Zinc finger protein

Overview
NameZinc finger protein
Smed IDSMED30027511
Length (bp)2748
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein (SMED30027511) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein (SMED30027511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein (SMED30027511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein (SMED30027511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30027511h1SMcG0009101 SmedASXL_012837SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30027511h1SMcG0009101 dd_Smed_v4_3300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027511h1SMcG0009101 dd_Smed_v4_3300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027511h1SMcG0009101 dd_Smed_v4_3300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027511h1SMcG0009101 dd_Smed_v4_23380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027511h1SMcG0009101 dd_Smed_v4_3300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF608 (zinc finger protein 608 [Source:HGNC Symbol;Acc:HGNC:29238])

HSP 1 Score: 67.3958 bits (163), Expect = 1.313e-10
Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++
Sbjct:  338 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLD 407          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF608 (zinc finger protein 608 [Source:HGNC Symbol;Acc:HGNC:29238])

HSP 1 Score: 66.6254 bits (161), Expect = 1.808e-10
Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  +
Sbjct:  338 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLDCTK 410          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF608 (zinc finger protein 608 [Source:HGNC Symbol;Acc:HGNC:29238])

HSP 1 Score: 66.2402 bits (160), Expect = 1.949e-10
Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  +
Sbjct:  338 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLDCTK 410          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF609 (zinc finger protein 609 [Source:HGNC Symbol;Acc:HGNC:29003])

HSP 1 Score: 66.2402 bits (160), Expect = 2.593e-10
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SVGVNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  278 EQIMVRTRSVGVNTCDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 347          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF608 (zinc finger protein 608 [Source:HGNC Symbol;Acc:HGNC:29238])

HSP 1 Score: 65.0846 bits (157), Expect = 3.411e-10
Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  +
Sbjct:  338 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLDCTK 410          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: sbb (gene:FBgn0285917 transcript:FBtr0329997)

HSP 1 Score: 65.0846 bits (157), Expect = 3.357e-10
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  677 VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
             S GT  +   LGPC+ G+ +TLE +V  ET+ G+L+V+V WRGKT +G L++  R
Sbjct:  877 TSVGTITEPDCLGPCEPGTSVTLEGIVWHETEGGVLVVNVTWRGKTYVGTLLDCTR 932          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: sbb (gene:FBgn0285917 transcript:FBtr0301549)

HSP 1 Score: 64.6994 bits (156), Expect = 3.431e-10
Identity = 26/57 (45.61%), Postives = 38/57 (66.67%), Query Frame = 2
Query:  677 VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERF 847
             S GT  +   LGPC+ G+ +TLE +V  ET+ G+L+V+V WRGKT +G L++  R 
Sbjct:  877 TSVGTITEPDCLGPCEPGTSVTLEGIVWHETEGGVLVVNVTWRGKTYVGTLLDCTRH 933          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: sbb (gene:FBgn0285917 transcript:FBtr0301550)

HSP 1 Score: 65.0846 bits (157), Expect = 3.528e-10
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  677 VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
             S GT  +   LGPC+ G+ +TLE +V  ET+ G+L+V+V WRGKT +G L++  R
Sbjct:  877 TSVGTITEPDCLGPCEPGTSVTLEGIVWHETEGGVLVVNVTWRGKTYVGTLLDCTR 932          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: sbb (gene:FBgn0285917 transcript:FBtr0301551)

HSP 1 Score: 64.6994 bits (156), Expect = 3.838e-10
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  677 VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
             S GT  +   LGPC+ G+ +TLE +V  ET+ G+L+V+V WRGKT +G L++  R
Sbjct:  867 TSVGTITEPDCLGPCEPGTSVTLEGIVWHETEGGVLVVNVTWRGKTYVGTLLDCTR 922          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: sbb (gene:FBgn0285917 transcript:FBtr0301547)

HSP 1 Score: 64.6994 bits (156), Expect = 3.838e-10
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  677 VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
             S GT  +   LGPC+ G+ +TLE +V  ET+ G+L+V+V WRGKT +G L++  R
Sbjct:  867 TSVGTITEPDCLGPCEPGTSVTLEGIVWHETEGGVLVVNVTWRGKTYVGTLLDCTR 922          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf609b (zinc finger protein 609b [Source:ZFIN;Acc:ZDB-GENE-030131-5095])

