + + +T +F G ++  +L G   D+YGR   +   +    Y + + + SP+  W     L +G  V G     F L  E+ PA YR   + +A+     G  L  LLG  ++P  GWR ++ +S + +VIL +    IPES RY +        +  +  +A+ NRA        PP  + +P +KD      L+ P + ST++L+ +   V   +YY  VL    +      C+ +    +  +  QK++  +D  C  +    ++Y ++LIS  GE+  IP  I L++  GRK ++ +   +  +  + +N C       ILLF+IR + + + N++ IYT E++PT+VRS GMG C +  R+GG +AP +A V++  +S++   +   V  ++C   +FLLP ETK + L Q++
Sbjct:   57 SVEEAVETIGFGRFHVLLFIIMGSASIAEAMEIMLLAVVSPEIRCEWHLDDWEVALVSTMVFAGFMVCGVLSGYVADRYGRWKVVFGGSLWAAYFSLLTSFSPSYGWFIFLRLMVGCGVAGCSQG-FVLKTEFIPASYRSYLLPLASIFWMVGSMLIILLGMTVVPTLGWRWMIRLSVIPSVILLLLFQLIPESARYNVSAGNVQAAVETLQRIARMNRASM------PPGRLMEPVVKDRGSWRLLVSPAFRSTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTD----ADAEHQQKHSHPEDGLCYCIPFGFSDYQTLLISCLGEVALIPLNICLLNVFGRKLSMVLLELMAALFFMLVNVCSTMFGFTILLFLIRSLVSMNFNVVYIYTAEVYPTAVRSLGMGFCTSFSRIGGMIAPFIAQVLM-SHSVILALLPFSVACVLCAVGAFLLPIETKGRALLQSS 514          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8G7A7 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 5.349e-53
Identity = 136/470 (28.94%), Postives = 232/470 (49.36%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVT------KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERN 1576
            T++  + ++GFGRF   +L +    +    +++ ++S LGP L C W+L +  +    T +F G ++G+   G   DK GR     +S C+  Y   +C+ SP+ +WL      +G ++ G   + F L  E+ P ++R   + +       G     LL Y+++P  GWR L+  S++   +  + L  +PES R+L+ +    +   V++ +A+ NR   ++    P V       +  +K L HP Y  T+ ++  +      +YY IVL+   I      C        TV  +   + VD+SCC  +  ++Y +MLIS+ GE + IP  ++ I  +GR+ T+ I   +  +       C+        LF+IR  S    N I IYTTE++PT +RS G+GIC A+ R+G    P +A VI+   S+L   +I  +++L C  +  LLP ET  + L  + E  N
Sbjct:   89 TVEEAVEKLGFGRFQIKILCITGIMSAADAMEMLLLSVLGPALRCDWRLTSTEVAGITTVVFAGMLLGAPGWGAVSDKRGRWSVFALSLCLMAYFGLLCSFSPDYFWLVSLRGVVGFNIGGAA-SSFTLLSEYLPQQHRAKVLILYNLFWGLGSTFEILLAYLVLPTLGWRYLVAFSSLPLFLFMLTLGHLPESARFLLASGRAEEAAAVIDQIARENRRPAMEG--RPAVATVSESDRGQLKALFHPFYRRTSFILFSLWFGVAFSYYGIVLVSTEIFRFHQDCFSTAQSV-TVAHNTTESVVDNSCCRGLQSDDYTAMLISSLGEFVIIPVNMLTIDALGRRATLGINYLLTGVFFGLTYLCVPKAATTAFLFLIRAHSAGIFNTIYIYTTEVYPTVIRSLGLGICSAMARLGSMTTPFVAQVIMPDVSVLLAFIIYLMVDLSCAGLCVLLPIETSGRALAHSLELPN 554          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A0F8AIU4 (Putative transporter SVOPL OS=Larimichthys crocea OX=215358 GN=EH28_10262 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 7.520e-53
Identity = 137/462 (29.65%), Postives = 238/462 (51.52%), Query Frame = 2
Query:  176 EMETIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD-IQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNL 1552
            E  T++  +  IGFGRFH  L +++ S+  +  ++I +++ + P + C WKL+   + + +T +F+G ++  +  G   D+YGR   +        Y + + + +P+  W       +G  V G+    F L  E+ P K+R   + +A+     G  L  LLG +++P  GWR ++ IS   ++IL      IPES RY +        +  +  +AK NRA      + EP V  + + + L+ P++  T++L+ +   V    YY  VL    +      C+ + +R   V+ HQ     D  C C+   +++Y ++LIS  GE+  IP  I L++  GRK ++ +   +  I  + LN C   L   +LLF++R + + + N++ IYT E++PT+ RS GMG C +  R+GG +AP +A V++ K S++       V  +IC   +FLLP ETK + L
Sbjct:   48 ETFTVEEAVETIGFGRFHILLFVIMGSSNIVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTMVFLGFMVCGVFGGYIADRYGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQG-FVLKTEFIPEKHRAFLLPLASIFWMIGSMLIILLGMLVVPTLGWRWMIRISVTPSIILIFLFKFIPESARYNVSAGNIQAAVATLEKIAKMNRASLPPGRLVEPAVNERGSWRILLSPSFRRTSLLLWYSWFVASFIYYGSVLSSSELLEKNLLCVTDADREHRVK-HQHE---DGLCYCIPFALSDYQTLLISCLGEVALIPINICLLNVFGRKMSLTVLQLLSAILFMILNICTTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTAARSLGMGFCTSFSRIGGMIAPFIAQVLMSK-SVIEALSPFAVACVICAVGNFLLPIETKGRAL 503          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: I3JL10 (SVOP-like OS=Oreochromis niloticus OX=8128 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.187e-52
Identity = 131/459 (28.54%), Postives = 238/459 (51.85%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKP--NIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNL 1552
            T+++ + +IGFGRFH  L +++ S+  +  ++I +++ + P + C W+L    + + +T +F+G ++  +L G   D+YGR   ++       Y + + + +P+  W       +G  V G+    F L  E+ PAKYR I + +A      G  L  +LG +++P +GWR ++ IS   ++IL      IPES RY +        ++ ++ +AK NRA         P+T+   + + L+ P++  T++L+ +   V    YY  VL    +      C+ + ++   V    K+   D  C C+    ++Y ++LIS  GE+  +P  I L++  GRK T+ +   +     + LN C       +LLF++R + + + N++ IYT E++PT  RS GMG C +  R+GG +AP +A V++ +  +LA      V  ++C   +FL+P ETK + L
Sbjct:    4 TVEDAVEKIGFGRFHILLFVIMGSSNIVEAMEIMLLAVVSPEIRCEWRLEDWQVALVSTMVFLGFMVCGVLGGYIADRYGRWKVVVGGFVWSAYFSLLTSFAPSYGWFIFLRAMVGCGVAGVSQG-FVLKTEFIPAKYRAILLPLATIFWMLGSMLIIILGMLVVPTWGWRWMIRISVTPSIILIFLFKFIPESARYNVSAGKTEAAMKTLHWIAKMNRASLPPGRLVEPITRERGSWRILLSPSFRRTSVLLWYSWFVASFIYYGSVLSSSELLEKNLLCVIDADKEHQV----KHRHEDGLCYCIPFGYSDYQTLLISCLGEVALVPANIALLNVFGRKMTLTVLQLLAAFFFMILNICSTMFGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSQSVILA-LCPFAVACVLCALGNFLMPIETKGRAL 456          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 164.466 bits (415), Expect = 4.536e-44
Identity = 124/476 (26.05%), Postives = 217/476 (45.59%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFC------VSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG F + L I+   +     +++ I+S L P L C W+L +  + +  + +FIG +I S L G   DKYGRK  L +S    ++   + + +P   W+      +G  + G P +V  LY E+ P + R   I +     + G     LL  +++P  GWR L+ +S +   I  +    +PES RY +L+  +   L  +  +A  N+      + I   QE    +  IKDL  P++  TTIL+ FI   N  +YY +VL+   +      C              K +  +  C   C  +N ++Y  +L +T  E   +   +  I  +GR+KT+ +      + I+ L  C+    L +L+F+ R           +YT E++PT+ R+ G+G    + RVG  + P +A V++        + +   L++ C C       S  LP ET  + L +++   
Sbjct:   71 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQE---ERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGACGDT-----------KGSKAEPRCNLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFLFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-------ESSVYLTLSVYCCCCLLAAVASCALPIETTGRGLQESSHRE 524          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 161.77 bits (408), Expect = 4.583e-43
Identity = 123/473 (26.00%), Postives = 217/473 (45.88%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFC------VSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG F + L I+   +     +++ I+S L P L C W+L +  + +  + +FIG +I S L G   DKYGRK  L +S    ++   + + +P   W+      +G  + G P +V  LY E+ P + R   I +     + G     LL  +++P  GWR L+ +S +   I  +    +PES RY +L+  +   L  +  +A  N+      + I   QE    +  IKDL  P++  TTIL+ FI   N  +YY +VL+   +      C         ++   + N      C  +N ++Y  +L +T  E   +   +  I  +GR+KT+ +      + I+ L  C+    L +L+F+ R           +YT E++PT+ R+ G+G    + RVG  + P +A V++        + +   L++ C C       S  LP ET  + L +++   
Sbjct:   73 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQE---ERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGAC-------GGIKAEPRCNLE----CKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFLFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-------ESSVYLTLSVYCCCCLLAAVASCALPIETTGRGLQESSHRE 523          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 145.206 bits (365), Expect = 1.474e-37
Identity = 126/457 (27.57%), Postives = 223/457 (48.80%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNL 1552
            +++  +  IGFGRFH  L I++ S   +  ++I +++ + P + C W+L    + + +T +F+G +I  +L G   DKYGR   +        Y + + + +P+  W       +G  V       F L  E+ PAK+R   + +A+     G  L  +LG  ++P  GWR ++  S + ++IL          PR+ IL          +N+            I+   +    +K +I   Y  + +++ F++     TYY  VL    +      C+ +    +  +   K+N  +  C C+  N+ +Y ++LIS  GE+  IP  I L++ +GRK ++ I L +  +  + +N C       +LLF++R + + + N++ IYT E++PTSVRS GMG C +  R+GG +AP +A V++ K  LLA +       L C   + LLP ET+ + L
Sbjct:   33 SVEEAVESIGFGRFHVLLFIIMGSANIVEAMEIMLLAVVSPEIRCEWRLEDWQVALVSTMVFLGFMICGVLCGYVADKYGRWKVVFGGFVWAAYFSLLTSFAPSYGWFIFLRSMVGCGVAATSQG-FVLKTEFIPAKHRAFLLPLASIFWMVGSLLIIILGMTVVPTLGWRWMIRFSIIPSLILIGLF---QVKPRWWILEY--------LNLF-----------IELLLIIVLEVK-IILSRYRYSILVLKFVA---SFTYYGSVLSSSELLEKNLLCVVD----ADAEHGIKHNQEEALCYCIPFNMADYQTLLISCLGEVALIPLNIGLLNVVGRKLSMIILLLLSAVFFMLVNVCTTMFGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTSVRSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVLLALSPFSLACCL-CAVGTALLPIETRGRAL 457          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: SLC22A2 (solute carrier family 22 member 2-like [Source:NCBI gene;Acc:103036098])

