ATP-dependent RNA helicase FAL1

Overview
NameATP-dependent RNA helicase FAL1
Smed IDSMED30027527
Length (bp)1263
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase FAL1 (SMED30027527) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase FAL1 (SMED30027527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase FAL1 (SMED30027527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase FAL1 (SMED30027527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30027527SMESG000030445.1 SmedASXL_012828SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 400.208 bits (1027), Expect = 4.612e-137
Identity = 202/392 (51.53%), Postives = 271/392 (69.13%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF I +LQ LD     ++ ETQAL+LAPTRELA QI     +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDI----QVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 400.208 bits (1027), Expect = 4.612e-137
Identity = 202/392 (51.53%), Postives = 271/392 (69.13%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF I +LQ LD     ++ ETQAL+LAPTRELA QI     +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDI----QVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 366.311 bits (939), Expect = 3.528e-124
Identity = 189/392 (48.21%), Postives = 256/392 (65.31%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF I +LQ LD          Q L+                +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDI---------QGLL----------------ALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 390          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 354.755 bits (909), Expect = 2.240e-119
Identity = 194/391 (49.62%), Postives = 263/391 (67.26%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            F  M LK  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ L+     E  ETQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+   +L  + + M ++DEADEM+++G   Q+  I++++  +IQV+++SAT+P   L++T+KF  D ++ILVK E L+++ +KQFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ VT ++   L+ +  F  TT++  P N+    +DLI
Sbjct:   36 FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEI----EFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNV----ADLI 408          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 354.369 bits (908), Expect = 3.137e-119
Identity = 194/391 (49.62%), Postives = 263/391 (67.26%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            F  M LK  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ L+     E  ETQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+   +L  + + M ++DEADEM+++G   Q+  I++++  +IQV+++SAT+P   L++T+KF  D ++ILVK E L+++ +KQFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ VT ++   L+ +  F  TT++  P N+    +DLI
Sbjct:   35 FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEI----EFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNV----ADLI 407          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Celegans
Match: Y65B4A.6 (pep chromosome:WBcel235:I:629492:636350:-1 gene:WBGene00022029.1 transcript:Y65B4A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y65B4A.6)

HSP 1 Score: 397.512 bits (1020), Expect = 1.097e-136
Identity = 197/384 (51.30%), Postives = 270/384 (70.31%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            TF  MGL+ +LL+GI  +GF  PS IQQ+AI  I+   DV+ QAQSG+GKTATF I +LQSLD    +++ ETQAL+L+PTRELA QI  V  +L D+MNV+  ACIGGT    +G   +KL  GQHVV GTPGR+ DMI+  +L+T  + +L++DEADEM+ +G  +QL  IYR +    QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q ++F NTR KV WLTDKM+   FTVS +HG +EQ +R+++M +FR+   RVLI TDVWARG+DV  V+LVINYD+P   NNR     E Y+HRIGRSGR+ RKGVA++ V + ++  L+ + ++  T I   P N+
Sbjct:   27 TFDKMGLREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGKTATFSISVLQSLD----TQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTN---LGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLP---NNR-----ELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNI 395          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Celegans
Match: F33D11.10 (pep chromosome:WBcel235:I:5866514:5868139:-1 gene:WBGene00018007.1 transcript:F33D11.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F33D11.10)

HSP 1 Score: 396.741 bits (1018), Expect = 2.649e-136
Identity = 196/384 (51.04%), Postives = 270/384 (70.31%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            TF  MGL+ +LL+GI  +GF  PS IQQ+A+  I+   DV+ QAQSG+GKTATF I +LQSLD    +++ ETQAL+L+PTRELA QI  V  +L D+MNV+  ACIGGT    +G   +KL  GQHVV GTPGR+ DMI+  +L+T  + +L++DEADEM+ +G  +QL  IYR +    QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q ++F NTR KV WLTDKM+   FTVS +HG +EQ +R+++M +FR+   RVLI TDVWARG+DV  V+LVINYD+P   NNR     E Y+HRIGRSGR+ RKGVA++ V + ++  L+ + ++  T I   P N+
Sbjct:   27 TFDKMGLREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGKTATFSISVLQSLD----TQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTN---LGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLP---NNR-----ELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNI 395          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 376.711 bits (966), Expect = 1.660e-128
Identity = 189/392 (48.21%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M LK ELL+GI   GF  PS IQ++AI+P   G DV+ QAQSG+GKTATF + ILQ +D     E P  QALV+APTRELAQQI  V  +L +++NV    CIGGT+ ++     +KL+ G HVVVGTPGR+ DMI    L T  + M ++DEADEM+++G   Q+  ++R + Q +QV+++SAT+P   LD+T +F  + ++ILVK + L+++ ++QFYINV ++E KF  L D+Y    + Q +IF NTR KV  LT+KM  + FTVSC+HG ++QAER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGRSGR+ RKGVA++ VT  +   LK +  +  T I+  P+++    +DLI
Sbjct:   30 SFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRID----HEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDD---QRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNREN--------YIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESI----ADLI 402          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 376.711 bits (966), Expect = 1.660e-128
Identity = 189/392 (48.21%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M LK ELL+GI   GF  PS IQ++AI+P   G DV+ QAQSG+GKTATF + ILQ +D     E P  QALV+APTRELAQQI  V  +L +++NV    CIGGT+ ++     +KL+ G HVVVGTPGR+ DMI    L T  + M ++DEADEM+++G   Q+  ++R + Q +QV+++SAT+P   LD+T +F  + ++ILVK + L+++ ++QFYINV ++E KF  L D+Y    + Q +IF NTR KV  LT+KM  + FTVSC+HG ++QAER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGRSGR+ RKGVA++ VT  +   LK +  +  T I+  P+++    +DLI
Sbjct:   30 SFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRID----HEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDD---QRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNREN--------YIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESI----ADLI 402          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 376.711 bits (966), Expect = 1.660e-128
Identity = 189/392 (48.21%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M LK ELL+GI   GF  PS IQ++AI+P   G DV+ QAQSG+GKTATF + ILQ +D     E P  QALV+APTRELAQQI  V  +L +++NV    CIGGT+ ++     +KL+ G HVVVGTPGR+ DMI    L T  + M ++DEADEM+++G   Q+  ++R + Q +QV+++SAT+P   LD+T +F  + ++ILVK + L+++ ++QFYINV ++E KF  L D+Y    + Q +IF NTR KV  LT+KM  + FTVSC+HG ++QAER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGRSGR+ RKGVA++ VT  +   LK +  +  T I+  P+++    +DLI
Sbjct:   30 SFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRID----HEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDD---QRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNREN--------YIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESI----ADLI 402          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Fly
Match: CG7483 (gene:FBgn0037573 transcript:FBtr0081834)

HSP 1 Score: 398.282 bits (1022), Expect = 7.238e-137
Identity = 203/392 (51.79%), Postives = 271/392 (69.13%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +M LK ELL+GI  +GF  PS IQQ++I PIV G DV+ QAQSG+GKTATF I ILQSLD    + + ETQ L L+PTRELA QI  V  +L D MNV+   CIGGT    +G   +KL  GQH+V GTPGR+ DMIK   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ER+++M +FR+ ++RVLI TDVWARGIDV  V+LVINYD+P   NNR     E Y+HRIGRSGR+ RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   27 TFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLD----TTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTN---LGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLP---NNR-----ELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNV----ADLI 399          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079178)

HSP 1 Score: 347.821 bits (891), Expect = 5.022e-117
Identity = 194/394 (49.24%), Postives = 263/394 (66.75%), Query Frame = 3
Query:   60 YATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            Y  F  M L+ ELL+GI  +GF  PS IQQ+AI+P V G DV+ QAQSG+GKTATF I ILQ +D S    I E QAL+LAPTRELA QI  V  +L ++M V   ACIGGT  +E     + L+ G HVVVGTPGR+ DMI    L+T+++ + ++DEADEM+++G   Q++ +++ +   +QVI++SAT+P   L+++  F  D V ILVK E L+++ +KQFY+NV QE  K  TL D+Y   +I Q++IF NTR KV  LT +M    FTVS +HG +EQ +RE +M QFRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ +T  +   LK + +F  TTI+  P N+    +DLI
Sbjct:   29 YDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTS----IRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDA---RILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNREN--------YIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANI----ADLI 403          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079175)

HSP 1 Score: 347.821 bits (891), Expect = 5.022e-117
Identity = 194/394 (49.24%), Postives = 263/394 (66.75%), Query Frame = 3
Query:   60 YATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            Y  F  M L+ ELL+GI  +GF  PS IQQ+AI+P V G DV+ QAQSG+GKTATF I ILQ +D S    I E QAL+LAPTRELA QI  V  +L ++M V   ACIGGT  +E     + L+ G HVVVGTPGR+ DMI    L+T+++ + ++DEADEM+++G   Q++ +++ +   +QVI++SAT+P   L+++  F  D V ILVK E L+++ +KQFY+NV QE  K  TL D+Y   +I Q++IF NTR KV  LT +M    FTVS +HG +EQ +RE +M QFRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ +T  +   LK + +F  TTI+  P N+    +DLI
Sbjct:   29 YDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTS----IRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDA---RILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNREN--------YIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANI----ADLI 403          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079177)

HSP 1 Score: 347.821 bits (891), Expect = 5.022e-117
Identity = 194/394 (49.24%), Postives = 263/394 (66.75%), Query Frame = 3
Query:   60 YATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            Y  F  M L+ ELL+GI  +GF  PS IQQ+AI+P V G DV+ QAQSG+GKTATF I ILQ +D S    I E QAL+LAPTRELA QI  V  +L ++M V   ACIGGT  +E     + L+ G HVVVGTPGR+ DMI    L+T+++ + ++DEADEM+++G   Q++ +++ +   +QVI++SAT+P   L+++  F  D V ILVK E L+++ +KQFY+NV QE  K  TL D+Y   +I Q++IF NTR KV  LT +M    FTVS +HG +EQ +RE +M QFRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ +T  +   LK + +F  TTI+  P N+    +DLI
Sbjct:   29 YDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTS----IRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDA---RILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNREN--------YIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANI----ADLI 403          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0307068)