HSP 1 Score: 65.4698 bits (158), Expect = 2.888e-10
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:   29 EQLMVRTRSVAVNTSDVALSTEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 98          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf609b (zinc finger protein 609b [Source:ZFIN;Acc:ZDB-GENE-030131-5095])

HSP 1 Score: 64.6994 bits (156), Expect = 4.984e-10
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  276 EQLMVRTRSVAVNTSDVALSTEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 345          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf609b (zinc finger protein 609b [Source:ZFIN;Acc:ZDB-GENE-030131-5095])

HSP 1 Score: 64.6994 bits (156), Expect = 4.984e-10
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  276 EQLMVRTRSVAVNTSDVALSTEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 345          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf609a (zinc finger protein 609a [Source:ZFIN;Acc:ZDB-GENE-030131-6219])

HSP 1 Score: 64.6994 bits (156), Expect = 5.446e-10
Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERF 847
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R 
Sbjct:  272 EQIMVRTRSVAVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTRH 342          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:100038177])

HSP 1 Score: 67.3958 bits (163), Expect = 1.174e-10
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            A  E+ ++   SVG+NT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  +
Sbjct:  328 APVEQLLVRTRSVGINTCDVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLDCTK 400          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:100038177])

HSP 1 Score: 67.0106 bits (162), Expect = 1.304e-10
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            A  E+ ++   SVG+NT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  +
Sbjct:  328 APVEQLLVRTRSVGINTCDVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLDCTK 400          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:100038177])

HSP 1 Score: 67.0106 bits (162), Expect = 1.338e-10
Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            A  E+ ++   SVG+NT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++
Sbjct:  328 APVEQLLVRTRSVGINTCDVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLD 397          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: slc25a20l (solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, gene 2 [Source:Xenbase;Acc:XB-GENE-5944561])

HSP 1 Score: 65.4698 bits (158), Expect = 3.891e-10
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SVGVNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  274 EQIMVRTRSVGVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 343          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp608 (zinc finger protein 608 [Source:MGI Symbol;Acc:MGI:2442338])

HSP 1 Score: 67.3958 bits (163), Expect = 8.283e-11
Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++
Sbjct:  337 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLD 406          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp609 (zinc finger protein 609 [Source:MGI Symbol;Acc:MGI:2674092])

HSP 1 Score: 66.2402 bits (160), Expect = 1.874e-10
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SVGVNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  278 EQIMVRTRSVGVNTCDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 347          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q56A10|ZN608_MOUSE (Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.794e-10
Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++
Sbjct:  337 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLD 406          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q9ULD9|ZN608_HUMAN (Zinc finger protein 608 OS=Homo sapiens OX=9606 GN=ZNF608 PE=1 SV=4)