HSP 1 Score: 77.411 bits (189), Expect = 1.267e-14
Identity = 105/408 (25.74%), Postives = 176/408 (43.14%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNI---NNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLN---FLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSL--LAGTMIIF-VLNLICFCVSFLLPYETKDQNLHQTAEE 1570
            G ++GS+ IG   DK+GRK++ ++SN +   +  + A SPN   L +F    G  V G  +A + L  E     +++ F        SFG  L   L   +IP   WR L V   V  +I   +   +PESPR+L+     S  + V   +AK N+               NIK+L   N  ++T   SF+ L+                   H  + ++N F++  ++Q          M++ I   N Y   LIS   E       +  I  IGR+        +     +   F      +L+  +      GI+ A   +++   TE++PT +R+ G+ +C  +  +GG +AP L    +++ ++  L   +IIF VL  +   +  LLP ETK   L +T ++
Sbjct:  160 GFLVGSITIGYLADKFGRKMSFLLSNILNAVTGILVAISPNYISLVVFRALHGFGVKGGWMAAYVLMTETVGVLFQMFF--------SFGLLL-LALIAYLIPN--WRWLQVAFTVPYIIFLSYYWFVPESPRWLLSQNKSSRAVEVTQAMAKENKK----------TLSQNIKNLKDDNAETST--GSFMDLIR------------TPKIRKHTLILSFNWFTSAVVYQ-------GLIMRLGILRGNIYIDFLISGIVEFPAAFLILFTIERIGRRLPFAAANIVSGAACLITAFIPESVLWLKTAVACIGRLGITMA-FEMVVFVNTELYPTFIRNLGVSVCSTLCDIGGIIAPFL----LYRLAVIWLELPLIIFGVLAFVAGGLVLLLP-ETKGVPLPETIDD 519          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-190l8.2 (solute carrier family 22 member 13-like [Source:NCBI gene;Acc:103030531])