HSP 1 Score: 347.821 bits (891), Expect = 5.022e-117
Identity = 194/394 (49.24%), Postives = 263/394 (66.75%), Query Frame = 3
Query:   60 YATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            Y  F  M L+ ELL+GI  +GF  PS IQQ+AI+P V G DV+ QAQSG+GKTATF I ILQ +D S    I E QAL+LAPTRELA QI  V  +L ++M V   ACIGGT  +E     + L+ G HVVVGTPGR+ DMI    L+T+++ + ++DEADEM+++G   Q++ +++ +   +QVI++SAT+P   L+++  F  D V ILVK E L+++ +KQFY+NV QE  K  TL D+Y   +I Q++IF NTR KV  LT +M    FTVS +HG +EQ +RE +M QFRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ +T  +   LK + +F  TTI+  P N+    +DLI
Sbjct:   29 YDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTS----IRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDA---RILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNREN--------YIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANI----ADLI 403          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Zebrafish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:394053])

HSP 1 Score: 404.06 bits (1037), Expect = 7.766e-139
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   34 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 354.369 bits (908), Expect = 2.733e-119
Identity = 191/392 (48.72%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ +D     E+  TQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+    L ++++ M ++DEADEM+++G   Q+  I+++++ +IQV+++SAT+P   LD+T KF  + V+ILVK E L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q +R+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   39 SFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDI----ELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 412          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 353.599 bits (906), Expect = 4.864e-119
Identity = 191/392 (48.72%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ +D     E+  TQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+    L ++++ M ++DEADEM+++G   Q+  I+++++ +IQV+++SAT+P   LD+T KF  + V+ILVK E L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q +R+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   33 SFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDI----ELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 353.599 bits (906), Expect = 4.864e-119
Identity = 191/392 (48.72%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ +D     E+  TQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+    L ++++ M ++DEADEM+++G   Q+  I+++++ +IQV+++SAT+P   LD+T KF  + V+ILVK E L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q +R+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   33 SFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDI----ELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 353.214 bits (905), Expect = 7.037e-119
Identity = 191/392 (48.72%), Postives = 265/392 (67.60%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ +D     E+  TQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+    L ++++ M ++DEADEM+++G   Q+  I+++++ +IQV+++SAT+P   LD+T KF  + V+ILVK E L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q +R+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   34 SFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDI----ELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 407          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Xenopus
Match: eif4a3.1 (eukaryotic translation initiation factor 4A3, gene 1 [Source:NCBI gene;Acc:100135173])

HSP 1 Score: 404.831 bits (1039), Expect = 6.818e-139
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   40 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 412          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Xenopus
Match: eif4a3.1 (eukaryotic translation initiation factor 4A3, gene 1 [Source:NCBI gene;Acc:100135173])

HSP 1 Score: 404.06 bits (1037), Expect = 7.050e-139
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   30 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 402          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Xenopus
Match: eif4a3.1 (eukaryotic translation initiation factor 4A3, gene 1 [Source:NCBI gene;Acc:100135173])

HSP 1 Score: 404.445 bits (1038), Expect = 8.173e-139
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   36 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 408          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Xenopus
Match: eif4a3.1 (eukaryotic translation initiation factor 4A3, gene 1 [Source:NCBI gene;Acc:100135173])

HSP 1 Score: 404.06 bits (1037), Expect = 1.023e-138
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   32 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 404          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Xenopus
Match: eif4a3.1 (eukaryotic translation initiation factor 4A3, gene 1 [Source:NCBI gene;Acc:100135173])

HSP 1 Score: 404.445 bits (1038), Expect = 1.057e-138
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   43 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 415          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Mouse
Match: Eif4a3 (eukaryotic translation initiation factor 4A3 [Source:MGI Symbol;Acc:MGI:1923731])

HSP 1 Score: 399.053 bits (1024), Expect = 8.077e-137
Identity = 201/392 (51.28%), Postives = 271/392 (69.13%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF + +LQ LD     ++ ETQAL+LAPTRELA QI     +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDI----QVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Mouse
Match: Eif4a3l2 (eukaryotic translation initiation factor 4A3 like 2 [Source:MGI Symbol;Acc:MGI:3646594])

HSP 1 Score: 393.66 bits (1010), Expect = 1.158e-134
Identity = 201/399 (50.38%), Postives = 271/399 (67.92%), Query Frame = 3
Query:   45 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            + + +  TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF I +LQ LD     ++ ETQAL+LAPTRELA QI     +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF T  ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF  T+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P NL    +DLI
Sbjct:   32 EEVDRTLTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDI----QVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLPTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTHPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCITKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNL----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Mouse
Match: Eif4a3l1 (eukaryotic translation initiation factor 4A3 like 1 [Source:MGI Symbol;Acc:MGI:3644226])

HSP 1 Score: 392.119 bits (1006), Expect = 4.766e-134
Identity = 201/392 (51.28%), Postives = 268/392 (68.37%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF I +LQ LD     ++ ETQAL+LAPTRELA QI     +L D+MNV+  AC+GGT    VG   +KL  GQHVV GTPGR+ DMI+   L T  + ML++DEADEM+ +G  +Q+  +YR +  A QV++VSATLP   L++T KF T  ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF  T+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P NL    +DLI
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIMKGRDVIAQSQSGTGKTATFSISVLQCLDI----QVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACVGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLTTRAIKMLVLDEADEMLNRGFKEQIYDVYRYLPPATQVVLVSATLPHEILEMTNKFMTHPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCITKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNL----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Mouse
Match: Eif4a3l1 (eukaryotic translation initiation factor 4A3 like 1 [Source:MGI Symbol;Acc:MGI:3644226])

HSP 1 Score: 392.119 bits (1006), Expect = 4.766e-134
Identity = 201/392 (51.28%), Postives = 268/392 (68.37%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATF I +LQ LD     ++ ETQAL+LAPTRELA QI     +L D+MNV+  AC+GGT    VG   +KL  GQHVV GTPGR+ DMI+   L T  + ML++DEADEM+ +G  +Q+  +YR +  A QV++VSATLP   L++T KF T  ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF  T+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P NL    +DLI
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIMKGRDVIAQSQSGTGKTATFSISVLQCLDI----QVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACVGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLTTRAIKMLVLDEADEMLNRGFKEQIYDVYRYLPPATQVVLVSATLPHEILEMTNKFMTHPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCITKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNL----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 354.755 bits (909), Expect = 1.538e-119
Identity = 194/391 (49.62%), Postives = 263/391 (67.26%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            F  M LK  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ L+     E  ETQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+   +L  + + M ++DEADEM+++G   Q+  I++++  +IQV+++SAT+P   L++T+KF  D ++ILVK E L+++ +KQFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ VT ++   L+ +  F  TT++  P N+    +DLI
Sbjct:   36 FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEI----EFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVR--NEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNV----ADLI 408          
BLAST of ATP-dependent RNA helicase FAL1 vs. UniProt/SwissProt
Match: sp|A5DE68|FAL1_PICGU (ATP-dependent RNA helicase FAL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) OX=294746 GN=FAL1 PE=3 SV=2)

HSP 1 Score: 417.542 bits (1072), Expect = 1.593e-143
Identity = 202/389 (51.93%), Postives = 277/389 (71.21%), Query Frame = 3
Query:   51 IKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            +K Y TF+SM LKPELLKGI N+GF  PS IQ +AIM I+ G D + QAQSG+GKTATF IGIL S+D  +K    + QALVL+PTRELAQQI  V + L D+MNV+  ACIGGT   +VG   KKL++GQH++ GTPGR++DMIK  ++   H+ ML++DEADE++ +G  +Q+  IY+ +    QV++VSATL    L++T KF +D VKILVK +++++K +KQ+YI   +E+ KF TL D+Y N TI Q +IF NT+ KV WL  +MR   FTV+ +HG ++Q +R+ +M +FRS   RVLI TDVWARGIDV  V+LVINYD+P+D+ N        Y+HRIGRSGR+ RKG A++L+T ++ + LK+L  +  T I+  P +L
Sbjct:   20 VKIYPTFESMNLKPELLKGIYNYGFEAPSAIQSRAIMQIIRGRDTIAQAQSGTGKTATFSIGILSSIDTKSK----DCQALVLSPTRELAQQIENVIEHLGDYMNVRSHACIGGT---QVGEDVKKLQQGQHIISGTPGRVLDMIKRRNIMPRHVKMLVLDEADELLTKGFKEQIYEIYKTLPAGAQVVVVSATLTPEVLEMTNKFTSDPVKILVKRDDVTLKGIKQYYIQCEKEDWKFDTLCDLYDNLTITQAVIFCNTKAKVNWLAGQMRKSNFTVAAMHGDMKQEDRDSIMKEFRSGSTRVLISTDVWARGIDVQQVSLVINYDLPLDKEN--------YVHRIGRSGRFGRKGTAINLLTSQDKDELKSLQHYYSTKIREVPADL 393          
BLAST of ATP-dependent RNA helicase FAL1 vs. UniProt/SwissProt
Match: sp|A5DWJ1|FAL1_LODEL (ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) OX=379508 GN=FAL1 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 3.927e-141
Identity = 206/389 (52.96%), Postives = 273/389 (70.18%), Query Frame = 3
Query:   51 IKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            +K + TF+SM LKPELLKGI  +GF  PS IQ +AIM I+ G D + QAQSG+GKTATF IG+L+ LD  +K    E QALVL+PTRELA QI  V   L D+MN++  ACIGG   K VG   K+L++GQ +V GTPGR++D+IK  +L T H+ MLI+DEADE+  +G  +Q+  IY+ +   +QV++VSATL    L++T KF TD VKILVK E +S+  +KQ+YI   +E+ KF TL D+Y N TI Q +IF NT+ KV WLTD+MR   FTV  +HG ++Q ER+ +M+ FRS  +RVLI TDVWARGIDV  ++LVINYD+P+D        KE Y+HRIGRSGR+ RKG A++L+T+ +   LKAL ++  T IK  P N+
Sbjct:   22 VKVHRTFESMRLKPELLKGIYAYGFEAPSAIQSRAIMQIISGRDTIAQAQSGTGKTATFSIGMLEVLDSKSK----ECQALVLSPTRELATQIQNVIKHLGDYMNIQTYACIGG---KNVGTDIKRLQQGQQIVSGTPGRVLDVIKRRNLSTRHIKMLILDEADELFTKGFKEQIYEIYKHLPPGVQVVVVSATLTHEVLEMTGKFTTDPVKILVKREEVSLSGIKQYYIQCEKEDWKFDTLCDLYDNLTITQAVIFCNTKIKVNWLTDQMRKQNFTVVAMHGDMKQEERDAIMNDFRSGNSRVLISTDVWARGIDVQQISLVINYDLPLD--------KENYIHRIGRSGRFGRKGTAINLLTKSDTIELKALEKYYSTKIKEMPSNV 395          
BLAST of ATP-dependent RNA helicase FAL1 vs. UniProt/SwissProt
Match: sp|Q9P735|FAL1_NEUCR (ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fal-1 PE=3 SV=2)