HSP 1 Score: 67.3958 bits (163), Expect = 6.308e-10
Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  626 ADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            A  E+ ++   SVGVNT   G   +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++
Sbjct:  338 APVEQLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLD 407          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|O15014|ZN609_HUMAN (Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 1.245e-9
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SVGVNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  278 EQIMVRTRSVGVNTCDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 347          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q8BZ47|ZN609_MOUSE (Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 1.311e-9
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SVGVNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  278 EQIMVRTRSVGVNTCDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 347          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A3S1C509 (C2H2-type domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_009138 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.175e-11
Identity = 35/63 (55.56%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  659 SVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERF 847
            SV V T S GT  D   LGPC+ GS + LE +V  ET++G+L+V+V WRGKT MG LM+S RF
Sbjct:  398 SVAVETCSIGTVTDPECLGPCEPGSSVRLEGIVWKETENGLLVVNVTWRGKTYMGTLMDSTRF 460          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A267FSC1 (C2H2-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010944g2 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.067e-10
Identity = 49/164 (29.88%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  398 DDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEG---------------MISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            D   G+ LK++       +E H IV P D ++ R L                P  +LEE  ++ T   +   K+SR D   G                  K     NT + GT I+   LGPC +G+ ++L+ +V +ET +G+L+V+V WRG+T +G L++S R
Sbjct:   72 DSDKGLVLKMKIKRKSKNEEKHEIVTP-DMEKYRLLS--------------APSVKLEEADSSATHAPAA--KKSRPDKSSGRHASASSSTGHSGSGSSGKRDAWANTATVGTGIEPDCLGPCDSGTSVSLDGLVWLETDTGVLVVNVTWRGRTYVGTLLDSSR 218          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A267G1W4 (C2H2-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021485g1 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.124e-10
Identity = 49/164 (29.88%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  398 DDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEG---------------MISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            D   G+ LK++       +E H IV P D ++ R L                P  +LEE  ++ T   +   K+SR D   G                  K     NT + GT I+   LGPC +G+ ++L+ +V +ET +G+L+V+V WRG+T +G L++S R
Sbjct:   72 DSDKGLVLKMKIKRKSKNEEKHEIVTP-DMEKYRLLS--------------APSVKLEEADSSATHAPAA--KKSRPDKSSGRHASASSSTGHSGSGSSGKRDAWANTATVGTGIEPDCLGPCDSGTSVSLDGLVWLETDTGVLVVNVTWRGRTYVGTLLDSSR 218          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A267FZQ5 (C2H2-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010944g1 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.128e-10
Identity = 49/164 (29.88%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  398 DDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEG---------------MISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            D   G+ LK++       +E H IV P D ++ R L                P  +LEE  ++ T   +   K+SR D   G                  K     NT + GT I+   LGPC +G+ ++L+ +V +ET +G+L+V+V WRG+T +G L++S R
Sbjct:   72 DSDKGLVLKMKIKRKSKNEEKHEIVTP-DMEKYRLLS--------------APSVKLEEADSSATHAPAA--KKSRPDKSSGRHASASSSTGHSGSGSSGKRDAWANTATVGTGIEPDCLGPCDSGTSVSLDGLVWLETDTGVLVVNVTWRGRTYVGTLLDSSR 218          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A1I8IG65 (C2H2-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.227e-10
Identity = 49/164 (29.88%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  398 DDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEG---------------MISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            D   G+ LK++       +E H IV P D ++ R L                P  +LEE  ++ T   +   K+SR D   G                  K     NT + GT I+   LGPC +G+ ++L+ +V +ET +G+L+V+V WRG+T +G L++S R
Sbjct:  238 DSDKGLVLKMKIKRKSKNEEKHEIVTP-DMEKYRLLS--------------APSVKLEEADSSATHAPAA--KKSRPDKSSGRHASASSSTGHSGSGSSGKRDAWANTATVGTGIEPDCLGPCDSGTSVSLDGLVWLETDTGVLVVNVTWRGRTYVGTLLDSSR 384          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: znf609b (zinc finger protein 609 [Source:NCBI gene;Acc:103027320])

HSP 1 Score: 64.6994 bits (156), Expect = 4.877e-10
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  278 EQLMVRTRSVAVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 347          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: znf609b (zinc finger protein 609 [Source:NCBI gene;Acc:103027320])

HSP 1 Score: 64.6994 bits (156), Expect = 4.892e-10
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:  278 EQLMVRTRSVAVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 347          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: znf609a (zinc finger protein 609 [Source:NCBI gene;Acc:103035716])

HSP 1 Score: 63.929 bits (154), Expect = 7.455e-10
Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERF 847
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R 
Sbjct:  276 EQIMVRTRSVAVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTRH 346          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:103046226])

HSP 1 Score: 60.8474 bits (146), Expect = 6.767e-9
Identity = 39/112 (34.82%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  524 PDSQDLGGFKPK--------TQLEEVSNTVTSDDSLPHKRSRADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            P  QD GG+K K           E      TS  SLP       S +  I   SVG NT      I+   + PCQ G+ + LE +V  ET+ G+L+V+V WR +T +G L++
Sbjct:  217 PVPQDEGGWKEKPCYCGDNGACFEFYKPISTSTVSLPFS---FPSYQLSIKTRSVGTNTQEAERAIESNYMEPCQPGTSVNLEGIVWHETEEGVLVVNVTWRKRTYVGTLLD 325          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:103046226])