HSP 1 Score: 70.0922 bits (170), Expect = 2.492e-12
Identity = 57/213 (26.76%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNK----------GKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIH---PNYLSTTILVSFISLVNYLTYY 973
            G +IGS++ G   DKYG+K  L+ S+ +      + A  P   +        GI+   I +  + L  EWS  KYRI    + +F  S G      + Y+     GW    +  A+  ++       IPESPR+L+LNK             +  + ++++      E+ K  +E    K  + D  H   P  L    ++SFI + + LTYY
Sbjct:   90 GLLIGSIIGGTLSDKYGKKFLLVCSSVLHSVVALLTAFFPYALFYLSVRCMAGIACCAIHICTYSLGVEWSIPKYRIWPTTLLSFIFSLGMMALAAVAYLTT---GWMQFHLALAIPQILCLPLYFSIPESPRWLLLNKRMHVLEDYRNRSPEVRQYLDLLLDSEGNESQKANKEETDCK-KVSDFTHFKSPTILLRLFVMSFIGIASALTYY 298          
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 181.415 bits (459), Expect = 2.320e-51
Identity = 133/481 (27.65%), Postives = 238/481 (49.48%), Query Frame = 2
Query:  134 RSALHS-SAK*NIL*EMETIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVTKP-NIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTE--IFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQ 1558
            RSAL S  A  N+  +  +++  +  +GFGRFH  LL ++ S      ++I ++S + P + C W+L    + +  T +F G ++ S   G   D+YGR   L++      Y + + + SP   W       +G  + G     F L  E+ P+  R   + ++      G  L  +L Y+I+P  GW  L+ IS + + +L +    IPES RY +        L  +  +AK N+    +  + EPP  +  NI DL+   YL TT+    I     LTYY ++L+   +      C    +  + ++ H   +  +  C C +    +Y ++L+S+ GE + IPF  + I  +GR++++ + + +  +    LN C   + L +LLF +R +++ + N+I IYT E  ++PT++RS G+G C +  R+G  +AP +A VI+   S+     +   + +IC  ++F LP ET  + + +
Sbjct:   15 RSALMSLPAAQNVEPKTFSVEQAVEHMGFGRFHILLLFIMGSTTIAESMEIMLLSVISPTIQCEWRLQQWQVALVTTMVFFGFMLSSGPCGFLADRYGRWKVLLLVTIWSSYWSGISSFSPTYGWFVFLRFLMGCGIGGQSQG-FVLMSEFMPSTARGRVLPMSQVFWVLGSLLEVVLAYLILPTLGWAWLIRISTIPSFVLLIAFKFIPESARYQVSAAKPDKALLTLAKIAKMNKTTLPQGTLVEPPAERRGNIWDLLDRQYLRTTLQTWPIWFGTTLTYYGLILVSSELLERNQMCGD--DSVTAIEEHIAFSEQESPCFCKQFKSEDYKTLLLSSFGEFLAIPFTTLTIDTLGRRRSMALSMILCGLLYYLLNICTTRMGLTVLLFFLRAVASTNFNIIYIYTVEVKVYPTNIRSLGLGSCSSTARIGAMIAPFVAQVIL-DISIPLALCLFGTVCVICSVLAFTLPIETMGREMKE 491          
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 65.4698 bits (158), Expect = 7.041e-12
Identity = 46/155 (29.68%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILM--VISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAK 832
            G ++GSL+ G   D+YGR+ AL+ S  +   +    A +P+    T     +G+S+ GI +    L  EW    +R        F  S G     LL Y++    GW+ L   V S +   ILT +   IPESPR+L++     +  R +++ A+
Sbjct:  150 GVMLGSLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWLDQGHRTFAGTSGGFAWSTGNMALGLLAYLLR---GWQQLQLVVTSPIYFCILTWWF--IPESPRWLLVRGRAREAHRNLSLCAR 299          
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 56.9954 bits (136), Expect = 6.215e-9
Identity = 48/187 (25.67%), Postives = 84/187 (44.92%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQE--PPVTK-------PNIKDLIH 907
            G ++G++L+G   D+YGR+ +L++S  +      + A +PN           GI  +G    VF    E+  +  R +   +     SFG  + + + Y +     WR L +   +  V+L  +   +PESPR+LI    K     V+  +A  N  E   +I++    VT+       P+I DL+ 
Sbjct:  166 GLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLRT---WRYLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEKAGNPSIADLMR 349          
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 55.4546 bits (132), Expect = 1.162e-8
Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 2
Query: 1298 RGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIF-VLNLICFCVSFLLPYETKDQNLHQTAEE 1570
            +G  + S N   +YT EIFPT +R  G+G+C  + RVGG LAPL   VI+   SL A  + ++   +L+   + + LP ET ++ L +T EE
Sbjct:  223 KGALSCSFNCAYLYTGEIFPTVIRQSGLGLCSTMARVGGMLAPL---VIMAGESLPALPLSMYGSASLVAGSLVYFLP-ETLNRPLPETIEE 310          
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001436.1 (pep scaffold:Pmarinus_7.0:GL476665:296817:321845:1 gene:ENSPMAG00000001290.1 transcript:ENSPMAT00000001436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 6.631e-8
Identity = 64/280 (22.86%), Postives = 117/280 (41.79%), Query Frame = 2
Query:  182 ETIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIIS---NCIFIY-SNFVCAASPNIYWLTLFHLFIGISVVGIPLA-VFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGW-------------RILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLT 967
            +  +  +   G GRF +   +VL       G+++ +++F+ P       +         T +++G ++GSL+ G   D+ GR+  L+++   N +F + S+FV       Y   +F  F+    +G  +  V+  Y E+     R   +     T  FG    + + + IIP +GW             R+ +++ A+  V   V L  +PESPR+L L  GK D          W   + + D         N+K   HP  + T   +  +  V+ +T
Sbjct:  150 QQYEAVMQECGHGRFQWTFYMVLGLALMADGVEVFVVAFVLPSAERDLCITDAGKGWLGTLVYLGMMMGSLVWGGLADQQGRRQCLLMALTVNSLFSFLSSFVWD-----YGTFIFCRFLDGFGIGGIIPIVYSYYAEFLAHDKRGEHLSWLCMTWMFGGIYASAMAWAIIPHYGWSFGMGSAYQFHSWRVFVIVCALPAVASIVCLTFMPESPRHL-LEMGKHD--------EAWMILKRVHDT--------NMKARGHPEKVFTVTQLKVVKQVDGVT 407          
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Match: CIN10 (Putative transporter; member of the sugar porter family; non-essential gene; overexpression results in elevated colony sectoring, an indicator of chromosomal instability [Source:SGD;Acc:S000002795])

HSP 1 Score: 57.7658 bits (138), Expect = 2.457e-9
Identity = 52/160 (32.50%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYF-EWSPAKYR--IIFIGIAAFTMSFGCFLGTLLGYVIIPRF-----GWRILMVISAVLTVILTVFLIPIPESPRYLILNKGK----SDCLRVM 817
            G   GS+L     D+YGR++ L I   IFI +    A +  + +L    L +GI+ VG+     PL+  E SP++ R  ++ + I A T       G L+ YVI          WR L  +SA+  ++    L  IPESPR+ I +KG      D LR++
Sbjct:   92 GSFFGSILAFPLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIA-VGVSAQCVPLFLSEISPSRIRGFMLTLNIIAITG------GQLVSYVIASLMKEIDNSWRYLFALSAIPAILFLSILDFIPESPRWSI-SKGDILYTRDSLRML 243          
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Match: ITR1 (Myo-inositol transporter; member of the sugar transporter superfamily; expression is repressed by inositol and choline via Opi1p and derepressed via Ino2p and Ino4p; relative distribution to the vacuole increases upon DNA replication stress; ITR1 has a paralog, ITR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002905])

HSP 1 Score: 54.299 bits (129), Expect = 3.115e-8
Identity = 50/177 (28.25%), Postives = 87/177 (49.15%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYF-EWSPA--KYRIIFIGIAAFT----MSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTK 883
            G +I S+  G   D +GRK  L+ SN +F+    +  ++   + + +  L +G  V GI   + PL+  E +P   + R+  I     T    +++GC  G  L YV     GWRIL+ +S + T +    L  +P++PRY ++   K D  R   ++ K +  +T ++I E  V +
Sbjct:  138 GALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGV-GIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGC--GAGLNYV---NNGWRILVGLSLIPTAVQFTCLCFLPDTPRYYVM---KGDLARATEVL-KRSYTDTSEEIIERKVEE 304          
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Match: HXT2 (High-affinity glucose transporter of the major facilitator superfamily; expression is induced by low levels of glucose and repressed by high levels of glucose [Source:SGD;Acc:S000004613])