HSP 1 Score: 405.601 bits (1041), Expect = 1.030e-138
Identity = 203/391 (51.92%), Postives = 268/391 (68.54%), Query Frame = 3
Query:   60 YATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTS 1232
            + TF+SM LK  LL+GI  +G+  PS +Q +AI+ I  G D + QAQSG+GKTATF I +LQ +D    + + ETQALVL+PTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQH+V GTPGR+ DMI+  HL+T H+ ML++DEADE++ QG  +Q+  +YR +  A QV++VSATLP   LD+T KF TD V+ILVK + L+++ LKQ++I V +E+ KF TL D+Y   TI Q +IF NTR KV WLTDKMR   FTVS +HG + Q ER+ +M  FR   +RVLI TDVWARGIDV  V+LVINYD+P +R N        Y+HRIGRSGR+ RKGVA++ VT +++  L+ +  +  T I   P N+  L S
Sbjct:   25 HPTFESMSLKESLLRGIYAYGYESPSAVQSRAIVQICKGRDTIAQAQSGTGKTATFSISMLQVID----TAVRETQALVLSPTRELATQIQSVVMALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHIVSGTPGRVADMIRRRHLRTRHIKMLVLDEADELLNQGFREQIYDVYRYLPPATQVVVVSATLPYDVLDMTTKFMTDPVRILVKRDELTLEGLKQYFIAVEKEDWKFDTLCDLYDTLTITQAVIFCNTRRKVDWLTDKMREANFTVSSMHGDMPQKERDSIMQDFRQGNSRVLISTDVWARGIDVQQVSLVINYDLPSNREN--------YIHRIGRSGRFGRKGVAINFVTSEDVRILRDIELYYSTQIDEMPMNVADLIS 400          
BLAST of ATP-dependent RNA helicase FAL1 vs. UniProt/SwissProt
Match: sp|O42226|I4A3B_XENLA (Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis OX=8355 GN=eif4a3-b PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 2.341e-138
Identity = 204/392 (52.04%), Postives = 273/392 (69.64%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQKAI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     +I ETQAL+LAPT+ELA+QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   42 TFDTMGLREDLLRGIYAYGFEKPSAIQQKAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QIRETQALILAPTKELARQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 414          
BLAST of ATP-dependent RNA helicase FAL1 vs. UniProt/SwissProt
Match: sp|Q7ZVA6|IF4A3_DANRE (Eukaryotic initiation factor 4A-III OS=Danio rerio OX=7955 GN=eif4a3 PE=2 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 3.363e-138
Identity = 203/392 (51.79%), Postives = 272/392 (69.39%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV ++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   34 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVSQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. TrEMBL
Match: A0A0L0S254 (Eukaryotic initiation factor 4A-III OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_02270 PE=3 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 4.665e-146
Identity = 214/399 (53.63%), Postives = 282/399 (70.68%), Query Frame = 3
Query:   45 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            D++K Y+TF  MGLK +LL+GI  + F  PS IQQ+AIMP++   DV+ QAQSG+GKTATF IGILQ++D    + + ETQALVL+PTRELAQQI  V  +L D+MNV+  ACIGGTT  E     +KL  GQHVV GTPGR+ DMIK GHL+T  L ML++DEADE++ QG  +Q+  IYR +  + Q+++VSATLP   L++T KF TD V++LVK + L+++ +KQF+I V +EE KF TL D+Y   TI Q +IF NTR KV WLT+KMR   FTVS +HG + Q ERE +M++FR   +RVLI TDVWARGIDV  V+LVINYD+P        +N+E YLHRIGRSGR+ RKGVA++ V   ++  L+ + ++  T I   P N+    SD+I
Sbjct:   19 DSVKVYSTFDQMGLKEDLLRGIYAYNFEKPSAIQQRAIMPVIRKRDVIAQAQSGTGKTATFSIGILQNID----TAVRETQALVLSPTRELAQQIQSVLLALGDYMNVQVHACIGGTTIAED---MRKLDYGQHVVSGTPGRVFDMIKRGHLRTRQLKMLVLDEADELLNQGFKEQIYDIYRLLPPSTQIVVVSATLPHEVLEMTTKFMTDPVRVLVKRDELTLEGIKQFFIAVEREEWKFDTLCDLYDTLTITQAVIFCNTRRKVDWLTEKMREANFTVSSMHGEMPQREREAIMNEFRQGASRVLITTDVWARGIDVQQVSLVINYDLP--------LNREVYLHRIGRSGRFGRKGVAINFVKNDDVRLLRDIEQYYSTQIDEMPMNV----SDMI 398          
BLAST of ATP-dependent RNA helicase FAL1 vs. TrEMBL
Match: A0A0L0RXN7 (Eukaryotic initiation factor 4A-III OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_00767 PE=3 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 5.495e-146
Identity = 214/399 (53.63%), Postives = 282/399 (70.68%), Query Frame = 3
Query:   45 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            D++K Y+TF  MGLK +LL+GI  + F  PS IQQ+AIMP++   DV+ QAQSG+GKTATF IGILQ++D    + + ETQALVL+PTRELAQQI  V  +L D+MNV+  ACIGGTT  E     +KL  GQHVV GTPGR+ DMIK GHL+T  L ML++DEADE++ QG  +Q+  IYR +  + Q+++VSATLP   L++T KF TD V++LVK + L+++ +KQF+I V +EE KF TL D+Y   TI Q +IF NTR KV WLT+KMR   FTVS +HG + Q ERE +M++FR   +RVLI TDVWARGIDV  V+LVINYD+P        +N+E YLHRIGRSGR+ RKGVA++ V   ++  L+ + ++  T I   P N+    SD+I
Sbjct:   19 DSVKVYSTFDQMGLKEDLLRGIYAYNFEKPSAIQQRAIMPVIRKRDVIAQAQSGTGKTATFSIGILQNID----TAVRETQALVLSPTRELAQQIQSVLLALGDYMNVQVHACIGGTTIAED---MRKLDYGQHVVSGTPGRVFDMIKRGHLRTRQLKMLVLDEADELLNQGFKEQIYDIYRLLPPSTQIVVVSATLPHEVLEMTTKFMTDPVRVLVKRDELTLEGIKQFFIAVEREEWKFDTLCDLYDTLTITQAVIFCNTRRKVDWLTEKMREANFTVSSMHGEMPQREREAIMNEFRQGASRVLITTDVWARGIDVQQVSLVINYDLP--------LNREVYLHRIGRSGRFGRKGVAINFVKNDDVRLLRDIEQYYSTQIDEMPMNV----SDMI 398          
BLAST of ATP-dependent RNA helicase FAL1 vs. TrEMBL
Match: A0A316UNY5 (ATP-dependent RNA helicase FAL1 OS=Jaminaea rosea OX=1569628 GN=BDZ90DRAFT_254749 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 2.252e-141
Identity = 206/392 (52.55%), Postives = 282/392 (71.94%), Query Frame = 3
Query:   45 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLE 1220
            +++K   TF ++GLK +LL+GI  + F  PS IQQ+AI+PI+ G DV+ QAQSG+GKTATF IG+LQS+D    + + + QALVL+PTRELA QI  V  +L D+MNV+  ACIGGT+   VG   ++L+ GQHVV GTPGR+ DMIK  HL+T+++ MLI+DE+DE++  G  +Q+  IYR +  A QV++VSATLP+  L+LT KF TD V+ILVK + L+++ +KQF++ V +E+ KF TL D+Y   TI Q +IF NTR KV WLT+KMR + F VS +HG ++Q ER+ +MS+FR   +RVLI TDVWARGIDV  V+LVINYD+P++R N        YLHRIGRSGR+ RKGV++  VT  ++  L+ + +F  TTI   P NL+
Sbjct:   19 ESVKVAPTFDALGLKEDLLRGIYAYNFEKPSAIQQRAILPIIRGRDVIAQAQSGTGKTATFSIGMLQSID----TTLRDCQALVLSPTRELATQIQSVVLALGDYMNVQCHACIGGTS---VGDDIRRLEHGQHVVSGTPGRVFDMIKRRHLRTKNIKMLIMDESDELLGMGFKEQIYDIYRYLPPATQVVVVSATLPQDVLELTTKFMTDPVRILVKRDELTLEGIKQFFVAVEKEDWKFDTLCDLYDTLTITQAVIFCNTRRKVDWLTEKMRENNFQVSSMHGEMQQKERDAIMSEFRQGSSRVLITTDVWARGIDVQNVSLVINYDLPLNREN--------YLHRIGRSGRFGRKGVSICFVTVDDVRILRDIEQFYSTTIDEMPVNLQ 395          
BLAST of ATP-dependent RNA helicase FAL1 vs. TrEMBL
Match: A0A421JEU4 (ATP-dependent RNA helicase FAL1 OS=Meyerozyma sp. JA9 OX=2028340 GN=JA9_002432 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 3.223e-141
Identity = 203/389 (52.19%), Postives = 276/389 (70.95%), Query Frame = 3
Query:   51 IKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            +K Y TF+SM LKPELLKGI N+GF  PS IQ +AIM I+ G D + QAQSG+GKTATF IGIL S+D  +K    + QALVL+PTRELAQQI  V + L D+MNV+  ACIGGT   +VG   KKL++GQH++ GTPGR++DMIK  ++   H+ ML++DEADE++ +G  +Q+  IY+ +    QV++VSATL    L++T KF TD VKILVK  ++++K +KQ+YI   +E+ KF TL D+Y N TI Q +IF NT+ KV WL  +MR   FTV+ +HG ++Q +R+ +M +FRS   RVLI TDVWARGIDV  V+LVINYD+P+D+ N        Y+HRIGRSGR+ RKG A++L+T ++ + LK+L  +  T I+  P +L
Sbjct:   20 VKIYPTFESMNLKPELLKGIYNYGFEAPSAIQSRAIMQIIRGRDTIAQAQSGTGKTATFSIGILSSIDTKSK----DCQALVLSPTRELAQQIENVIEHLGDYMNVRSHACIGGT---QVGEDVKKLQQGQHIISGTPGRVLDMIKRRNIMPRHVKMLVLDEADELLTKGFKEQIYEIYKTLPAGAQVVVVSATLTPEVLEMTNKFTTDPVKILVKRHDVTLKGIKQYYIQCEKEDWKFDTLCDLYDNLTITQAVIFCNTKAKVNWLAGQMRKSNFTVAAMHGDMKQEDRDSIMKEFRSGSTRVLISTDVWARGIDVQQVSLVINYDLPLDKEN--------YVHRIGRSGRFGRKGTAINLLTSQDKDELKSLQHYYSTKIREVPADL 393          
BLAST of ATP-dependent RNA helicase FAL1 vs. TrEMBL
Match: A0A2H9TFG5 (Uncharacterized protein OS=Paramicrosporidium saccamoebae OX=1246581 GN=PSACC_03721 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 3.263e-141
Identity = 202/391 (51.66%), Postives = 279/391 (71.36%), Query Frame = 3
Query:   45 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            + I+ Y TF ++ LK +LL+G+  +GF  PS IQQ+AI+PI+ G DV+ QAQSG+GKTATF IG+LQ +D      + ETQAL+LAPTRELAQQ   V  +L D+MNV+  ACIGGT   +VG   KKL  GQHVVVGTPGR+ DMI+  +L+TE++ ML++DEADEM+++G  +Q+  IYR +    Q++IVSATLP+  LD+T KF  + V++LVK + L+++ +KQF+++V +EE KF TL D+Y   TI Q++IF NT+ KV WLTDKMR   FTVS +HG + Q ER+ +M +FR   +RVLI TDVWARGIDV  V++V NYD+P +R N        YLHRIGRSGR+ RKG+A++ VT+ ++  L+ + ++  T I   P N+
Sbjct:   27 EKIEVYPTFDALALKEDLLRGVYGYGFERPSAIQQRAIVPIIRGRDVIAQAQSGTGKTATFSIGVLQRVDIG----LRETQALILAPTRELAQQTQSVVLALGDYMNVQAHACIGGT---KVGEDVKKLDYGQHVVVGTPGRVFDMIRRRNLRTENIKMLVLDEADEMLSRGFKEQIYDIYRYLPPKTQIVIVSATLPQEVLDITSKFMVEPVQVLVKRDELTLEGIKQFFVDVEREEWKFDTLCDLYDTITIAQSVIFCNTKRKVDWLTDKMRQANFTVSAMHGEMPQKERDAIMQEFRRGVSRVLITTDVWARGIDVQQVSVVFNYDLPFNREN--------YLHRIGRSGRFGRKGIAINFVTKDDVHVLRDIEQYYATQIDEMPVNV 402          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 405.601 bits (1041), Expect = 1.356e-139
Identity = 203/392 (51.79%), Postives = 273/392 (69.64%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   34 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 394.43 bits (1012), Expect = 2.146e-135
Identity = 198/383 (51.70%), Postives = 266/383 (69.45%), Query Frame = 3
Query:   93 ELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFC+ +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   29 DLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 392          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Cavefish
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:NCBI gene;Acc:103033197])