HSP 1 Score: 58.9214 bits (141), Expect = 2.725e-8
Identity = 25/63 (39.68%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  647 ISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            I   SVG NT      I+   + PCQ G+ + LE +V  ET+ G+L+V+V WR +T +G L++
Sbjct:  271 IKTRSVGTNTQEAERAIESNYMEPCQPGTSVNLEGIVWHETEEGVLVVNVTWRKRTYVGTLLD 333          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007467.1 (pep scaffold:Pmarinus_7.0:GL476374:282201:323773:-1 gene:ENSPMAG00000006740.1 transcript:ENSPMAT00000007467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.092e-9
Identity = 25/72 (34.72%), Postives = 46/72 (63.89%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERFQ 850
            E+ +I   +VGV+T    +  +   LGPC+ G+ + LE +V  ET++G+L+V+V WR K+ +G L++  + +
Sbjct:  351 EQILIRTRTVGVSTCEAASVTEPDCLGPCEPGTCINLEGIVWHETETGMLVVNVTWRNKSYVGTLLDCTKHE 422          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000521.1 (pep scaffold:Pmarinus_7.0:GL485309:439952:445953:-1 gene:ENSPMAG00000000470.1 transcript:ENSPMAT00000000521.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 5.936e-8
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 2
Query:  689 TEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERF 847
            T  +   LGPC  G+ + LE +V  ET +G+L+V+V WR KT +G L++  + 
Sbjct:   14 TLTEPECLGPCDPGTTVCLEGIVWHETSTGLLVVNVAWRNKTYVGTLLDCTKH 66          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000023485.2 (zinc finger protein 609 [Source:NCBI gene;Acc:101169179])

HSP 1 Score: 65.4698 bits (158), Expect = 2.432e-10
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESER 844
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R
Sbjct:   30 EQIMVRTRSVAVNTAETALATEPDCLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTR 99          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: znf609b (zinc finger protein 609 [Source:NCBI gene;Acc:101166456])

HSP 1 Score: 63.929 bits (154), Expect = 8.559e-10
Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  635 EEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERF 847
            E+ M+   SV VNT       +   LGPC+ G+ + LE +V  ET+ G+L+V+V WR KT +G L++  R 
Sbjct:  281 EQIMVRTRSVAVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDCTRH 351          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:105354812])

HSP 1 Score: 59.6918 bits (143), Expect = 1.554e-8
Identity = 27/63 (42.86%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  659 SVGVNT----VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            SVG NT    VS  +E +   +GPCQ G+ + LE +V  ET+ G+L+V+V WR +T +G L++
Sbjct:  318 SVGTNTQDGGVSGVSEGEPPCIGPCQPGTSVNLEGIVWHETEEGVLVVNVTWRKRTYVGTLLD 380          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ZNF608 (zinc finger protein 608 [Source:NCBI gene;Acc:105354812])

HSP 1 Score: 59.3066 bits (142), Expect = 1.822e-8
Identity = 27/63 (42.86%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  659 SVGVNT----VSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALME 835
            SVG NT    VS  +E +   +GPCQ G+ + LE +V  ET+ G+L+V+V WR +T +G L++
Sbjct:  318 SVGTNTQDGGVSGVSEGEPPCIGPCQPGTSVNLEGIVWHETEEGVLVVNVTWRKRTYVGTLLD 380          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000022714.1 (SMESG000022714.1)