HSP 1 Score: 51.6026 bits (122), Expect = 2.123e-7
Identity = 44/167 (26.35%), Postives = 73/167 (43.71%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLF--HLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIP---RFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD 859
            G   G L +GR  D YGR++ L+    ++I    +  AS +  W   F   +  G+ V GI +    L  E +P   R   +      ++ G FLG    Y          WR+ + ++    + +   ++ +PESPR+L+      D  R +   AK N+  TI+D
Sbjct:  116 GCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSD-KWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL---AKSNKV-TIED 277          
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Match: HXT17 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by raffinose and galactose at pH 7.7 versus pH 4.7, repressed by high levels of glucose; HXT17 has a paralog, HXT13, that arose from a segmental duplication [Source:SGD;Acc:S000005355])

HSP 1 Score: 50.8322 bits (120), Expect = 3.746e-7
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLF--HLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIP---RFGWRILMVISAVLTVILTVFLIPIPESPRYLI 781
            G  IG L+  R  D  GR+LA++I   +++    +  +S N  W   F   +  G+   G  +    L  E +P   R   + +    M+FG FLG    Y          WR+ + +  + T+I+ + ++ +PESPRYLI
Sbjct:  118 GCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISS-NHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTLIIIIGMLLVPESPRYLI 257          
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Match: ITR2 (Myo-inositol transporter; member of the sugar transporter superfamily; expressed constitutively; ITR2 has a paralog, ITR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005463])

HSP 1 Score: 49.2914 bits (116), Expect = 1.068e-6
Identity = 49/177 (27.68%), Postives = 86/177 (48.59%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYF-EWSPA--KYRIIFIGIAAFT----MSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTK 883
            G +I S+  G   D +GR+  L+ SN +F+    +   +   + +    L +G  V GI   + PL+  E +P   + R+  I     T    +++GC  G  L +V   + GWRIL+ +S + TV+   F   +P++PRY ++   K D L+   +V K +   T  +I +  V +
Sbjct:  161 GALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGV-GIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGC--GAGLNHV---KNGWRILVGLSLIPTVLQFSFFCFLPDTPRYYVM---KGD-LKRAKMVLKRSYVNTEDEIIDQKVEE 327          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO39287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ0])

HSP 1 Score: 147.517 bits (371), Expect = 3.162e-39
Identity = 130/444 (29.28%), Postives = 224/444 (50.45%), Query Frame = 2
Query:  272 GLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYR---IIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIP---IPESPRYLILNKGKSDCLRVMNIVAKWNRAE-TIKDIQ--EPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLT----YYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLN---FLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLH 1555
             ++IT++S L P + C W L+ + + +  T +FI  ++GS  +G   D +GRK  LI+S+    Y+  + A SP+  WL      +G  + G  L    L  E+SP K+R   ++ +G+A    + G F+ +L+G V +P  GWR  +V    +T  L VFLI    IPE   +LI +  K +  +V+  +A+  +AE  I ++Q     V    + DL+ P Y  TT+L+ +      L+    YY +VL+   I      C        +V+   K  T+       ++ N++ ++L +TS E+  +   + +   +GRK  +  +  I  I    L  C     FL  N  LF+IRG+  A   ++I YT+E++PT+ R+ G+G+   +GR+GG +APL++ V+    S+ A   ++ +   +C    + LP ET+ + L 
Sbjct:    4 AMEITMLSILVPYVKCEWDLSIVQVAMITTVVFIMFLVGSPTLGWMGDNFGRKPMLIVSSVAVAYAGLLSAFSPSYPWLLFLRGIVGFGLGGKCLNA-ALLVEYSPIKHRGATVMSLGVA---WAIGSFMTSLVGMVFVPWLGWRSFVV---AITFPLVVFLILSKWIPEFSHFLITSGEKDEARKVLQEMARIQKAELPIGELQGLSHEVALGRVGDLLTPEYRLTTLLLIYFYYFYLLSYRGIYYGLVLLTTQIMTSGSHCP------GSVKFKTKLYTI------LLSTNDFTTLLWTTSAELPAMILTLAMADKVGRKTLLTTYFVIASICYCFLFICAGSRVFLAFN--LFIIRGLLLAGNEVLICYTSEVYPTAFRATGLGLMNGIGRIGGVIAPLISQVLA-DSSMNAAIGVLLLFTALCTVTCYFLPIETRQRELQ 425          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO41352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N1])

HSP 1 Score: 137.887 bits (346), Expect = 2.097e-35
Identity = 112/481 (23.28%), Postives = 222/481 (46.15%), Query Frame = 2
Query:  143 LHSSAK*NIL*EMETIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAET----IKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC--------CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTE-IFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQ 1546
            LH S       ++ ++ + ++ IGFG F   ++++L   +    L++ ++S L P + C ++++A       T +FIG ++GS   G   D +GRK  +++ +    Y   + A SP+ YW+ +  + +G+ + G P +   L  E+ P+KYR + + I +   + G      +  +++P +GWR L+ + ++   +  +    +PES R+ + +  +   L  ++ +A+ N+A      +KD  +    +  I DL+ P    TT+++ F+      TYY +VL+                   T ++ Q ++     C        C  +   +Y  M+ +T  EI  +   I+L+  +GR++T+ +   +     + L  C     +   +F  RG  +     I IYT E + P    + G+G C AV R+G  + P +  V++ + S+     +     L C  ++  LP ETK +
Sbjct:    6 LHFSVSLECGEDVYSVSDAVDHIGFGWFQIKIMLLLGYFSAADALEMMLLSILAPTIRCIFRISAWKEAWITTVVFIGMMVGSSTWGWIADNFGRKFVIVLVSIWIAYFGLLSAFSPHYYWIIVLRMVVGLGIGGAPQSA-TLMSEFLPSKYRAMCMCIQSPWWTLGSLFTICVAMLVMPVYGWRYLLALLSLPMFLFLLLSPFLPESCRFQLASGDRDKALATLHRMARANKATLPTGFLKDANQ-NAKRGRILDLLKPELRRTTLMLWFLWFNVAFTYYGVVLM-------------------TSELFQSDSAGGGKCEVKDPHCGCKLLTTKDYTDMMWTTLAEIPIVLVNIVLLERLGRRRTLALLYGLTATFYMLLFICTKREWMVAFIFGARGCISGVFTAIYIYTPEVVLPYRGATLGLGTCSAVARIGAMITPFICQVLL-RASVDFALGVYAATGLSCVVIALCLPIETKGR 464          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO39285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI8])

