Low-density lipoprotein receptor 1

Overview
NameLow-density lipoprotein receptor 1
Smed IDSMED30027482
Length (bp)2213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low-density lipoprotein receptor 1 (SMED30027482) t-SNE clustered cells

Violin plots show distribution of expression levels for Low-density lipoprotein receptor 1 (SMED30027482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low-density lipoprotein receptor 1 (SMED30027482) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low-density lipoprotein receptor 1 (SMED30027482) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30027482SMESG000049079.1 dd_Smed_v4_8647_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027482SMESG000049079.1 dd_Smed_v4_8647_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027482SMESG000049079.1 SmWIOct06_021848GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Human
Match: KRI1 (KRI1 homolog [Source:HGNC Symbol;Acc:HGNC:25769])

HSP 1 Score: 68.9366 bits (167), Expect = 2.446e-11
Identity = 41/100 (41.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query: 1252 KSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVKE--RKHEVLKSL 1542
            K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE +D R Y ++ +   +K +V KSL
Sbjct:  498 KTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILAADDKELNRWCSLKKTCMYRSEQEELRDKRAYSQKAQNSWKKRQVFKSL 590          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Human
Match: KRI1 (KRI1 homolog [Source:HGNC Symbol;Acc:HGNC:25769])

HSP 1 Score: 68.9366 bits (167), Expect = 2.481e-11
Identity = 41/100 (41.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query: 1252 KSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVKE--RKHEVLKSL 1542
            K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE +D R Y ++ +   +K +V KSL
Sbjct:  504 KTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILAADDKELNRWCSLKKTCMYRSEQEELRDKRAYSQKAQNSWKKRQVFKSL 596          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Celegans
Match: F54C9.9 (pep chromosome:WBcel235:II:8578049:8581513:1 gene:WBGene00010044.1 transcript:F54C9.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F54C9.9)

HSP 1 Score: 72.4034 bits (176), Expect = 7.227e-13
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 1246 KHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE 1515
            K K+F ++  + +    ED+I       GD   RFK+R VE  DFGL T+EIL  + R+LN W SLKK+T  RT  EE  DR  Y+R  E
Sbjct:  505 KEKTFEEYFNEYYALDYEDII-------GDTPTRFKYRDVESNDFGLSTDEILEADERQLNAWASLKKVTAYRTSQEEFFDRKAYQRKAE 587          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Fly
Match: CG5645 (gene:FBgn0036254 transcript:FBtr0076024)

HSP 1 Score: 87.0409 bits (214), Expect = 3.309e-17
Identity = 48/120 (40.00%), Postives = 69/120 (57.50%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVKER--KHEVLKSLYGNGSD 1560
            +IQ     F+ E  K++++++ + +   CED+I       GD  CRFK+      DFGL  EEIL  + +ELNQW SLKK  Q R +  E+K+ R+Y  + K    K ++ KSLYG GSD
Sbjct:  485 MIQAEKPAFNPEDEKTYSEYIDEYYQMDCEDII-------GDQPCRFKYVETTPNDFGLTIEEILLAKNKELNQWASLKKAVQNRPEHVEKKEQRLYKMKAKNEDLKRKIFKSLYGEGSD 597          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Zebrafish
Match: kri1 (KRI1 homolog [Source:NCBI gene;Acc:402800])

HSP 1 Score: 63.929 bits (154), Expect = 4.942e-10
Identity = 42/115 (36.52%), Postives = 63/115 (54.78%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYE---RVKERKHEVLKSLY 1545
            II K+  +FD    KSF  +L + +    ED+I        D+ CRF++R V   DFGL T+EIL    +ELN+W SL+K    R++ EE  D   ++   R  ++K +V  SL+
Sbjct:  493 IISKSKPVFDP-NEKSFEQYLDEYYKLDFEDII-------DDLPCRFRYREVVANDFGLSTDEILNAGDKELNRWCSLRKTCMYRSEREELCDLKNFQIKARNVKKKQQVFVSLF 599          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Xenopus
Match: ndufa4 (NDUFA4, mitochondrial complex associated [Source:Xenbase;Acc:XB-GENE-5863763])