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 781/797 (97.99%), Postives = 781/797 (97.99%), Query Frame = 2
Query:   71 MLMQKHSPXXXXXXXXXXKITENEDVXXXXXXXXXXXFFAGRNASIAGSECNDDKSNDACSSGDESHEQDNAEQENQTSFIDSTNRDQFKLSAXXXXXXXXXXXFSGSQDDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERFQIGTLEKDSIYRREKFMGMNRRNTRRKSKNLFGKKKRKTATPLDPNDVGGTENEAGNSDVDNPYICDKENCHMKFSDFQALRIHIYQSHRNKDNSCVKDEPTVKIESNVVIKSEPTSIGNVYLSPDNPYNPLFKSLRLTDCKPNDLLRSESGLQIAGVRNRPSPLPEVISANHQSEERNSFSPAYSDISDANEAPVLENEAELKLPSAASQPPLNLSLCHTPSIHAANRLFSPTAPALQPEGLCSGPPLSNLRLTHDTKLSHLTAAYGNRYQESSLFTNGYLQLXXXXXXXXXFKPQNGVHSVHSSSG--PLQXXXXXXXASHSDNAVNHNSVNAIQDLSMXX-XXXXXXXXXXXXXXXXXXXXPTTASATPLKYXXXXXXXXXXXKTAP-----NNCINNSKPIPLHQSRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGYLPSNPNSKYPNVVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLPLNGVLTHLPYMSFNTPVNSPPPKFNPSLSLYHQPKY 2437
            MLMQKHSPNNNNNNNNNNKITENEDVNSNSSHSNGGNFFAGRNASIAGSECNDDKSNDACSSGDESHEQDNAEQENQTSFIDSTNRDQFKLSAKKKKKKTVKVKFSGSQDDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERFQIGTLEKDSIYRREKFMGMNRRNTRRKSKNLFGKKKRKTATPLDPNDVGGTENEAGNSDVDNPYICDKENCHMKFSDFQALRIHIYQSHRNKDNSCVKDEPTVKIESNVVIKSEPTSIGNVYLSPDNPYNPLFKSLRLTDCKPNDLLRSESGLQIAGVRNRPSPLPEVISANHQSEERNSFSPAYSDISDANEAPVLENEAELKLPSAASQPPLNLSLCHTPSIHAANRLFSPTAPALQPEGLCSGPPLSNLRLTHDTKLSHLTAAYGNRYQESSLFTNGYLQLSSSNGNNNNFKPQNGVHSVHSSSG  PLQPPPPPPPASHSDNAVNHNSVNAIQDLSMNS        NNNNNSNASSIHNPTTASATPLKYSIHNHSSNNHHKTAP     NNCINNSKP PLHQSRYHSSLHSSSSSHGGSHHTAAPALPSSHAPHSHPPHPHSTSNGYLPSNPNSKYPNVVLSTSTSDNNNSSSHHHHHHQNSNNSSSSISSNQLPLNGVLTHLPYMSFNTPVNSPPPKFNPSLSLYHQPKY
Sbjct:    1 MLMQKHSPNNNNNNNNNNKITENEDVNSNSSHSNGGNFFAGRNASIAGSECNDDKSNDACSSGDESHEQDNAEQENQTSFIDSTNRDQFKLSAKKKKKKTVKVKFSGSQDDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRNKPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERFQIGTLEKDSIYRREKFMGMNRRNTRRKSKNLFGKKKRKTATPLDPNDVGGTENEAGNSDVDNPYICDKENCHMKFSDFQALRIHIYQSHRNKDNSCVKDEPTVKIESNVVIKSEPTSIGNVYLSPDNPYNPLFKSLRLTDCKPNDLLRSESGLQIAGVRNRPSPLPEVISANHQSEERNSFSPAYSDISDANEAPVLENEAELKLPSAASQPPLNLSLCHTPSIHAANRLFSPTAPALQPEGLCSGPPLSNLRLTHDTKLSHLTAAYGNRYQESSLFTNGYLQLSSSNGNNNNFKPQNGVHSVHSSSGPLPLQPPPPPPPASHSDNAVNHNSVNAIQDLSMNSPLFTNKTNNNNNNSNASSIHNPTTASATPLKYSIHNHSSNNHHKTAPNNNNNNNCINNSKPTPLHQSRYHSSLHSSSSSHGGSHHTAAPALPSSHAPHSHPPHPHSTSNGYLPSNPNSKYPNVVLSTSTSDNNNSSSHHHHHHQNSNNSSSSISSNQLPLNGVLTHLPYMSFNTPVNSPPPKFNPSLSLYHQPKY 797          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000036216.1 (SMESG000036216.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.712e-13
Identity = 61/251 (24.30%), Postives = 101/251 (40.24%), Query Frame = 2
Query:  596 DDSLPHKRSRADSEEGMISKVSVGVNTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLMGALMESERFQIG-TLEKDSIYRRE----------------------KFMGMNRRNTRRKS------------KNLFGKKKRKTATPLDPNDVGGTENEAGNSDVD-NPY-----------------------ICD-----------------KENCHMKFSDFQALRIHIYQSHRN 1120
            +D +P KR +   + G      +GVNT +  T  +   LGPC+ G+ + L+ +V +ET SG+L+++V WRG+T +G LM+S +++   +L +++  + E                           N R++RR S            K L  ++        D  +   T + +G+SD D N Y                       +CD                 KENC  +F D  A + HI + H N
Sbjct:   78 EDKIPLKRIKVAEKLGK----EIGVNTSNFSTMTEPEYLGPCEPGTSIELQGIVWLETASGLLVINVTWRGRTYVGTLMDSTKYEFTPSLSQENFGKFEGRPSNRSTRGKKRQVGNLGNHFSLRSKNIRHSRRLSESLNPSNGDGLVKKLSTRQNNNLINYFDSANQSATASGSGDSDTDKNSYSKFSTNSKTRSVTRSITKLNKAALCDFNSNSLEDNDRNLIPCSKENCFKRFVDTTAYKYHIQRCHNN 324          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF6081.313e-1041.43zinc finger protein 608 [Source:HGNC Symbol;Acc:HG... [more]