HSP 1 Score: 97.8265 bits (242), Expect = 7.997e-22
Identity = 104/491 (21.18%), Postives = 204/491 (41.55%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIG-SLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGIS---VVGIPLAVFPLYFEWSPAK-----------------------YRIIFIGIAAFTM----SFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAE----TIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLH 1555
            + + +  I FG F   L+ ++        L++ ++S L P + C W LN++      T + +  +I  S+  G       R    I+ N +   +  +         ++++H  +G+S   ++G  +    L F W  A+                         ++F G    ++    + G      +   ++P  GWR L+ I  +  ++       +PES R+L+    +   ++V+  + + N+ +     +KD  +    +  + DL   +   TTIL+  I       YY IVL             Q  +         K+++  D  C  + + +Y  M+ +T  E   +   + +I  +GRK T  +   I  +    L  C + L + I +F++RG  + +     +YT E++PT  R+ G+G C  + RVG  + P +A V++ K S+     +   +++IC   S +LP ETK + + 
Sbjct:   14 LSDAVEWIRFGPFQARLIAIVGFFVIADALEMMLLSILAPTIRCTWHLNSLEEAFITTYIPVFVLIMFSVQTGNIQKSRWRPKGTIVLNRMQGNTKSI---------ISIYHFLLGLSLRDILGYSIRCVTLVF-WGEARTVSLYVIFDELSLRDILRCSVRCVTLVFWGTRKVSLYIFWAVGSTFTVAVAMAVMPTLGWRWLLAILCLPLLLFLAMSKWLPESCRFLLAAGEREGAIQVLRDMCEMNKKQMPQGELKDASQNA-KRGRVADLFLKDQWKTTILLWIIWFNLAFAYYGIVLTTT-------ELFQTISTEGKCASSGKHSSKADCGCQLLGVEDYVDMMWTTLAEFPGVIITMFIIDKLGRKYTAALEFVITAVFFFLLIICTDRLTMTIFIFIVRGAISGAFQTFYVYTPEVYPTVTRALGLGCCSGIARVGAMITPFVAQVLL-KESVALSMGVYGGMSVICIIASLMLPIETKGREMQ 485          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO39286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI9])

HSP 1 Score: 74.3294 bits (181), Expect = 2.535e-15
Identity = 59/225 (26.22%), Postives = 107/225 (47.56%), Query Frame = 2
Query:  881 KPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLH 1555
            +  I DL +P Y  TT+L+S       L+YY + L+   +      C     +             ++  C  +   ++ ++L +TS E+  +   I +I  + RK  + I+  I  I    L  C   +   + L++IRGI+ A+  +++ YT E++PT+ R+ G+G     GR+GG + PL++ V+    SL A   ++F    +C    + LP ET+ + L 
Sbjct:    1 RGRIVDLFNPEYRVTTLLLSLTWFSVILSYYGMALLTTQMMTSGSNCPAFVRK-------------EECGCRLLRKRDFITLLWTTSAELPAMILTIFIIDKVRRKSLLTIYFAIASIFFCFLFICTGRIVSTLNLYIIRGITLAASEVLVCYTGEVYPTAFRATGLGYALGAGRIGGLITPLISQVLA-ASSLNAAIGVLFFFTALCTVTCYFLPIETRQRELQ 211          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO42217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S240])

HSP 1 Score: 72.4034 bits (176), Expect = 1.762e-14
Identity = 54/200 (27.00%), Postives = 95/200 (47.50%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWL-TLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDI-------QEPPVTKPNIKDLIHPNYLSTTILVSFIS 949
            G + G+++ G   DKYGR+  L IS+C+  +  F  +  P  YWL  +F  FIG  + G  + +F +  E+   + R +      +  +    L  LL Y I     WRIL + ++   ++L +F   IPES R+L+ ++   +   ++  V K+N+ E   D        Q+    + N  DL     ++   ++S+IS
Sbjct:   26 GWLFGNIVFGILSDKYGRRKVLFISSCMVCWVAFASSFVP-YYWLYAVFRFFIGFGLGGSIVILFIMATEFVGPQKRAMAGTFTWYFWTGALMLIALLAYFIRD---WRILSITTSAPGILLFLFWWLIPESVRWLLTHERSKEAEMILRKVGKFNKHEASPDTHLGLPPGQDHQGRQANFFDLFRTRSMTKKTVISWIS 221          
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 196.052 bits (497), Expect = 7.215e-56
Identity = 135/463 (29.16%), Postives = 240/463 (51.84%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD-IQEPPV-TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 1564
            T+++ +  IGFGRFH  L +++ S   +  ++I +++ + P + C WKL+   + + +T +F+G ++  +L G   D++GR   +        Y + + + +P+  W       +G  V G+    F L  E+ PAKYR + + +A      G  L  +LG +++P  GWR ++ IS   +++L      IPES RY +        L+ +  +A+ NRA   +  + EP V  + + + L+ P++  T++L+ +   V    YY  VL    +      C+ N  R   V+ H+    V   C C+     +Y ++LIS  GE+  +P  I L++  GRK ++ +   +  +  + LN C   L   +LLF++R + + + N++ IYT E++PT  RS GMG C +  R+GG +AP +A V++ K  +LA +    V  +IC   +FLLP ET+ + L Q +
Sbjct:   51 TVEDAVEEIGFGRFHVLLFVIMGSANVVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQG-FVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRAGLPEGRLVEPAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCVTNAEREHQVK-HRHQGGV---CYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVVLALSPFA-VACVICALGNFLLPIETRGRALLQNS 507          
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 192.586 bits (488), Expect = 1.496e-54
Identity = 133/457 (29.10%), Postives = 236/457 (51.64%), Query Frame = 2
Query:  185 TIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD-IQEPPV-TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC-CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQ 1546
            T+++ +  IGFGRFH  L +++ S   +  ++I +++ + P + C WKL+   + + +T +F+G ++  +L G   D++GR   +        Y + + + +P+  W       +G  V G+    F L  E+ PAKYR + + +A      G  L  +LG +++P  GWR ++ IS   +++L      IPES RY +        L+ +  +A+ NRA   +  + EP V  + + + L+ P++  T++L+ +   V    YY  VL    +      C+ N  R   V+ H+    V   C C+     +Y ++LIS  GE+  +P  I L++  GRK ++ +   +  +  + LN C   L   +LLF++R + + + N++ IYT E++PT  RS GMG C +  R+GG +AP +A V++ K  +LA +    V  +IC   +FLLP ET+  
Sbjct:   54 TVEDAVEEIGFGRFHVLLFVIMGSANVVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQG-FVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRAGLPEGRLVEPAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCVTNAEREHQVK-HRHQGGV---CYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVVLALSPFA-VACVICALGNFLLPIETRGH 504          
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Match: svopb (synaptic vesicle 2-related protein [Source:NCBI gene;Acc:101161175])

HSP 1 Score: 177.563 bits (449), Expect = 9.593e-49
Identity = 126/464 (27.16%), Postives = 222/464 (47.84%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQE--PPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSC---CMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 1564
            +D+ L  IGFG F + + ++         +++ I+S LGP L C W L +  + +  + +FIG   GS + G   DKYGRK+ L +  C  +Y   + A +P   WL +   F+G  + G P +V  LY E+ P K R I I +     + G     LL   ++P  GWR L+ +SA+   +   F   +PESPR+ +L   +   +  +  +AK N     +          +  +KDL  P Y  TT+L+ F+   N  +YY IVL+   +      C +            +   ++  C   C  ++ ++Y  +L +T  E   +   ++ I ++GRKK++ +  F+  + I+ L  C+  + L I +F+ R   +    ++ +YT E++PT  R+  MG   A+ R+G  + P +A V++ + S+     +     L+    S LLP ET  + L +++
Sbjct:   73 VDDALEAIGFGVFQWKISLITGLAWVADAMEMMILSILGPELHCDWSLPSYQVALITSVVFIGMGFGSPVWGNVSDKYGRKVGLTVCMCWTLYYGILSAFAPIYGWLLVLRGFVGFGIGGAPQSV-TLYTEFLPVKARGICIVLIGAFWAIGAVFEVLLALWVMPTLGWRWLLGLSALPMAVFVCFCFWLPESPRFDVLAGRREKAMATLVRIAKDNGKAMPQGTLTIYKQTNRGQLKDLFSPQYWKTTLLLWFLWFANAFSYYGIVLLTTELFQAGDLCAET-----------QGAKIEPRCSLECKYLSSDDYKDLLWTTLAEFPGLLVILLAIDYMGRKKSMALCFFMFSLCILPLFACIGRIALTIFIFICRAFISGGYQVVFVYTPEVYPTETRALAMGTSSAIARIGALITPFVAQVLL-RRSVYVTLGVYCACGLVAGIASLLLPIETLGRGLQESS 523          
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:101156331])