HSP 1 Score: 69.707 bits (169), Expect = 1.204e-11
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE---RKHEVLKSL 1542
            ++ K   +FD    K+F  +L + +    ED+I        D+ CRFK+R V   +FGL TEEIL  E +ELN+W SL+K    R++ EE +D+  Y +  +   +K +VLKSL
Sbjct:  414 VVSKEKPVFDP-GDKTFQQYLDEYYQLDYEDII-------DDLPCRFKYRQVVPCNFGLSTEEILAAEDKELNRWCSLRKTCMYRSEKEEYQDQKAYGQKAQNQWKKLQVLKSL 519          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Xenopus
Match: ndufa4 (NDUFA4, mitochondrial complex associated [Source:Xenbase;Acc:XB-GENE-5863763])

HSP 1 Score: 69.3218 bits (168), Expect = 1.430e-11
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE---RKHEVLKSL 1542
            ++ K   +FD    K+F  +L + +    ED+I        D+ CRFK+R V   +FGL TEEIL  E +ELN+W SL+K    R++ EE +D+  Y +  +   +K +VLKSL
Sbjct:  414 VVSKEKPVFDP-GDKTFQQYLDEYYQLDYEDII-------DDLPCRFKYRQVVPCNFGLSTEEILAAEDKELNRWCSLRKTCMYRSEKEEYQDQKAYGQKAQNQWKKLQVLKSL 519          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Xenopus
Match: ndufa4 (NDUFA4, mitochondrial complex associated [Source:Xenbase;Acc:XB-GENE-5863763])

HSP 1 Score: 69.3218 bits (168), Expect = 1.572e-11
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE---RKHEVLKSL 1542
            ++ K   +FD    K+F  +L + +    ED+I        D+ CRFK+R V   +FGL TEEIL  E +ELN+W SL+K    R++ EE +D+  Y +  +   +K +VLKSL
Sbjct:  476 VVSKEKPVFDP-GDKTFQQYLDEYYQLDYEDII-------DDLPCRFKYRQVVPCNFGLSTEEILAAEDKELNRWCSLRKTCMYRSEKEEYQDQKAYGQKAQNQWKKLQVLKSL 581          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Xenopus
Match: ndufa4 (NDUFA4, mitochondrial complex associated [Source:Xenbase;Acc:XB-GENE-5863763])

HSP 1 Score: 68.9366 bits (167), Expect = 1.867e-11
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE---RKHEVLKSL 1542
            ++ K   +FD    K+F  +L + +    ED+I        D+ CRFK+R V   +FGL TEEIL  E +ELN+W SL+K    R++ EE +D+  Y +  +   +K +VLKSL
Sbjct:  465 VVSKEKPVFDP-GDKTFQQYLDEYYQLDYEDII-------DDLPCRFKYRQVVPCNFGLSTEEILAAEDKELNRWCSLRKTCMYRSEKEEYQDQKAYGQKAQNQWKKLQVLKSL 570          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Xenopus
Match: ndufa4 (NDUFA4, mitochondrial complex associated [Source:Xenbase;Acc:XB-GENE-5863763])

HSP 1 Score: 68.5514 bits (166), Expect = 1.895e-11
Identity = 45/127 (35.43%), Postives = 71/127 (55.91%), Query Frame = 1
Query: 1171 ESANQKIPNKKIGIIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE---RKHEVLKSL 1542
            +S  ++  +K   ++ K   +FD    K+F  +L + +    ED+I        D+ CRFK+R V   +FGL TEEIL  E +ELN+W SL+K    R++ EE +D+  Y +  +   +K +VLKSL
Sbjct:  304 QSGKKRKKSKFAEVVSKEKPVFDP-GDKTFQQYLDEYYQLDYEDII-------DDLPCRFKYRQVVPCNFGLSTEEILAAEDKELNRWCSLRKTCMYRSEKEEYQDQKAYGQKAQNQWKKLQVLKSL 422          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Mouse
Match: Kri1 (KRI1 homolog [Source:MGI Symbol;Acc:MGI:2384899])