ZNF6081.808e-1039.73zinc finger protein 608 [Source:HGNC Symbol;Acc:HG... [more]
ZNF6081.949e-1039.73zinc finger protein 608 [Source:HGNC Symbol;Acc:HG... [more]
ZNF6092.593e-1041.43zinc finger protein 609 [Source:HGNC Symbol;Acc:HG... [more]
ZNF6083.411e-1039.73zinc finger protein 608 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sbb3.357e-1046.43gene:FBgn0285917 transcript:FBtr0329997[more]
sbb3.431e-1045.61gene:FBgn0285917 transcript:FBtr0301549[more]
sbb3.528e-1046.43gene:FBgn0285917 transcript:FBtr0301550[more]
sbb3.838e-1046.43gene:FBgn0285917 transcript:FBtr0301551[more]
sbb3.838e-1046.43gene:FBgn0285917 transcript:FBtr0301547[more]
back to top
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
znf609b2.888e-1040.00zinc finger protein 609b [Source:ZFIN;Acc:ZDB-GENE... [more]
znf609b4.984e-1040.00zinc finger protein 609b [Source:ZFIN;Acc:ZDB-GENE... [more]
znf609b4.984e-1040.00zinc finger protein 609b [Source:ZFIN;Acc:ZDB-GENE... [more]
znf609a5.446e-1039.44zinc finger protein 609a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ZNF6081.174e-1038.36zinc finger protein 608 [Source:NCBI gene;Acc:1000... [more]
ZNF6081.304e-1038.36zinc finger protein 608 [Source:NCBI gene;Acc:1000... [more]
ZNF6081.338e-1040.00zinc finger protein 608 [Source:NCBI gene;Acc:1000... [more]
slc25a20l3.891e-1041.43solute carrier family 25 (carnitine/acylcarnitine ... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zfp6088.283e-1141.43zinc finger protein 608 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6091.874e-1041.43zinc finger protein 609 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q56A10|ZN608_MOUSE5.794e-1041.43Zinc finger protein 608 OS=Mus musculus OX=10090 G... [more]
sp|Q9ULD9|ZN608_HUMAN6.308e-1041.43Zinc finger protein 608 OS=Homo sapiens OX=9606 GN... [more]
sp|O15014|ZN609_HUMAN1.245e-941.43Zinc finger protein 609 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8BZ47|ZN609_MOUSE1.311e-941.43Zinc finger protein 609 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Zinc finger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1C5093.175e-1155.56C2H2-type domain-containing protein OS=Elysia chlo... [more]
A0A267FSC11.067e-1029.88C2H2-type domain-containing protein OS=Macrostomum... [more]
A0A267G1W41.124e-1029.88C2H2-type domain-containing protein OS=Macrostomum... [more]
A0A267FZQ51.128e-1029.88C2H2-type domain-containing protein OS=Macrostomum... [more]
A0A1I8IG652.227e-1029.88C2H2-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf609b4.877e-1040.00zinc finger protein 609 [Source:NCBI gene;Acc:1030... [more]
znf609b4.892e-1040.00zinc finger protein 609 [Source:NCBI gene;Acc:1030... [more]
znf609a7.455e-1039.44zinc finger protein 609 [Source:NCBI gene;Acc:1030... [more]
ZNF6086.767e-934.82zinc finger protein 608 [Source:NCBI gene;Acc:1030... [more]
ZNF6082.725e-839.68zinc finger protein 608 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007467.11.092e-934.72pep scaffold:Pmarinus_7.0:GL476374:282201:323773:-... [more]
ENSPMAT00000000521.15.936e-839.62pep scaffold:Pmarinus_7.0:GL485309:439952:445953:-... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000023485.22.432e-1040.00zinc finger protein 609 [Source:NCBI gene;Acc:1011... [more]