HSP 1 Score: 353.984 bits (907), Expect = 3.500e-119
Identity = 195/391 (49.87%), Postives = 261/391 (66.75%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            F  M LK  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ L+   K    ETQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+    L  + + M ++DEADEM+++G   Q+  I+++++  IQV+++SAT+P   LD+T KF  + V+ILVK E L+++ +KQFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ VT ++   L+ +  F  TT++  P N+    +DLI
Sbjct:   39 FDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEQK----ETQALVLAPTRELAQQIQKVILALGDYMGASCHACIGGTNVR--NEMQKLQAEAPHIVVGTPGRVFDMLNRRFLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNV----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Cavefish
Match: eif4a1a (eukaryotic initiation factor 4A-I [Source:NCBI gene;Acc:103045638])

HSP 1 Score: 352.829 bits (904), Expect = 7.997e-119
Identity = 194/393 (49.36%), Postives = 263/393 (66.92%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGK-EVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ +D   K+    TQA+VLAPTRELAQQI  V  +L D+M     ACIGGT  + EV  L   +    H+VVGTPGR+ DM+   +L   H+    +DEADEM+++G   Q+  I+++++  IQVI++SAT+P+  LD+T KF  D V+ILVK E L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   33 SFDDMNLRENLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIEMKA----TQAMVLAPTRELAQQIQKVVLALGDYMGATCHACIGGTNVRNEVQKLQADVP---HIVVGTPGRVFDMLNRRYLSPRHIKQFALDEADEMLSRGFKDQIYEIFQKLSSDIQVILLSATMPQEVLDVTSKFMRDPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDLIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Cavefish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 322.013 bits (824), Expect = 4.308e-107
Identity = 179/392 (45.66%), Postives = 249/392 (63.52%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ LD     E+  TQALVLAPTRELAQQ+                             + K   E  H+VVGTPGR+ DM+    L ++ + M ++DEADEM+++G   Q+  I++++  + QV+++SAT+P   L++T KF  + V+ILVK + L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q +R+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   35 TFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQLD----PELRATQALVLAPTRELAQQVS----------------------------VAKLQAEAPHIVVGTPGRVFDMLSRKFLSSKSIKMFVLDEADEMLSRGFKDQIYEIFQKLPSSTQVVLLSATMPVEVLEVTTKFMREPVRILVKKDELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 382          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Sea Lamprey
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 249.21 bits (635), Expect = 3.744e-78
Identity = 144/392 (36.73%), Postives = 225/392 (57.40%), Query Frame = 3
Query:   48 TIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMN-VKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLE 1220
            T  K   F+   LK ELL GI   G+  PSPIQ+++I   + G D++ +A++G+GK+  + I +L+ LD       P  QAL + PTRELA Q   +   LS  M  VK  A  GGT  ++  L   +L E  HV++ TPGRI+D+I  G  K + + M+++DEAD++++Q   Q L+ I R + +  Q+++ SAT P +      +      +I +  E L++K + QFY  V  E  K   L  +++   I+Q+IIF N+ ++V+ L  K+   G++   +H +++Q  R ++   FR  E R L+C+D++ RGID+  VN+VIN+D P         N E YLHRIGRSGRY   G+A++L+T ++   LK + E L T IKP P  ++
Sbjct:   94 TATKGNEFEDYCLKRELLMGIFEKGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDMKK----PYIQALTIVPTRELALQTSQICIELSKHMGGVKVMATTGGTNLRDDIL---RLDETVHVIIATPGRILDLINKGLAKVDAVQMIVLDEADKLLSQDFVQMLDDIIRAMPRNRQILLYSATFPLSVQKFMNRHLQKPYEINLMEE-LTLKGITQFYAYV-NERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMKQEHRNRVFHDFRRGECRNLVCSDLFTRGIDIQAVNVVINFDFP--------KNAETYLHRIGRSGRYGHLGLAINLITYEDRFNLKGIEEQLGTEIKPIPGTID 468          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 188.734 bits (478), Expect = 5.411e-56
Identity = 122/378 (32.28%), Postives = 196/378 (51.85%), Query Frame = 3
Query:   54 KKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIH-QTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFL 1184
            KK   F+SMGL   + KG++  G+  P+PIQ+K I  I++G DVV  A++GSGKTA F + + + L    +S     +ALVL+PTRELA Q       L     +K    +GG   ++       L E   +++GTPGR++ ++   +LK + +  ++ DEAD +   G  +QL  I RR+  + Q ++ SATLPK  ++      +D V I +  ++     LK  ++    ++     L  +      H QT++F  T+  V++L + +   G + + ++  ++Q ER+  + +F   +  +LI TDV ARGID    N VINY+ P           + ++HR+GR  R  R G A SLV   EM  +  L  FL
Sbjct:   30 KKSGGFQSMGLSYPVFKGVMGKGYKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERL--HARSAQAGARALVLSPTRELALQTSKFTKELGKHTGLKTALILGGDRMEDQ---FAALHENPDIIIGTPGRLMHVVVEMNLKLQAMEYVVFDEADRLFEMGFAEQLTEIIRRLPDSRQTLLFSATLPKQLVEFARAGLSDPVLIRLDVDSKLSDQLKLAFMCSRADDKPCVLLHLLRTVVKPHEQTVVFVATKHHVEYLRELVSQAGMSCAYIYSALDQTERKINVGKFVHKKTMLLIVTDVAARGIDPMLDN-VINYNFP--------GKPKLFIHRVGRVARAGRSGTAYSLVAPDEMPFVIDLHLFL 393          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 179.874 bits (455), Expect = 5.965e-52
Identity = 127/395 (32.15%), Postives = 201/395 (50.89%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIP-ETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGH-LKTEHLTMLIVDEADEMMAQG---LNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQ---------TIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDV----WARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIK 1199
            FK +GL   L++     G + P+P+Q+  I PI+ G D +  AQ+GSGKTA F + ILQ L     SE P     LVLAPTRELA QI   F  +   + +K +  +GG          ++L    HVV+ TPGR+ D ++  +    + +  L++DEAD ++ QG     + L+ I   +    Q ++ SATL     +L     T+      K    +V+ L Q YI V  +      + D Y  + I +          I+F NT +  Q L   +R+  F    +H  + Q ER   +S+F+S   ++LI TDV    WARG+D+ TV +V+N++ P           + Y+HR+GR+ R  R GVA+++VT+ ++  ++A+ E + T +K
Sbjct:    7 FKRLGLDDWLMQQCKQMGISKPTPVQENCIPPILRGQDCMGCAQTGSGKTAAFVLPILQKL-----SEDPFGIFCLVLAPTRELAYQIAEQFRVMGKPLGLKDSVIVGGMDSVRQA---QELARKPHVVIATPGRLADHLRSSNTFSLKKIQFLVMDEADRLLEQGATDFTKDLQVIL-ALPAKRQTLLFSATLTDTLQELRNLALTNPFFWESKEPVRTVEELDQRYILVADK------VKDAYLVHIIQKIQDAHDDWSIIVFTNTCKNCQVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSMFKILIATDVASSFWARGLDIPTVQVVLNHNTP--------SLPKTYIHRVGRTARAGRNGVAITIVTQYDIHLVQAIEETINTKLK 378          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 1.237e-50
Identity = 111/371 (29.92%), Postives = 195/371 (52.56%), Query Frame = 3
Query:  120 GFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQ-ALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGH-LKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTI--HQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLE 1220
            G+  P+ IQ +AI   + G D++  A++GSGKT  F + ILQ+L      + P+   ALVL PTRELA QI   F++L   + +K    +GG       L    L +  HV++ TPGR++D +++        L  L++DEAD ++      +++ I + I +  +  + SAT+ K    L      + VK  V ++  +V+ L+Q+Y+ +     KF     +Y  N +  +  IIF +T    Q +   +RN GFT   +HG++ Q +R   +++F+     +L+ TDV +RG+D+  V++VIN+D+P    +        Y+HR+GR+ R  R G +++ V++ ++E  + +   +   +   P N E
Sbjct:   14 GWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQAL-----LDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSL---ALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFI---PAKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKD--------YIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIGKKLPAFPTNEE 365          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Sea Lamprey
Match: ddx39aa (DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Source:ZFIN;Acc:ZDB-GENE-030131-4275])