HSP 1 Score: 68.1662 bits (165), Expect = 2.526e-11
Identity = 39/100 (39.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query: 1252 KSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEE-EKDRIYYERVKE--RKHEVLKSL 1542
            K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE ++ R+Y ++ +   +K ++ KSL
Sbjct:  383 KTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILSADDKELNRWCSLKKTCMYRSEQEEMQEQRVYSQKAQNMWKKRQIFKSL 475          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Mouse
Match: Kri1 (KRI1 homolog [Source:MGI Symbol;Acc:MGI:2384899])

HSP 1 Score: 67.781 bits (164), Expect = 3.617e-11
Identity = 39/100 (39.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query: 1252 KSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEE-EKDRIYYERVKE--RKHEVLKSL 1542
            K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE ++ R+Y ++ +   +K ++ KSL
Sbjct:  501 KTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILSADDKELNRWCSLKKTCMYRSEQEEMQEQRVYSQKAQNMWKKRQIFKSL 593          
BLAST of Low-density lipoprotein receptor 1 vs. UniProt/SwissProt
Match: sp|Q9VTU0|KRI1_DROME (Protein KRI1 homolog OS=Drosophila melanogaster OX=7227 GN=CG5645 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.317e-16
Identity = 48/120 (40.00%), Postives = 69/120 (57.50%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVKER--KHEVLKSLYGNGSD 1560
            +IQ     F+ E  K++++++ + +   CED+I       GD  CRFK+      DFGL  EEIL  + +ELNQW SLKK  Q R +  E+K+ R+Y  + K    K ++ KSLYG GSD
Sbjct:  485 MIQAEKPAFNPEDEKTYSEYIDEYYQMDCEDII-------GDQPCRFKYVETTPNDFGLTIEEILLAKNKELNQWASLKKAVQNRPEHVEKKEQRLYKMKAKNEDLKRKIFKSLYGEGSD 597          
BLAST of Low-density lipoprotein receptor 1 vs. UniProt/SwissProt
Match: sp|Q0V8M0|KRI1_BOVIN (Protein KRI1 homolog OS=Bos taurus OX=9913 GN=KRI1 PE=2 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 6.785e-11
Identity = 42/107 (39.25%), Postives = 64/107 (59.81%), Query Frame = 1
Query: 1231 IFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVKE--RKHEVLKSL 1542
            +FD    K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE +D R+Y ++ +   +K ++ KSL
Sbjct:  491 VFDP-GDKTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILAADDKELNRWCSLKKTCMYRSEQEELQDKRVYSQKARNVWKKQQIFKSL 589          
BLAST of Low-density lipoprotein receptor 1 vs. UniProt/SwissProt
Match: sp|Q8N9T8|KRI1_HUMAN (Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3)