znf609b8.559e-1039.44zinc finger protein 609 [Source:NCBI gene;Acc:1011... [more]
ZNF6081.554e-842.86zinc finger protein 608 [Source:NCBI gene;Acc:1053... [more]
ZNF6081.822e-842.86zinc finger protein 608 [Source:NCBI gene;Acc:1053... [more]
back to top
BLAST of Zinc finger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022714.10.000e+097.99SMESG000022714.1[more]
SMESG000036216.11.712e-1324.30SMESG000036216.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027511 ID=SMED30027511|Name=Zinc finger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2748bp
TCTATATAAATCTTATATGAAACATTTTCGTTAAATCGCTTGGAATTTTT
TCAATCTCTATTTGGTAATAATGCTGATGCAAAAACATTCGCCAAACAAT
AACAATAATAACAACAATAATAATAAGATTACCGAAAATGAAGATGTAAA
TTCCAACTCATCTCATTCGAATGGGGGTAATTTCTTTGCCGGCCGAAATG
CTTCTATTGCCGGTTCTGAGTGCAACGATGACAAGTCGAATGATGCTTGT
AGCAGTGGAGATGAATCCCATGAACAGGATAACGCTGAACAGGAGAATCA
GACTTCTTTCATTGACAGCACGAATCGAGATCAGTTTAAGTTGTCAGCGA
AAAAAAAGAAAAAGAAAACCGTCAAAGTGAAATTTTCCGGCAGTCAAGAT
GATAAAGCTGGAATTAAATTGAAAATCCGACGGACAAACAATTTCAATCA
AGATGAAAATCATGTCATTGTCGATCCGGCAGACCAACAGAGAAAGAGGC
ATTTAAAAAACAAACGAAACAAACCCGATTCACAGGATTTGGGGGGATTT
AAACCCAAGACCCAGCTGGAAGAGGTGTCAAACACCGTGACAAGTGACGA
CAGCTTGCCACACAAACGCAGCCGGGCCGATTCAGAGGAAGGAATGATTT
CAAAGGTTTCTGTCGGTGTCAACACAGTTTCCAAAGGCACAGAAATCGAT
GAAACGGTTCTTGGACCATGTCAAGCCGGATCCAAGTTGACTTTGGAAAG
TGTTGTTTTAATGGAAACGAAATCCGGGATATTGATTGTCAGTGTGCAAT
GGCGAGGGAAAACCTTGATGGGAGCTTTAATGGAATCAGAAAGGTTTCAA
ATTGGCACTTTAGAAAAGGACAGCATTTATAGGCGAGAGAAATTCATGGG
AATGAATCGCCGAAATACGAGAAGGAAATCGAAAAATCTTTTCGGTAAAA
AGAAACGCAAAACTGCAACGCCCCTCGATCCGAACGATGTCGGGGGCACG
GAAAACGAAGCTGGAAATAGTGATGTAGATAATCCTTATATTTGTGATAA
AGAAAACTGTCATATGAAATTCTCGGATTTCCAAGCTTTGCGGATCCATA
TTTATCAGAGCCATCGAAACAAAGACAATTCCTGTGTCAAAGACGAGCCA
ACTGTGAAAATCGAATCGAATGTTGTCATAAAATCTGAGCCGACCTCTAT
TGGAAATGTTTACTTGTCGCCAGATAATCCCTACAATCCGCTGTTCAAAT
CTCTCAGGCTGACAGATTGTAAACCAAACGATTTGTTGAGATCAGAATCC
GGCCTTCAAATTGCCGGAGTTAGAAACCGACCAAGCCCGCTTCCGGAAGT
TATCAGCGCAAACCATCAGTCGGAAGAACGCAACAGTTTCAGTCCAGCAT
ACTCCGACATCAGTGACGCTAATGAGGCGCCTGTGCTGGAGAACGAAGCA
GAATTAAAACTTCCATCAGCAGCATCTCAGCCTCCCCTCAACCTGTCTCT
CTGTCACACTCCATCAATCCATGCCGCTAACAGATTATTCTCCCCGACTG
CACCGGCATTGCAGCCAGAAGGTCTCTGCTCAGGACCGCCTTTATCGAAT
TTGCGTTTGACGCACGACACAAAACTGTCGCATTTGACCGCAGCGTATGG
AAATCGTTATCAGGAATCGTCACTGTTTACCAATGGATATCTCCAGTTAT
CATCGAGTAACGGCAACAATAATAATTTCAAACCACAAAATGGGGTTCAC
TCAGTTCATTCATCATCAGGGCCGCTGCAGCCGCCGCCGCCGCCGCCTCC
GGCCTCTCATTCAGACAATGCTGTCAATCACAATTCCGTAAATGCAATCC
AGGATCTCTCAATGAACAGTCCGTTATTCACAAATAAGACCAATAATAAT
AATAATAGCAACGCGAGTAGCATTCACAATCCGACAACCGCCTCAGCCAC
CCCCCTCAAATATTCAATTCACAACCATTCGAGTAATAATCACCACAAAA
CTGCACCGAACAACTGCATCAACAACAGTAAACCGATCCCTCTCCATCAG
TCTCGGTATCACTCCTCACTCCATTCGTCCTCATCCTCACATGGAGGATC
CCATCACACAGCGGCACCGGCACTGCCATCATCTCATGCCCCCCATTCAC
ACCCGCCACATCCGCATTCCACCAGTAATGGCTACCTGCCATCGAATCCG
AATTCCAAATATCCAAACGTCGTATTGTCGACCTCTACATCAGACAACAA
CAACAGCAGCAGTCACCACCACCACCACCACCAGAACAGCAACAACAGCA
GTAGTAGTATCAGTTCCAATCAGTTACCCCTCAATGGGGTCCTCACTCAT
TTGCCCTACATGTCTTTCAATACCCCAGTCAATAGTCCGCCCCCGAAATT
CAACCCGTCTCTGTCTCTCTATCATCAGCCCAAGTATTGAATCTGTAGCT
CTCTCTCTCTCTCTCTCTCTGACGTACCGTATCACATTTGGTCTCTTGTA
GTAAAATAGAAACGAAAAATCGTGTTGTGACAAACCCAGCAAAATTTTCA
GTCGTCTTGTACAAAAGCTTTTATTCGTGGAATACAAATTGAGTTGCGTT
ACTTTCAACAAACCGATCCGTTACGGATCAGCGATTTTACCATTGATTTA
TTCACTACACCCAACACAAGCACGGAACTCGGTTCTTGATCGAGGAGAAA
TCGGTACTTTCATGTTGAAATTTTCTTTGAATAAATTTAATCCTTGTG
back to top