HSP 1 Score: 159.073 bits (401), Expect = 3.423e-42
Identity = 121/467 (25.91%), Postives = 216/467 (46.25%), Query Frame = 2
Query:  188 IDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEER 1573
            +++ +  IGFG F + L I+   +     +++ I+S L P L C W+L ++ + +  + +FIG +I S L G   DKYGRK  L +S    ++   + A +P   W+ +    +G  + G P +V  LY E+ P + R   I +     + G     LL  +++P  GWR L+ +S +   I  +    +PES RY +L   +   L  +  +A  N       + I   QE    +  IKDL   ++  TT+L+ FI   N  +YY +VL+   +      C +N           K     +  C  +  ++Y  +L +T  E   +   +  I  +GR++T+ +   I  + +I L  C+  + + +L+F+ R           +YT E++PT+ R+ G+G    + RVG  + P +A V++ +YS+     +     L+    S  LP ET  + L + +   
Sbjct:   68 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSLEVALLTSAVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTMFYGILSAFAPIYGWILVLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLGLSTIPLFIFAILCFWLPESARYDVLTGNQDKALATLKRIATENGVPMPLGKLIAARQE---DRGKIKDLFSSHFRCTTVLLWFIWFANAFSYYGLVLLTTELFQEGGACGRN-----------KQELRCNLECKYLTSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRRTMALCFLIFSLALIPLYGCVGRVSMMVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-EYSVYLALSVYCCCCLLAAVASCALPIETTGRGLQEASHRE 518          
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Match: slc22a2 (solute carrier family 22 member 2 [Source:NCBI gene;Acc:101173762])

HSP 1 Score: 79.7221 bits (195), Expect = 1.943e-15
Identity = 92/360 (25.56%), Postives = 156/360 (43.33%), Query Frame = 2
Query:  374 GKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRIL-MVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNI---NNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLN--FLQLNILLFVIR-GISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLL 1432
            G ++GS+ IG   D++GRK++ ++S  +   +  + A SPN   L +F    G  V G  +A + L  E    ++R     +     S G  +  LL + I     WR L + I+A   + L+ +   IPESPR+L+    KS  +++   +AK NR           V   NI+ L   +  S +   SF+ L+                   H  + ++N F++  ++Q          M++ I   N Y   LIS   E       +  I  IGR+        +     +   F  +  FL   ++  + R GI+ A   +++   TE++PT VR+ G+ +C  +  VGG +AP L
Sbjct:  155 GFLVGSIAIGYLADRFGRKMSFLMSTLVNAVAGILVAVSPNYTSLLVFRSLSGFGVKGGWMAGYVLITEIVGVEFRRTVGVLYQMFFSVGLLILPLLAFFIT---DWRWLQLAITAPYILFLSYYWF-IPESPRWLLSQNKKSQVVKITESIAKENRR----------VLSKNIETLTDDDADSNS--ASFMDLIR------------TPNMRKHTLILSYNWFTSAVVYQ-------GLIMRLGILGGNVYVDFLISGLVEFPAAFLILFTIERIGRRLPFASANMVAGASCLITAFLPDDLFLLKTVVACIGRLGITMA-FEMVVFVNTELYPTFVRNLGVSVCSTLCDVGGIVAPFL 478          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000000110.1 (SMESG000000110.1)

HSP 1 Score: 804.668 bits (2077), Expect = 0.000e+0
Identity = 454/469 (96.80%), Postives = 460/469 (98.08%), Query Frame = 2
Query:  179 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNKFE 1585
            METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSC+WKLNAINIFIFNTTMFIGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGK DCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTS EIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISN + NLI+IY  EI+PTSVRSFGMGIC AVGRVGGALAPLLANV+IFKYS L GTMIIFVLNLICFCV+FLLPYETKDQNLHQTAEERNKFE
Sbjct:    1 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCYWKLNAINIFIFNTTMFIGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKFDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSAEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISNLNFNLIMIYAPEIYPTSVRSFGMGICSAVGRVGGALAPLLANVVIFKYSFLVGTMIIFVLNLICFCVTFLLPYETKDQNLHQTAEERNKFE 469          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000011499.1 (SMESG000011499.1)