HSP 1 Score: 174.866 bits (442), Expect = 1.547e-50
Identity = 119/369 (32.25%), Postives = 189/369 (51.22%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFM-NVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLN----QQLETI--YRRITQAI--QVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEEN--KFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVT 1142
            F+   LKPELL+ I++ GF  PS +Q + I   + G DV+ QA+SG GKTA F +  LQ L+ ++     +   LV+  TRELA QI   ++  S +M  VK     GG + K+   + KK     H+VVGTPGR+  + ++  L  +H+   I+DE D+M+ Q +     +QL  I  ++ +  A    + +V       C    E F  D  K       L++  L+Q+Y+ +   E   K   L D+   N   Q +IF  + ++   L   +    F    +H  + Q ER     QF+  + R+L+ T+++ RG+D+  VN+V NYD+P D         + YLHR+ R+GR+  KG+AV+ V+
Sbjct:   46 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPTDG----QVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGLSIKKDEEVLKK--NCPHIVVGTPGRLA-LSRNKTLNLKHVKHFILDECDKMLEQLVTASEVEQLLHISPHQLLLDACFADLTVVLCCSSWQCYPPMEVFVDDETK-------LTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFN---QVVIFVKSVQRCMALAQLLIEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPED--------SDTYLHRVARAGRFGTKGLAVTFVS 389          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 369.392 bits (947), Expect = 2.390e-126
Identity = 189/395 (47.85%), Postives = 269/395 (68.10%), Query Frame = 3
Query:   51 IKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQ--GLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILT 1229
            +K  +TF+SM LK +LL+GI ++GF  PS IQ +AI  I+ G DV+ QAQSG+GKTATF IG+LQ++D   K    + QAL+L+PTRELA QI  V  +L D+MNV   A  GG T K+   L K  K G   V GTPGR++DMIK   L+T ++ ML++DEADE++++  G  QQ+  I+ ++ +  QV++VSAT+ K  L++T KF  D VKILVK + +S++ +KQ+ +NV +EE KF TL DIY + TI Q +IF NT++KV WL+ ++    F V  +HG ++Q ER+++M+ FR+  +RVLI TDVWARGIDV  V+LVINYD+P      + I  E Y+HRIGRSGR+ RKGVA++ +T+ ++  L+ + +F    I P P N   L+
Sbjct:   19 LKVSSTFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKK----DLQALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDD--LKKMQKHGCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLP------EII--ENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMPANFAELS 399          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Yeast
Match: TIF1 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF1 has a paralog, TIF2, that arose from the whole genome duplication [Source:SGD;Acc:S000001767])

HSP 1 Score: 334.339 bits (856), Expect = 9.898e-113
Identity = 182/386 (47.15%), Postives = 262/386 (67.88%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEIL 1226
            F  M L   LL+G+  +GF +PS IQQ+AIMPI++G DV+ QAQSG+GKT TF I  LQ +D S K+     QAL+LAPTRELA QI  V  +L+  M++K  ACIGGT+  E     + L++ Q +VVGTPGR+ D I+    +T+ + M I+DEADEM++ G  +Q+  I+  +    QV+++SAT+P   L++T KF  + V+ILVK + L+++ +KQFY+NV +EE K+  LTD+Y + ++ Q +IF NTR KV+ LT K+RND FTVS ++  + Q ER+ +M +FRS  +R+LI TD+ ARGIDV  V+LVINYD+P         NKE Y+HRIGR GR+ RKGVA++ VT +++ A++ L +F  T I+  P ++  L
Sbjct:   24 FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKA----PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDA---EGLRDAQ-IVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLP--------ANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL 393          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Yeast
Match: TIF2 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF2 has a paralog, TIF1, that arose from the whole genome duplication [Source:SGD;Acc:S000003674])

HSP 1 Score: 334.339 bits (856), Expect = 9.898e-113
Identity = 182/386 (47.15%), Postives = 262/386 (67.88%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEIL 1226
            F  M L   LL+G+  +GF +PS IQQ+AIMPI++G DV+ QAQSG+GKT TF I  LQ +D S K+     QAL+LAPTRELA QI  V  +L+  M++K  ACIGGT+  E     + L++ Q +VVGTPGR+ D I+    +T+ + M I+DEADEM++ G  +Q+  I+  +    QV+++SAT+P   L++T KF  + V+ILVK + L+++ +KQFY+NV +EE K+  LTD+Y + ++ Q +IF NTR KV+ LT K+RND FTVS ++  + Q ER+ +M +FRS  +R+LI TD+ ARGIDV  V+LVINYD+P         NKE Y+HRIGR GR+ RKGVA++ VT +++ A++ L +F  T I+  P ++  L
Sbjct:   24 FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKA----PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDA---EGLRDAQ-IVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLP--------ANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL 393          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Yeast
Match: DBP5 (Cytoplasmic ATP-dependent RNA helicase of the DEAD-box family; involved in mRNA export from the nucleus, remodeling messenger ribonucleoprotein particles (mRNPs), with ATPase activity stimulated by Gle1p, IP6 and Nup159p; involved in translation termination along with Sup45p (eRF1); role in the cellular response to heat stress [Source:SGD;Acc:S000005572])

HSP 1 Score: 230.335 bits (586), Expect = 3.488e-71
Identity = 127/365 (34.79%), Postives = 213/365 (58.36%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIV---DGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMM-AQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRK 1148
            +F  +GL PELLKGI    F  PS IQ++A +P++      +++ Q+QSG+GKTA F + +L  ++  + S     QA+ LAP+RELA+Q   V   +  F  +     +  +         K  +    V+VGTPG ++D+++   ++ + + + ++DEAD M+  QGL  Q   + R + +  Q+++ SAT   A     +K   +A  + +++  ++V  +KQ Y++   E +KF  LT++Y   TI  +IIF  T++    L  K++++G  VS +HG ++  ER++L+  FR   ++VLI T+V ARGID+ TV++V+NYD+P   N +   +   Y+HRIGR+GR+ RKGVA+S V  K
Sbjct:   93 SFDELGLAPELLKGIYAMKFQKPSKIQERA-LPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDAS----PQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDS-------FEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQ--ADPATYIHRIGRTGRFGRKGVAISFVHDK 443          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Yeast
Match: DHH1 (Cytoplasmic DEAD-box helicase, stimulates mRNA decapping; coordinates distinct steps in mRNA function and decay, interacting with both decapping and deadenylase complexes; role in translational repression, mRNA decay, and possibly mRNA export; interacts and cooperates with Ngr1p to promote specific mRNA decay; ATP- and RNA-bound form promotes processing body (PB) assembly, while ATPase stimulation by Not1p promotes PB disassembly; forms cytoplasmic foci on replication stress [Source:SGD;Acc:S000002319])