protein sequence of SMED30027511-orf-1

>SMED30027511-orf-1 ID=SMED30027511-orf-1|Name=SMED30027511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=790bp
MLMQKHSPNNNNNNNNNNKITENEDVNSNSSHSNGGNFFAGRNASIAGSE
CNDDKSNDACSSGDESHEQDNAEQENQTSFIDSTNRDQFKLSAKKKKKKT
VKVKFSGSQDDKAGIKLKIRRTNNFNQDENHVIVDPADQQRKRHLKNKRN
KPDSQDLGGFKPKTQLEEVSNTVTSDDSLPHKRSRADSEEGMISKVSVGV
NTVSKGTEIDETVLGPCQAGSKLTLESVVLMETKSGILIVSVQWRGKTLM
GALMESERFQIGTLEKDSIYRREKFMGMNRRNTRRKSKNLFGKKKRKTAT
PLDPNDVGGTENEAGNSDVDNPYICDKENCHMKFSDFQALRIHIYQSHRN
KDNSCVKDEPTVKIESNVVIKSEPTSIGNVYLSPDNPYNPLFKSLRLTDC
KPNDLLRSESGLQIAGVRNRPSPLPEVISANHQSEERNSFSPAYSDISDA
NEAPVLENEAELKLPSAASQPPLNLSLCHTPSIHAANRLFSPTAPALQPE
GLCSGPPLSNLRLTHDTKLSHLTAAYGNRYQESSLFTNGYLQLSSSNGNN
NNFKPQNGVHSVHSSSGPLQPPPPPPPASHSDNAVNHNSVNAIQDLSMNS
PLFTNKTNNNNNSNASSIHNPTTASATPLKYSIHNHSSNNHHKTAPNNCI
NNSKPIPLHQSRYHSSLHSSSSSHGGSHHTAAPALPSSHAPHSHPPHPHS
TSNGYLPSNPNSKYPNVVLSTSTSDNNNSSSHHHHHHQNSNNSSSSISSN
QLPLNGVLTHLPYMSFNTPVNSPPPKFNPSLSLYHQPKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR040010ZN608/ZN609
IPR013087Znf_C2H2_type
IPR010895CHRD
IPR007087Znf_C2H2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 666..686
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 558..582
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 73..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 730..757
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 57..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 127..190
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..315
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 666..711
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 568..582
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..106
IPR040010Zinc finger protein 608/609PANTHERPTHR21564BRAKELESS PROTEINcoord: 9..256
coord: 287..485
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 325..348
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 323..353
score: 8.767