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 438/469 (93.39%), Postives = 446/469 (95.10%), Query Frame = 2
Query:  179 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNKFE 1585
            METIDNCLNRIGFGRFHFYLLIVLS NAGIFGLQI IMSFLGPVLSCFWKLNAINIFIFNT +FI     SLLIGRF DKYGR  ALI  NC+ IYSNF+ A SPNIYWLTLF  F+GIS+ GI L +FPL+FEWSPAKYRI FIGIAA T+SFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNKFE
Sbjct:    1 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLNAINIFIFNTIIFISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNKFE 468          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000000287.1 (SMESG000000287.1)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 429/469 (91.47%), Postives = 450/469 (95.95%), Query Frame = 2
Query:  179 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNKFE 1585
            MET+D+ L++IGFGRFHFYLL+ L+S+ GIFGLQITIMSFLGPVLSC+WKLNAINI IFNTTMFIGKIIGSLLIGRF DKYGRKLALIISNCIFIYSNFVCAAS NIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIA+   SFGCFLGTLLGYVIIPRFGWRILMVISA+LTVILTVFLIPIPESPRYL+LNKGKSDCLRVMNIVAKWNRAETIKDIQEPP+TKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWN+FSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTS EIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGIS+ + NLI+IY  EI+PTSVRSFGMGIC AVGRVGGALAPLLANV+IFK+S L GTMIIFVLNLICFCV+FLLPYET+DQNLHQTAEERN  E
Sbjct:    1 METLDSSLDKIGFGRFHFYLLLSLASDGGIFGLQITIMSFLGPVLSCYWKLNAINILIFNTTMFIGKIIGSLLIGRFSDKYGRKLALIISNCIFIYSNFVCAASSNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIASLFASFGCFLGTLLGYVIIPRFGWRILMVISAILTVILTVFLIPIPESPRYLLLNKGKSDCLRVMNIVAKWNRAETIKDIQEPPITKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNQFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSAEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISSLNYNLIMIYAPEIYPTSVRSFGMGICNAVGRVGGALAPLLANVVIFKFSFLVGTMIIFVLNLICFCVTFLLPYETRDQNLHQTAEERNTLE 469          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000000077.1 (SMESG000000077.1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 309/464 (66.59%), Postives = 380/464 (81.90%), Query Frame = 2
Query:  179 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEE 1570
            M++IDN LN+IGFGRFHFY ++V++  +GIF  Q+  ++ LGP LSC+WK+NA  +F FNT +F G IIGSL +G+F DKYGRK  LI+SNC+F Y  F+ A S +IYWLT+F   IGI  VGIP+     +FEW P KYRI++I +    + FGC + TLLGYVIIPRFGWR+ ++I+A+L + L +FLIP+PES RYL+LNKGKSDCLRV+NIVAKWNRAETIKDIQEPPVTK NIKDL+HPNYL TTILVSFISLVNY TY+ I+L+IPIIANIPHRCLQNWNRFSTVQ HQ +  +DDSCCM++++ NY +MLIS S E+IFIPFYIILISFIGRKKTI IFLF+I  GI  LNFCLN LQLNILLF+IRGIS+ +INLII+Y +EIFPTSVR FGMGIC A GR+G A++P + N++I+KYS+L G+MII  +N  CFCVSFLLPYET+D+NL +TA+ 
Sbjct:    1 MDSIDNALNKIGFGRFHFYFVVVMACQSGIFDFQLVTITLLGPALSCYWKINATEVFTFNTIIFSGMIIGSLTLGKFSDKYGRKTVLILSNCLFSYCIFLSAISQDIYWLTVFQFIIGIFSVGIPITTSAFFFEWCPMKYRIVYIAVNTTIIGFGCQIETLLGYVIIPRFGWRVFILITAILIIFLALFLIPVPESARYLMLNKGKSDCLRVINIVAKWNRAETIKDIQEPPVTKSNIKDLMHPNYLLTTILVSFISLVNYFTYFCIILVIPIIANIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 464          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069049.1 (SMESG000069049.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 296/467 (63.38%), Postives = 366/467 (78.37%), Query Frame = 2
Query:  179 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWKLNAXXXXXXXXXXXXGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTXXXXXXXXXXXPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEXXXXXXXXXXXXXXGRKKTXXXXXXXXXXXXXSLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNK 1579
            M TI+  LN+IGFG+FH  L+ +L+ ++GIFG QI+ ++ LGPVLSC+WKLN   +FIFNT MF G I GSL +G+  DK+GRK  LI+SNC+ IY + +   SPNIYWL +F   IG+ +VGIP+ +FP +FEWSP KYR++FIGI+      G  +G LLGY IIPRFGWRI ++   +LT+ L+VF+  IPESPRYL+LNKG+ DCLR MNIVAKWNRAE+IKDI EPPVTK NIKDLIHPNY STT+ +SFISL  YL YY+IVL IPIIAN+PHRCLQNW++FS VQ  + N  VDDSCCMK++I NY +MLISTS EII +P Y+ LI+ IGRKKT+ + +FIIMIG+  LN CLN LQLNILLF+IRGISN + NLI IY +EIFPTSVRS GMGI    GR+GG L+PL+A +IIFKYS L GTMI+F  + +CFC+SFLLPYET +Q+L QTA +RNK
Sbjct:    1 MNTIETALNQIGFGKFHITLIAILAGHSGIFGFQISCVTLLGPVLSCYWKLNVKEVFIFNTVMFTGMIFGSLFLGKLSDKFGRKPVLIMSNCVCIYCSLMAIISPNIYWLAIFQFMIGVFIVGIPITIFPFFFEWSPIKYRVVFIGISMCAFGIGGLIGNLLGYAIIPRFGWRIFILACPLLTIFLSVFIFQIPESPRYLLLNKGRFDCLRAMNIVAKWNRAESIKDIYEPPVTKSNIKDLIHPNYFSTTLFISFISLAVYLIYYSIVLAIPIIANVPHRCLQNWSQFSNVQNLKNNRIVDDSCCMKLDIENYKNMLISTSAEIISVPLYLFLITVIGRKKTLSVLIFIIMIGVSLLNLCLNLLQLNILLFIIRGISNLNFNLITIYASEIFPTSVRSSGMGITSGCGRIGGVLSPLIATIIIFKYSFLMGTMILFGFSFVCFCMSFLLPYETVNQDLQQTAADRNK 467          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOPL9.449e-4928.70SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOP4.342e-4526.75SV2 related protein [Source:HGNC Symbol;Acc:HGNC:2... [more]
SVOPL7.151e-3029.48SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL7.151e-3029.48SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL6.255e-2829.90SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svop-12.826e-4626.08Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
svop-12.826e-4626.08Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
hmit-1.13.993e-1227.54H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.21.650e-1025.89H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
oct-14.164e-722.60Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43242.469e-3424.23gene:FBgn0034956 transcript:FBtr0343347[more]
CG43242.469e-3424.23gene:FBgn0034956 transcript:FBtr0072197[more]
CG31689.127e-1325.12gene:FBgn0029896 transcript:FBtr0340268[more]
CG31689.127e-1325.12gene:FBgn0029896 transcript:FBtr0340266[more]
CG31689.127e-1325.12gene:FBgn0029896 transcript:FBtr0340267[more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl1.547e-4929.22SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl1.547e-4929.22SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl3.014e-4929.13SVOP-like [Source:NCBI gene;Acc:492766][more]
svopa1.321e-4125.84SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
svopa1.817e-4125.84SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOP9.861e-4626.38SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP2.815e-4526.38SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP7.343e-4526.17SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP2.203e-4325.91SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP1.780e-3626.02SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svopl7.807e-4728.57SV2 related protein homolog (rat)-like [Source:MGI... [more]
Svop1.615e-4227.18SV2 related protein [Source:MGI Symbol;Acc:MGI:191... [more]
Slc22a72.020e-1822.97solute carrier family 22 (organic anion transporte... [more]
Slc22a74.345e-1822.93solute carrier family 22 (organic anion transporte... [more]
Slc22a191.301e-1225.76solute carrier family 22 (organic anion transporte... [more]
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1LVS8|SVOPL_DANRE1.168e-4829.22Putative transporter SVOPL OS=Danio rerio OX=7955 ... [more]
sp|Q8N434|SVOPL_HUMAN4.538e-4828.70Putative transporter SVOPL OS=Homo sapiens OX=9606... [more]
sp|Q6PDF3|SVOPL_MOUSE5.461e-4628.57Putative transporter SVOPL OS=Mus musculus OX=1009... [more]
sp|Q2XWK0|SVOP_XENLA1.827e-4526.60Synaptic vesicle 2-related protein OS=Xenopus laev... [more]
sp|P30638|SVOP_CAEEL3.595e-4526.08Putative transporter svop-1 OS=Caenorhabditis eleg... [more]
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A177BET02.348e-5430.54Putative transporter SVOPL OS=Intoshia linei OX=18... [more]
A0A1S3N0134.859e-5329.15putative transporter SVOPL OS=Salmo salar OX=8030 ... [more]
A0A1I8G7A75.349e-5328.94MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A0F8AIU47.520e-5329.65Putative transporter SVOPL OS=Larimichthys crocea ... [more]
I3JL101.187e-5228.54SVOP-like OS=Oreochromis niloticus OX=8128 PE=4 SV... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa4.536e-4426.05SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopa4.583e-4326.00SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopl1.474e-3727.57SVOP-like [Source:NCBI gene;Acc:492766][more]
SLC22A21.267e-1425.74solute carrier family 22 member 2-like [Source:NCB... [more]
si:dkey-190l8.22.492e-1226.76solute carrier family 22 member 13-like [Source:NC... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl2.320e-5127.65SVOP-like [Source:NCBI gene;Acc:492766][more]
SLC22A77.041e-1229.68solute carrier family 22 member 7 [Source:HGNC Sym... [more]
oct26.215e-925.67organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
slc22a6l1.162e-839.13solute carrier family 22 member 6, like [Source:NC... [more]
ENSPMAT00000001436.16.631e-822.86pep scaffold:Pmarinus_7.0:GL476665:296817:321845:1... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CIN102.457e-932.50Putative transporter; member of the sugar porter f... [more]
ITR13.115e-828.25Myo-inositol transporter; member of the sugar tran... [more]
HXT22.123e-726.35High-affinity glucose transporter of the major fac... [more]
HXT173.746e-728.37Putative transmembrane polyol transporter; support... [more]
ITR21.068e-627.68Myo-inositol transporter; member of the sugar tran... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392873.162e-3929.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413522.097e-3523.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392857.997e-2221.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392862.535e-1526.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422171.762e-1427.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl7.215e-5629.16SVOP like [Source:NCBI gene;Acc:101157836][more]
svopl1.496e-5429.10SVOP like [Source:NCBI gene;Acc:101157836][more]
svopb9.593e-4927.16synaptic vesicle 2-related protein [Source:NCBI ge... [more]
svopa3.423e-4225.91SV2 related protein [Source:NCBI gene;Acc:10115633... [more]
slc22a21.943e-1525.56solute carrier family 22 member 2 [Source:NCBI gen... [more]
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000110.10.000e+096.80SMESG000000110.1[more]
SMESG000011499.10.000e+093.39SMESG000011499.1[more]
SMESG000000287.10.000e+091.47SMESG000000287.1[more]
SMESG000000077.10.000e+066.59SMESG000000077.1[more]
SMESG000069049.10.000e+063.38SMESG000069049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027539 ID=SMED30027539|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1589bp
TCATTGATAAAATTACATATTGACACGAATTTGACAAGTGCGTCACTTAT
TTTCTGTCATTTACTGATAATTTCTCATCAGTTGATACGACGATTTTTAG
CACGTATATTTGCAGCATTGAATGCGTTGTTTGCGGAGTGCATTGCATTC
CTCCGCAAAATAAAACATTTTATGAGAAATGGAAACAATTGACAATTGCT
TAAATCGAATCGGATTTGGAAGATTTCATTTCTATTTGCTTATAGTTTTA
TCAAGCAATGCTGGGATTTTTGGATTGCAAATTACTATTATGTCTTTTCT
GGGGCCGGTCCTCAGTTGCTTTTGGAAACTGAATGCCATAAATATATTTA
TTTTCAACACAACAATGTTTATTGGAAAGATTATTGGAAGCTTATTAATT
GGAAGATTCTGTGATAAATATGGCAGAAAATTGGCATTGATCATATCGAA
CTGTATATTTATTTATTCCAATTTCGTATGTGCGGCCTCACCGAATATTT
ATTGGTTGACGCTCTTTCATCTGTTTATTGGTATTTCTGTTGTTGGCATC
CCATTGGCGGTCTTCCCATTATATTTTGAATGGTCTCCAGCAAAATATAG
AATTATTTTTATTGGAATAGCTGCTTTTACTATGAGTTTTGGATGCTTTT
TAGGAACTCTTCTTGGATATGTAATTATTCCAAGATTCGGATGGAGGATT
CTCATGGTGATATCTGCAGTTTTAACAGTCATTCTAACAGTATTTCTAAT
TCCAATTCCAGAGTCACCGAGATATTTGATATTAAATAAAGGCAAATCCG
ATTGTTTGAGAGTAATGAACATCGTTGCTAAATGGAACCGAGCCGAAACG
ATTAAAGATATTCAAGAACCGCCAGTCACCAAACCCAATATCAAAGATTT
GATACATCCGAATTATTTATCAACAACAATTCTTGTTTCATTCATTTCAT
TGGTCAATTATTTAACATATTACACTATCGTTCTGATAATTCCGATAATT
GCCAATATTCCTCACAGATGTCTGCAGAATTGGAATCGATTCTCCACCGT
CCAAATCCATCAGAAAAACAATACTGTTGATGATTCTTGCTGCATGAAAA
TGAATATCAATAATTACAACAGCATGCTCATATCGACATCCGGGGAAATC
ATTTTCATTCCATTTTATATAATTCTCATCAGTTTCATTGGACGAAAGAA
AACTATTCCGATATTTTTATTTATAATCATGATTGGGATAATTTCATTGA
ATTTTTGTCTCAATTTCTTGCAATTAAACATTTTATTATTTGTTATCAGA
GGAATATCAAATGCAAGTATTAATTTAATTATAATTTATACGACAGAAAT
ATTTCCAACGTCAGTTCGAAGTTTTGGAATGGGAATTTGTGGAGCCGTTG
GAAGAGTTGGCGGCGCTTTAGCTCCACTTCTAGCAAATGTGATCATTTTC
AAGTATTCTCTCCTAGCCGGAACAATGATTATATTTGTTCTCAATCTTAT
ATGCTTTTGTGTGAGTTTTCTTTTGCCATATGAGACCAAAGATCAGAATC
TACACCAAACAGCTGAAGAGAGAAATAAATTTGAATAAA
back to top