HSP 1 Score: 222.631 bits (566), Expect = 4.406e-68
Identity = 131/385 (34.03%), Postives = 210/385 (54.55%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLE 1220
            TF+   LK ELL GI   GF  PSPIQ++AI   + G D++ +A++G+GKTA F I  L+ +    K ++ + QAL++ PTRELA Q   V  +L     +      GGT  ++  L   +L E  H++VGTPGR++D+           ++ I+DEAD+M+++     +E I   +    Q ++ SAT P    +   K      +I +  E L++K + Q+Y  V +E  K   L  +++   I+Q IIF N+  +V+ L  K+ + G++    H R++Q ER ++  +FR  + R L+C+D+  RGID+  VN+VIN+D P           E YLHRIGRSGR+   G+A++L+   +   L  + + L T I   P  ++
Sbjct:   47 TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKV----KPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIL---RLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEE-LTLKGITQYYAFV-EERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFP--------KTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATID 414          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Nematostella
Match: EDO48460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU5])

HSP 1 Score: 395.971 bits (1016), Expect = 3.668e-136
Identity = 197/392 (50.26%), Postives = 274/392 (69.90%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +M L+ +LL+GI  +GF  PS IQQ+AI PI+ G DV+ QAQSG+GKTATF I +LQ++D    +++ E QALVL+PTRELA QI  V  +L D+M+V+  ACIGGT    +G   +KL  GQH+V GTPGR+ DMI+  +L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTV+ +HG + Q ERE +M  FR+ ++RVLI TDVWARG+DV  V+LVINYD+P   NNR     E Y+HRIGRSGR+ RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   35 TFDAMKLREDLLRGIYAYGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAID----TQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTN---IGEDIRKLDYGQHIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVLISTDVWARGLDVQQVSLVINYDLP---NNR-----ELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNV----ADLI 407          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Nematostella
Match: EDO45225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ5])

HSP 1 Score: 348.977 bits (894), Expect = 9.419e-118
Identity = 193/394 (48.98%), Postives = 263/394 (66.75%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLD--FSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M LK  LL+GI  +GF  PS IQQ+AI P     DV+ QAQSG+GKTATF I ILQ +D  + +K+     QALVLAPTRELAQQI  V  +L D+M+VK  ACIGGT  +E  +   KL+EG HVVVGTPGR+ DMI  G L T  + + ++DEADEM+++G   Q+  ++ R+  ++QV+++SAT+P   L++T KF  D V+ILVK E ++++ +KQF++ V +E+ K  TL D+Y   TI Q +IFANTR KV WL  KM     TVS +HG + Q ER+ +M +FRS  +RVLI TD+ ARGIDVH V+LVINYD+P +R N        Y+HRIGR GR+ RKG A++ VT  ++  LK + ++  T I+  P N+    +DLI
Sbjct:   34 SFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHACIGGTNVREDRM---KLEEGVHVVVGTPGRVFDMINRGVLNTRDIKLFVLDEADEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDVVRILVKREEVTLEGIKQFFVLVEKEDWKLDTLCDLYETLTITQAVIFANTRRKVDWLAAKMTEKDHTVSSMHGDMSQKERDIIMKEFRSGSSRVLITTDLLARGIDVHQVSLVINYDLPSNREN--------YIHRIGRGGRFGRKGAAINFVTNDDVRMLKDIEQYYNTKIEEMPMNV----ADLI 412          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Nematostella
Match: EDO39940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H2])

HSP 1 Score: 239.965 bits (611), Expect = 5.482e-75
Identity = 139/387 (35.92%), Postives = 216/387 (55.81%), Query Frame = 3
Query:   48 TIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAP 1208
            T  K   F+   LK ELL GI   GF  PSPIQ+++I   + G D++ +A++G+GKTA + + +L+  D +        QALVL PTRELA Q   +   L   M  +     GGT+ K+  L   +L    HV+V TPGR++D++K          ML++DEAD++++    + LE I + + +  Q+++ SAT P +  D  EK      +I +  E L++  + Q+Y  V +E+ K   L  ++    I+Q+IIF N+ ++V+ L  K+   GF+   +H R+ Q+ R ++   FR    R L+C+D++ RGID+ +VN+VIN+D P         N E YLHRIGRSGR+   GVA++L+T  +   L  +   L T IKP P
Sbjct:   42 TATKGNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERTDTTKNC----IQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLKDDIL---RLYNKVHVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINLMDE-LTLHGVTQYYAFV-EEKQKVHCLNTLFQKLQINQSIIFCNSVQRVELLARKILELGFSCFYIHARMSQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFP--------KNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENELDTEIKPIP 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Nematostella
Match: EDO46214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR7])

HSP 1 Score: 207.994 bits (528), Expect = 3.684e-63
Identity = 130/379 (34.30%), Postives = 212/379 (55.94%), Query Frame = 3
Query:   51 IKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTAC---IGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQE-------ENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEME 1157
            I++   F S+ L P LL+G+   GF  PSPIQ KAI     G D++ QA+SG+GKT  F +  L+++     +E    Q ++L PTRE+A Q+  V  ++    +  G AC   IGG + +E     KK  +  H+ VGTPGR+  +I+  +LKTE + M I+DEAD+++ +   QQ+  I+  + +  Q++  SAT P+   +  +K+ T+   + + + + S++ +KQFY  V          + K   L  + ++   +Q ++F+N + + + L+D +   G+  + + G   QA+R + M + +S   R+LI TD+ ARGID   VNLV+N DVP         N E YLHRIGR+GR+  +G+AV+ V   + E
Sbjct:   17 IEEQIDFHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALENV----ITESNCIQIIILTPTREIAVQVKDVICAIG--CHYDGLACKVFIGGISLEE----DKKALKSCHIAVGTPGRVKYLIEQKYLKTESVRMFILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEVLANHLKKYMTEPTFVRLNAADPSLQGIKQFYSLVRFHPLPHKTFQEKVDGLIKLLSSVNFNQCLVFSNYQIRAKSLSDTLCRKGWPSTFIAGYQTQAKRLEAMEKLKSFHCRILISTDLTARGIDAENVNLVVNMDVP--------HNGETYLHRIGRAGRFGTEGMAVTYVANGKEE 377          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Nematostella
Match: EDO46520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ2])

HSP 1 Score: 209.149 bits (531), Expect = 4.087e-63
Identity = 123/385 (31.95%), Postives = 215/385 (55.84%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGD---DVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFM-NVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGH-LKTEHLTMLIVDEADEMMA-QGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVT-RKEMEALKALGEFLKTTIK 1199
            +F+ + L   L +G+ + GF  PS IQ+ A +P++  D   +++ Q+QSG+GKTA F + +L  +D +     P  Q + L+PT ELA+Q   V +++     ++K    + G          +  K   H+++GTPG ++D I+     +   +++ ++DEAD M+A QG   Q   I++ + +  QV++ SAT  +  +   E    + + I ++ E  S+  +KQ+Y+     E+KF  L ++Y   +I Q ++F +TR    WL +KM  +G  V+ + G I   +R  ++ +FR  + ++LI T+V ARGIDV  V LVINYD+P+D   +   + E YLHRIGR+GR+ + G+AV+ +  ++ M  +K + E     I+
Sbjct:   47 SFEELPLSANLRRGVYDMGFNKPSKIQETA-LPMLLADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATK----PYPQVICLSPTYELARQTGKVAEAMGKHCPHIKINYAVRGNQ------FPRGQKCTDHIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEADIMIALQGHQDQSIRIHKSLHKDCQVLLFSATYDEDVMKFAETVVPNPIIIRLRREEESLDNIKQYYVVCKNSEDKFEALCNMYGVLSIGQCVVFCHTRRNAAWLAEKMVKEGHAVALLSGEITIEQRIAVLERFRLGKEKLLITTNVSARGIDVEQVTLVINYDMPMDMQGKA--DFETYLHRIGRTGRFGKSGIAVNFIDGQRSMNIMKKIEEHFGKKIQ 418          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Medaka
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:101159793])

HSP 1 Score: 405.986 bits (1042), Expect = 9.105e-140
Identity = 204/392 (52.04%), Postives = 273/392 (69.64%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            TF +MGL+ +LL+GI  +GF  PS IQQ+AI  I+ G DV+ Q+QSG+GKTATFCI +LQ LD     ++ ETQAL+LAPTRELA QI  V  +L D+MNV+  ACIGGT    VG   +KL  GQHVV GTPGR+ DMI+   L+T  + ML++DEADEM+ +G  +Q+  +YR +  A QV+++SATLP   L++T KF TD ++ILVK + L+++ +KQF++ V +EE KF TL D+Y   TI Q +IF NT+ KV WLT+KMR   FTVS +HG + Q ERE +M +FRS  +RVLI TDVWARG+DV  V+L+INYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + ++  T I   P N+    +DLI
Sbjct:   34 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCISVLQCLDI----QVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTN---VGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV----ADLI 406          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Medaka
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:NCBI gene;Acc:101167901])

HSP 1 Score: 358.607 bits (919), Expect = 4.610e-121
Identity = 196/391 (50.13%), Postives = 263/391 (67.26%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            F  M LK  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ LD   K    ETQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+   HL  + + M ++DEADEM+++G   Q+  I+++++  IQV+++SAT+P   L++T+KF  D ++ILVK E L+++ +KQFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ VT ++   L+ +  F  TT++  P N+    +DLI
Sbjct:   39 FDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLDIEQK----ETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNLR--SEIQKLQAEAPHIVVGTPGRVFDMLNRRHLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNV----ADLI 411          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Medaka
Match: eif4a1a (eukaryotic initiation factor 4A-I [Source:NCBI gene;Acc:101155548])