HSP 1 Score: 68.9366 bits (167), Expect = 1.175e-10
Identity = 41/100 (41.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query: 1252 KSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVKE--RKHEVLKSL 1542
            K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE +D R Y ++ +   +K +V KSL
Sbjct:  498 KTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILAADDKELNRWCSLKKTCMYRSEQEELRDKRAYSQKAQNSWKKRQVFKSL 590          
BLAST of Low-density lipoprotein receptor 1 vs. UniProt/SwissProt
Match: sp|Q8VDQ9|KRI1_MOUSE (Protein KRI1 homolog OS=Mus musculus OX=10090 GN=Kri1 PE=1 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 2.380e-10
Identity = 39/100 (39.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query: 1252 KSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEE-EKDRIYYERVKE--RKHEVLKSL 1542
            K+F ++L + +    ED+I        D+ CRFK+R V   DFGL TEEIL  + +ELN+W SLKK    R++ EE ++ R+Y ++ +   +K ++ KSL
Sbjct:  500 KTFEEYLDEYYRLDYEDII-------DDLPCRFKYRTVVPCDFGLSTEEILSADDKELNRWCSLKKTCMYRSEQEEMQEQRVYSQKAQNMWKKRQIFKSL 592          
BLAST of Low-density lipoprotein receptor 1 vs. UniProt/SwissProt
Match: sp|Q6DRJ4|KRI1_DANRE (Protein KRI1 homolog OS=Danio rerio OX=7955 GN=kri1 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 3.731e-9
Identity = 42/115 (36.52%), Postives = 63/115 (54.78%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYE---RVKERKHEVLKSLY 1545
            II K+  +FD    KSF  +L + +    ED+I        D+ CRF++R V   DFGL T+EIL    +ELN+W SL+K    R++ EE  D   ++   R  ++K +V  SL+
Sbjct:  493 IISKSKPVFDP-NEKSFEQYLDEYYKLDFEDII-------DDLPCRFRYREVVANDFGLSTDEILNAGDKELNRWCSLRKTCMYRSEREELCDLKNFQIKARNVKKKQQVFVSLF 599          
BLAST of Low-density lipoprotein receptor 1 vs. TrEMBL
Match: A0A1I8PYP8 (Kri1_C domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106086441 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.422e-16
Identity = 51/122 (41.80%), Postives = 73/122 (59.84%), Query Frame = 1
Query: 1204 IGIIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVK--ERKHEVLKSLYGNGSD 1560
            + +I+    +FD E  K++ +++ + +   CED+I       GD+ CRFK+      DFGL  EEIL  + +ELNQW SLKK TQIR    E+K+ R+Y  + K  E K ++ KSLYG GSD
Sbjct:  493 MAMIKSEKPVFDPEDEKTYGEYIDEYYQLDCEDII-------GDLPCRFKYVETTPNDFGLTIEEILLAKNKELNQWASLKKATQIRPDHVEKKEQRLYKLKAKNEELKRKIFKSLYGEGSD 607          
BLAST of Low-density lipoprotein receptor 1 vs. TrEMBL
Match: A0A1A9YML3 (Kri1_C domain-containing protein OS=Glossina fuscipes fuscipes OX=201502 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.252e-16
Identity = 50/120 (41.67%), Postives = 73/120 (60.83%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVK--ERKHEVLKSLYGNGSD 1560
            II+    +F+ +  K++ +++ + +   CED+I       GD+ CRFK+ A    DFGL  EEIL  + +ELNQW SLKK  QIR +  E+K+ R+Y  + K  E K ++ KSLYG GSD
Sbjct:  495 IIKAEKPVFNPDDEKTYAEYIDEYYKLDCEDII-------GDVPCRFKYTATTPNDFGLTIEEILLAKNKELNQWASLKKAVQIRPEQLEKKEQRLYKMKAKNMELKRKIFKSLYGEGSD 607          
BLAST of Low-density lipoprotein receptor 1 vs. TrEMBL
Match: A0A0K2U8U0 (Protein KRI1 homolog [Bombus terrestris] OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.984e-16
Identity = 75/238 (31.51%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  856 RKLTEFFQQQDGSMPIDEEKPIFSDLSDDDPIEMDSDQEEIDYDDGXXXXXXXXXXXXDFIGIDKNQEKIDRNQQDIDEEQXXXXXXXXXXXXXXXXXXXFFTNLESANQKIPNKKIGIIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVK---ERKHEVLKSLYGNGSD 1560
            +++ E F+  D ++ +DEEKP+F D+ D D   +++D E  ++DD K +++           +  N E+ D     ++EE+  K    K             + L     K  +K   II+K   IFD++ +K+F ++L + +   CED+I       GD+ CRFK+R V++  FGL+ EEIL    RELN W SLKK  Q R + +E+ D + YE  +   + K ++L SL+ + S+
Sbjct:  377 KRMKEIFKNYDDNV-VDEEKPVFPDIGDSD---IENDLEVENWDDWKPSQEH---------DVQNNDEEGD--SMTVNEEKDDKYTFQKE----------VLSTLGRRKGKRKSKFAEIIEKKKPIFDSKMNKTFENYLNEYYKLDCEDII-------GDLPCRFKYRNVQKNAFGLEVEEILSAPDRELNAWCSLKKTCQYRDERDEKADVVSYENKRSNIQLKEKILPSLFVSNSE 582          
BLAST of Low-density lipoprotein receptor 1 vs. TrEMBL
Match: A0A1B0FAA2 (Kri1_C domain-containing protein OS=Glossina morsitans morsitans OX=37546 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.456e-16
Identity = 49/120 (40.83%), Postives = 73/120 (60.83%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVK--ERKHEVLKSLYGNGSD 1560
            II+    +F+ E  +++ +++ + +   CED+I       GD+ CRFK+      DFGL  EEIL  + +ELNQW SLKK  QIR +  E+K+ R+Y  + K  E K ++ KSLYG+GSD
Sbjct:  495 IIKAEKPVFNPEDEQTYAEYIDEYYKLDCEDII-------GDVPCRFKYTTTTPNDFGLTIEEILLAKNKELNQWASLKKAVQIRPEQLEKKEQRLYKMKAKNMELKRKIFKSLYGDGSD 607          
BLAST of Low-density lipoprotein receptor 1 vs. TrEMBL
Match: A0A1A9ZWL8 (Kri1_C domain-containing protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 9.095e-16
Identity = 49/120 (40.83%), Postives = 72/120 (60.00%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD-RIYYERVK--ERKHEVLKSLYGNGSD 1560
            II+    +F+ E  +++ +++ + +   CED+I       GD+ CRFK+      DFGL  EEIL  + +ELNQW SLKK  QIR +  E+K+ R+Y  + K  E K ++ KSLYG GSD
Sbjct:  495 IIKAEKPVFNPEDEQTYAEYIDEYYKLDCEDII-------GDVPCRFKYTTTTPNDFGLTIEEILLAKNKELNQWASLKKAVQIRPEQLEKKEQRLYKMKAKNMELKRKIFKSLYGEGSD 607          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Cavefish
Match: kri1 (KRI1 homolog [Source:NCBI gene;Acc:103022389])