protein sequence of SMED30027539-orf-1

>SMED30027539-orf-1 ID=SMED30027539-orf-1|Name=SMED30027539-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MFITLKQSDLPLFNIKYLGDSGIGIRNTVRMTVKTADITMRILHPNLGII
TYPRRVPKKHPKLIVKAAIPIKIILYFAGDHSKYNGKTANGMPTTEIPIN
R*
back to top

protein sequence of SMED30027539-orf-2

>SMED30027539-orf-2 ID=SMED30027539-orf-2|Name=SMED30027539-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=470bp
METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCFWK
LNAINIFIFNTTMFIGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFV
CAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAF
TMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYL
ILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTT
ILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTV
DDSCCMKMNINNYNSMLISTSGEIIFIPFYIILISFIGRKKTIPIFLFII
MIGIISLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFG
MGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLP
YETKDQNLHQTAEERNKFE*
back to top
Aliases
The feature 'MFS domain-containing protein' has the following synonyms
Synonym
SV2-RP
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 14..466
e-value: 7.8E-63
score: 214.8
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 5..459
NoneNo IPR availablePANTHERPTHR24064:SF457TRANSPORTER SVOPL-RELATEDcoord: 5..459
NoneNo IPR availableCDDcd17372MFS_SVOP_likecoord: 33..444
e-value: 7.60278E-47
score: 164.245
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 427..449
NoneNo IPR availableTMHMMTMhelixcoord: 315..337
NoneNo IPR availableTMHMMTMhelixcoord: 255..277
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
NoneNo IPR availableTMHMMTMhelixcoord: 16..38
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
NoneNo IPR availableTMHMMTMhelixcoord: 171..193
NoneNo IPR availableTMHMMTMhelixcoord: 342..364
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 56..207
e-value: 2.5E-24
score: 86.0
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 322..460
e-value: 3.9E-13
score: 49.1
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 20..454
score: 35.793
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 7..463