HSP 1 Score: 347.436 bits (890), Expect = 8.763e-117
Identity = 188/392 (47.96%), Postives = 263/392 (67.09%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M L+  LL+GI  +GF  PS IQQ+AI+P + G DV+ QAQSG+GKTATF I ILQ +D   K+    TQALVLAPTRELAQQI  V  +L D+M     ACIGGT  +    + K   E  H+VVGTPGR+ DM+   ++  + + M ++DEADEM+++G   Q+  I++++  + QV+++SAT+P   L++T+KF  + ++ILVK E L+++ ++QFYINV +EE K  TL D+Y   TI Q +IF NTR KV WLT+KM    FTVS +HG ++Q ER+ +M +FRS  +RVLI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA+++VT  +   L+ +  F  TT++  P N+    +DLI
Sbjct:   32 SFDDMNLREALLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQIDVEMKA----TQALVLAPTRELAQQIQKVVLALGDYMGANCYACIGGTNIR--NEVQKLQAEAPHIVVGTPGRVFDMLSRKNISPKCIKMFVLDEADEMLSRGFKDQIYEIFQKLASSTQVVLLSATMPADVLEVTKKFMREPIRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNREN--------YIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNV----ADLI 405          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Medaka
Match: ENSORLT00000028513.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 239.195 bits (609), Expect = 1.051e-73
Identity = 141/392 (35.97%), Postives = 226/392 (57.65%), Query Frame = 3
Query:   48 TIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMN-VKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLE 1220
            T  K   F+   LK ELL GI   G+  PSPIQ+++I   + G D++ +A++G+GK+  + I +L+ +D          QA+V+ PTRELA Q+  +   +S  M  VK  A  GGT  ++  +   +L E  HVV+ TPGRI+D+IK G  K + + M+++DEAD++++Q     +E I   + +  Q+++ SAT P +      K      +I +  E L++K + QFY  V  E  K   L  +++   I+Q+IIF N+ ++V+ L  K+   G++   +H ++ Q  R ++   FR+   R L+CTD++ RGID+  VN+VIN+D P         N E YLHRIGRSGR+   G+A++L+T ++   LKA+ E L T IKP P +++
Sbjct:   84 TATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKD----HIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIM---RLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLMEE-LTLKGITQFYAYV-TERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFP--------KNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSID 458          
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Medaka
Match: ENSORLT00000045064.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 239.195 bits (609), Expect = 1.051e-73
Identity = 141/392 (35.97%), Postives = 226/392 (57.65%), Query Frame = 3
Query:   48 TIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMN-VKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLE 1220
            T  K   F+   LK ELL GI   G+  PSPIQ+++I   + G D++ +A++G+GK+  + I +L+ +D          QA+V+ PTRELA Q+  +   +S  M  VK  A  GGT  ++  +   +L E  HVV+ TPGRI+D+IK G  K + + M+++DEAD++++Q     +E I   + +  Q+++ SAT P +      K      +I +  E L++K + QFY  V  E  K   L  +++   I+Q+IIF N+ ++V+ L  K+   G++   +H ++ Q  R ++   FR+   R L+CTD++ RGID+  VN+VIN+D P         N E YLHRIGRSGR+   G+A++L+T ++   LKA+ E L T IKP P +++
Sbjct:   84 TATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKD----HIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIM---RLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLMEE-LTLKGITQFYAYV-TERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFP--------KNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSID 458          
BLAST of ATP-dependent RNA helicase FAL1 vs. Planmine SMEST
Match: SMESG000030445.1 (SMESG000030445.1)

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 398/399 (99.75%), Postives = 398/399 (99.75%), Query Frame = 3
Query:   45 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHL MLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI
Sbjct:   15 DTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLIMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 413          
BLAST of ATP-dependent RNA helicase FAL1 vs. Planmine SMEST
Match: SMESG000030445.1 (SMESG000030445.1)

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 387/388 (99.74%), Postives = 387/388 (99.74%), Query Frame = 3
Query:   78 MGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            MGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHL MLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI
Sbjct:    1 MGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLIMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 388          
BLAST of ATP-dependent RNA helicase FAL1 vs. Planmine SMEST
Match: SMESG000078818.1 (SMESG000078818.1)

HSP 1 Score: 382.104 bits (980), Expect = 1.545e-130
Identity = 190/383 (49.61%), Postives = 262/383 (68.41%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            F  M LK +LL+GI  +GF  PS IQ +AI  IV G DV+ QAQSG+GKT+   I  LQ  D     ++ ETQ L+L+PTRELAQQ   V  +L D+MNV+  ACIGG +   +    KKL  GQH+V GTPGR+ DM++  +L+T  ++ L++DEADEM+ +G  +Q+  IYR +    QVI++SATLP   L++T KF T+ ++ILVK + L+++ +KQ++++V +EE KF TL DIY   T+ Q +IF NT+ KV+WLT+KMR + FTVS +HG + Q ER+++  QFR++E RVLI TDVWARGIDV  V+LVINYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + +F  T I   P N+
Sbjct:   27 FNKMNLKEDLLRGIYAYGFEKPSAIQARAIKQIVKGRDVIAQAQSGTGKTSLIAISSLQLTDI----DLRETQILILSPTRELAQQTQKVILALGDYMNVQCHACIGGAS---MAQDMKKLDYGQHIVSGTPGRVFDMMQRRNLRTSKISTLVLDEADEMLDKGFKEQIYQIYRYLPPGTQVILISATLPHEILEMTSKFMTNPIRILVKRDELTLEGIKQYFVSVEREEWKFDTLCDIYDTVTVTQVVIFCNTKRKVEWLTEKMRENNFTVSSIHGDMPQGERDEITRQFRALETRVLITTDVWARGIDVQHVSLVINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKSDDVRILRDIEQFYATQIDEMPMNM 394          
BLAST of ATP-dependent RNA helicase FAL1 vs. Planmine SMEST
Match: SMESG000078818.1 (SMESG000078818.1)

HSP 1 Score: 381.333 bits (978), Expect = 1.998e-130
Identity = 190/383 (49.61%), Postives = 262/383 (68.41%), Query Frame = 3
Query:   69 FKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNL 1217
            F  M LK +LL+GI  +GF  PS IQ +AI  IV G DV+ QAQSG+GKT+   I  LQ  D     ++ ETQ L+L+PTRELAQQ   V  +L D+MNV+  ACIGG +   +    KKL  GQH+V GTPGR+ DM++  +L+T  ++ L++DEADEM+ +G  +Q+  IYR +    QVI++SATLP   L++T KF T+ ++ILVK + L+++ +KQ++++V +EE KF TL DIY   T+ Q +IF NT+ KV+WLT+KMR + FTVS +HG + Q ER+++  QFR++E RVLI TDVWARGIDV  V+LVINYD+P   NNR     E Y+HRIGRSGRY RKGVA++ V   ++  L+ + +F  T I   P N+
Sbjct:   22 FNKMNLKEDLLRGIYAYGFEKPSAIQARAIKQIVKGRDVIAQAQSGTGKTSLIAISSLQLTDI----DLRETQILILSPTRELAQQTQKVILALGDYMNVQCHACIGGAS---MAQDMKKLDYGQHIVSGTPGRVFDMMQRRNLRTSKISTLVLDEADEMLDKGFKEQIYQIYRYLPPGTQVILISATLPHEILEMTSKFMTNPIRILVKRDELTLEGIKQYFVSVEREEWKFDTLCDIYDTVTVTQVVIFCNTKRKVEWLTEKMRENNFTVSSIHGDMPQGERDEITRQFRALETRVLITTDVWARGIDVQHVSLVINYDLP---NNR-----ELYIHRIGRSGRYGRKGVAINFVKSDDVRILRDIEQFYATQIDEMPMNM 389          
BLAST of ATP-dependent RNA helicase FAL1 vs. Planmine SMEST
Match: SMESG000058317.1 (SMESG000058317.1)