HSP 1 Score: 65.855 bits (159), Expect = 1.178e-10
Identity = 43/115 (37.39%), Postives = 62/115 (53.91%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYE---RVKERKHEVLKSLY 1545
            II +   +FD    KSF  +L + +    ED+I        D+ CRF++R V   DFGL T+EIL  + +ELN+W SLKK    R++ EE  D   Y+   +   +K +V  SLY
Sbjct:  506 IITQNKPVFDPH-EKSFEQYLDEYYKLDFEDII-------DDLPCRFRYREVVPNDFGLSTDEILAADEKELNRWCSLKKTCMYRSENEELCDVKNYQIKAKNVNKKKQVFTSLY 612          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Nematostella
Match: EDO45163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX9])

HSP 1 Score: 68.1662 bits (165), Expect = 6.181e-12
Identity = 38/97 (39.18%), Postives = 56/97 (57.73%), Query Frame = 1
Query: 1219 KTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERV 1509
            K   +FD    K+F ++  + +    ED+I       GD+ CRFK+R V   D+GL  EE+L    RELNQWVS+KK++Q R+  EE +D   Y ++
Sbjct:  394 KNKPLFDP-NEKTFEEYFDEYYKLDYEDII-------GDMPCRFKYRQVTPNDYGLSAEEVLKFPERELNQWVSVKKMSQYRSTEEEIRDLKKYRKL 482          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Medaka
Match: kri1 (KRI1 homolog [Source:NCBI gene;Acc:402800])

HSP 1 Score: 68.1662 bits (165), Expect = 1.230e-11
Identity = 43/116 (37.07%), Postives = 64/116 (55.17%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVK----ERKHEVLKSLY 1545
            ++ +   +FD  K K+F  +L + +    ED+I        D+ CRF++R V   DFGL TEEIL    +ELN+W SLKK    R++ EE  D   Y ++K     +K E+L S+Y
Sbjct:  144 VVTQKKPVFDP-KEKTFEQYLDEYYKLDYEDII-------DDLPCRFRYRQVVPNDFGLTTEEILSANDKELNRWCSLKKTCMFRSEKEELSDLKNY-KIKAGNERKKKEILSSVY 250          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Medaka
Match: kri1 (KRI1 homolog [Source:NCBI gene;Acc:402800])