HSP 1 Score: 361.303 bits (926), Expect = 1.671e-122
Identity = 194/393 (49.36%), Postives = 270/393 (68.70%), Query Frame = 3
Query:   66 TFKSMGLKPELLKGIINHGFTDPSPIQQKAIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLAPTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKE-VGLLTKKLKEGQHVVVGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQAIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQEENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGRIEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNNRKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKPAPKNLEILTSDLI 1241
            +F  M LK +LL+GI  +GF  PS IQQ+A++P ++G DV+ QAQSG+GKTATF + ILQ +D S      E QALVLAPTRELA+QI  V  +L D+M  K  ACIGGT  +E VG     L+ G HV+VGTPGR+ DMI+ G+LKT ++ M ++DEADEM+++G  +Q+ ++ + I    Q++++SAT+P   L++T KF  + VKILVK E L+++ ++QFY+NVG EE KF TLTD+Y   TI Q +IF NTR KV  LTD ++   F VS +HG ++Q  R+Q+M +FRS  +R+LI TD+ ARGIDV  V+LVINYD+P +R N        Y+HRIGR GR+ RKGVA++ VT+ ++  L+ L  +  T I+  P N+    +DLI
Sbjct:   17 SFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKN----EVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVG----NLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGDEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNREN--------YIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNI----ADLI 389          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4A34.612e-13751.53eukaryotic translation initiation factor 4A3 [Sour... [more]
EIF4A34.612e-13751.53eukaryotic translation initiation factor 4A3 [Sour... [more]
EIF4A33.528e-12448.21eukaryotic translation initiation factor 4A3 [Sour... [more]
EIF4A22.240e-11949.62eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A23.137e-11949.62eukaryotic translation initiation factor 4A2 [Sour... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y65B4A.61.097e-13651.30pep chromosome:WBcel235:I:629492:636350:-1 gene:WB... [more]
F33D11.102.649e-13651.04pep chromosome:WBcel235:I:5866514:5868139:-1 gene:... [more]
inf-11.660e-12848.21Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-11.660e-12848.21Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-11.660e-12848.21Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG74837.238e-13751.79gene:FBgn0037573 transcript:FBtr0081834[more]
eIF4A5.022e-11749.24gene:FBgn0001942 transcript:FBtr0079178[more]
eIF4A5.022e-11749.24gene:FBgn0001942 transcript:FBtr0079175[more]
eIF4A5.022e-11749.24gene:FBgn0001942 transcript:FBtr0079177[more]
eIF4A5.022e-11749.24gene:FBgn0001942 transcript:FBtr0307068[more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a37.766e-13951.79eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a1b2.733e-11948.72eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b4.864e-11948.72eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b4.864e-11948.72eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b7.037e-11948.72eukaryotic translation initiation factor 4A1B [Sou... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a3.16.818e-13951.79eukaryotic translation initiation factor 4A3, gene... [more]
eif4a3.17.050e-13951.79eukaryotic translation initiation factor 4A3, gene... [more]
eif4a3.18.173e-13951.79eukaryotic translation initiation factor 4A3, gene... [more]
eif4a3.11.023e-13851.79eukaryotic translation initiation factor 4A3, gene... [more]
eif4a3.11.057e-13851.79eukaryotic translation initiation factor 4A3, gene... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4a38.077e-13751.28eukaryotic translation initiation factor 4A3 [Sour... [more]
Eif4a3l21.158e-13450.38eukaryotic translation initiation factor 4A3 like ... [more]
Eif4a3l14.766e-13451.28eukaryotic translation initiation factor 4A3 like ... [more]
Eif4a3l14.766e-13451.28eukaryotic translation initiation factor 4A3 like ... [more]
Eif4a21.538e-11949.62eukaryotic translation initiation factor 4A2 [Sour... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5DE68|FAL1_PICGU1.593e-14351.93ATP-dependent RNA helicase FAL1 OS=Meyerozyma guil... [more]
sp|A5DWJ1|FAL1_LODEL3.927e-14152.96ATP-dependent RNA helicase FAL1 OS=Lodderomyces el... [more]
sp|Q9P735|FAL1_NEUCR1.030e-13851.92ATP-dependent RNA helicase fal-1 OS=Neurospora cra... [more]
sp|O42226|I4A3B_XENLA2.341e-13852.04Eukaryotic initiation factor 4A-III-B OS=Xenopus l... [more]
sp|Q7ZVA6|IF4A3_DANRE3.363e-13851.79Eukaryotic initiation factor 4A-III OS=Danio rerio... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L0S2544.665e-14653.63Eukaryotic initiation factor 4A-III OS=Allomyces m... [more]
A0A0L0RXN75.495e-14653.63Eukaryotic initiation factor 4A-III OS=Allomyces m... [more]
A0A316UNY52.252e-14152.55ATP-dependent RNA helicase FAL1 OS=Jaminaea rosea ... [more]
A0A421JEU43.223e-14152.19ATP-dependent RNA helicase FAL1 OS=Meyerozyma sp. ... [more]
A0A2H9TFG53.263e-14151.66Uncharacterized protein OS=Paramicrosporidium sacc... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a31.356e-13951.79eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a32.146e-13551.70eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a23.500e-11949.87eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a1a7.997e-11949.36eukaryotic initiation factor 4A-I [Source:NCBI gen... [more]
eif4a1b4.308e-10745.66eukaryotic translation initiation factor 4A1B [Sou... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx63.744e-7836.73DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
DDX545.411e-5632.28DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
ddx495.965e-5232.15DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
ENSPMAT00000000216.11.237e-5029.92pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx39aa1.547e-5032.25DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Sourc... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FAL12.390e-12647.85Nucleolar protein required for maturation of 18S r... [more]
TIF19.898e-11347.15Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
TIF29.898e-11347.15Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
DBP53.488e-7134.79Cytoplasmic ATP-dependent RNA helicase of the DEAD... [more]
DHH14.406e-6834.03Cytoplasmic DEAD-box helicase, stimulates mRNA dec... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO484603.668e-13650.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452259.419e-11848.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399405.482e-7535.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462143.684e-6334.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465204.087e-6331.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a39.105e-14052.04eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a24.610e-12150.13eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a1a8.763e-11747.96eukaryotic initiation factor 4A-I [Source:NCBI gen... [more]
ENSORLT00000028513.11.051e-7335.97probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ENSORLT00000045064.11.051e-7335.97probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
back to top
BLAST of ATP-dependent RNA helicase FAL1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030445.10.000e+099.75SMESG000030445.1[more]
SMESG000030445.10.000e+099.74SMESG000030445.1[more]
SMESG000078818.11.545e-13049.61SMESG000078818.1[more]
SMESG000078818.11.998e-13049.61SMESG000078818.1[more]
SMESG000058317.11.671e-12249.36SMESG000058317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027527 ID=SMED30027527|Name=ATP-dependent RNA helicase FAL1|organism=Schmidtea mediterranea sexual|type=transcript|length=1263bp
TAATGAGTAAAATTAATAAAAAATTAGTTATTAAAAATAATAAAGATACT
ATTAAAAAGTATGCTACTTTTAAATCTATGGGACTGAAGCCTGAATTGTT
AAAAGGTATAATAAATCATGGTTTTACTGATCCATCCCCAATTCAACAAA
AAGCAATAATGCCTATTGTTGATGGAGATGATGTTGTTATTCAAGCTCAA
TCAGGTTCAGGAAAAACTGCAACATTCTGCATTGGTATTTTACAAAGTCT
CGATTTTTCCAATAAATCAGAGATTCCCGAAACTCAAGCACTAGTCTTAG
CTCCTACTAGAGAATTAGCTCAACAGATATGTGGTGTATTTGATTCATTG
AGTGATTTCATGAACGTAAAAGGTACAGCATGTATTGGTGGAACTACCGG
TAAAGAAGTTGGTCTATTGACGAAGAAATTGAAAGAAGGCCAACATGTCG
TTGTCGGAACTCCAGGTCGAATTATTGATATGATCAAACACGGCCATTTA
AAAACCGAACATTTGACAATGTTAATTGTCGACGAAGCCGATGAAATGAT
GGCCCAAGGATTAAATCAACAATTGGAAACTATTTATCGTCGAATAACAC
AGGCTATTCAAGTAATCATCGTCAGCGCTACTCTTCCGAAAGCTTGCTTG
GATTTGACAGAGAAATTCCAAACTGATGCCGTGAAAATCCTTGTGAAAAG
CGAAAATCTTTCAGTGAAAACCTTGAAACAGTTCTACATCAATGTCGGCC
AAGAGGAGAACAAATTCAGCACTCTGACAGACATTTACGCCAACAACACA
ATCCACCAGACAATCATATTCGCCAACACCCGGGAGAAAGTCCAATGGCT
GACAGACAAAATGCGCAATGACGGATTCACAGTTTCATGCGTGCACGGCC
GGATCGAGCAGGCCGAGCGAGAACAGCTAATGAGCCAATTCCGATCGATG
GAAAACCGAGTGCTGATCTGCACCGACGTGTGGGCGCGTGGAATTGACGT
GCATACTGTCAATCTCGTTATCAACTACGACGTGCCGATCGACAGGAACA
ACCGGAAATTCATTAACAAAGAGGCCTATTTGCACAGGATCGGTCGGAGT
GGTCGATACGAGAGGAAAGGGGTCGCAGTGAGCCTCGTGACTCGCAAGGA
AATGGAGGCGTTGAAGGCACTGGGAGAGTTCTTGAAGACCACCATCAAAC
CTGCTCCGAAAAATTTGGAAATTTTAACTTCCGATTTGATTTGATCAATA
AATATTTGCGTGA
back to top

protein sequence of SMED30027527-orf-1

>SMED30027527-orf-1 ID=SMED30027527-orf-1|Name=SMED30027527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MSKINKKLVIKNNKDTIKKYATFKSMGLKPELLKGIINHGFTDPSPIQQK
AIMPIVDGDDVVIQAQSGSGKTATFCIGILQSLDFSNKSEIPETQALVLA
PTRELAQQICGVFDSLSDFMNVKGTACIGGTTGKEVGLLTKKLKEGQHVV
VGTPGRIIDMIKHGHLKTEHLTMLIVDEADEMMAQGLNQQLETIYRRITQ
AIQVIIVSATLPKACLDLTEKFQTDAVKILVKSENLSVKTLKQFYINVGQ
EENKFSTLTDIYANNTIHQTIIFANTREKVQWLTDKMRNDGFTVSCVHGR
IEQAEREQLMSQFRSMENRVLICTDVWARGIDVHTVNLVINYDVPIDRNN
RKFINKEAYLHRIGRSGRYERKGVAVSLVTRKEMEALKALGEFLKTTIKP
APKNLEILTSDLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: biological process
TermDefinition
GO:0000462maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364rRNA processing
GO:0042254ribosome biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005829cytosol
GO:0030688preribosome, small subunit precursor
GO:0097078FAL1-SGD1 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 281..370
e-value: 2.4E-27
score: 106.8
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 254..369
e-value: 2.4E-26
score: 92.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 240..409
score: 22.619
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 40..244
e-value: 1.8E-50
score: 183.6
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 52..229
score: 24.461
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 233..408
e-value: 1.7E-49
score: 169.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..232
e-value: 3.6E-62
score: 211.8
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 20..395
NoneNo IPR availablePANTHERPTHR24031:SF646coord: 20..395
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 241..379
e-value: 3.26919E-50
score: 163.832
NoneNo IPR availableCDDcd18045DEADc_EIF4AIII_DDX48coord: 23..230
e-value: 7.4388E-83
score: 250.462
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 46..214
e-value: 1.1E-39
score: 136.0
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 175..183
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 21..49
score: 11.161
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 93..389
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 38..117