HSP 1 Score: 67.781 bits (164), Expect = 1.291e-11
Identity = 43/116 (37.07%), Postives = 64/116 (55.17%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVK----ERKHEVLKSLY 1545
            ++ +   +FD  K K+F  +L + +    ED+I        D+ CRF++R V   DFGL TEEIL    +ELN+W SLKK    R++ EE  D   Y ++K     +K E+L S+Y
Sbjct:  143 VVTQKKPVFDP-KEKTFEQYLDEYYKLDYEDII-------DDLPCRFRYRQVVPNDFGLTTEEILSANDKELNRWCSLKKTCMFRSEKEELSDLKNY-KIKAGNERKKKEILSSVY 249          
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Medaka
Match: kri1 (KRI1 homolog [Source:NCBI gene;Acc:402800])

HSP 1 Score: 63.929 bits (154), Expect = 2.628e-10
Identity = 36/93 (38.71%), Postives = 52/93 (55.91%), Query Frame = 1
Query: 1210 IIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKD 1488
            ++ +   +FD  K K+F  +L + +    ED+I        D+ CRF++R V   DFGL TEEIL    +ELN+W SLKK    R++ EE  D
Sbjct:  241 VVTQKKPVFDP-KEKTFEQYLDEYYKLDYEDII-------DDLPCRFRYRQVVPNDFGLTTEEILSANDKELNRWCSLKKTCMFRSEKEELSD 325          
BLAST of Low-density lipoprotein receptor 1 vs. Planmine SMEST
Match: SMESG000049079.1 (SMESG000049079.1)

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 616/652 (94.48%), Postives = 627/652 (96.17%), Query Frame = 1
Query:   16 MELEINETFTKHYNXXXXXXXXXXXXXXXXXQIKXXXXXXXXXXXXXXXXXYRNQFVNRCDFVLRXXXXXXXXXXXXXXXXXDMVPTKSTETNEKPVYAKDLNRQILLEDGAENYKELIEIENSSKIDSDFIIKQTKSSFVFDVINDDNDEDFLKPSTKPPKFVVKNVIKENSDSESEIHFDNXXXXXXXXXXXXMHIEINRDRKLETVRVSKTTTRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRIKKIVPQAAXXXXXXXXXXXXXXXXVSRKLTEFFQQQDGSMPIDEEKPIFSDLSDDDPIEMDSDQEEIDYDDGXXXXXXXXXXXXDFIGIDKNQEKIDRNQQDIDEEQXXXXXXXXXXXXXXXXXXXFFTNLESANQKIPNKKIGIIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKERKHEVLKSLYGNGSDXXXXXXXXXXXXXXKFSLSXXXXXXXXXXXXXXXVHERLSGSESYENQQISGSQIDTELNEPXXXXXXXXNDSFKGQKKNQKIDFEKSDKIDIGLDEHKKIDSE----------KSVEIKIDSEKSVKIKIDSSEID 1941
            MELEINETFTKHYNKYREREEAAKTKKTLKKQIKEIEEESSSSSDSDSDEIYRNQFVNRCDFVLREFENNKKNALLNKEFFKDM PTKSTE NEKPVYAKDLNRQILLEDGAENYKELIEIENSSKIDSDFIIKQTKSSF FDVINDDNDEDFLKPSTKPPKFVVKN+IKENSDSESEIHFDNEEDEEKKSESSKMHIEINRDRKLETVRVSKTTTRSERRKEKKERKEKELKEKMKKLKEIKQKMLQEKIDRIKKIVPQAADELILDELEEDFDVDEVSRKLTEFFQQQDGSMPIDEEKPIFSDLSDDDPIE+DSDQEEIDYDDGKINKKRKNNKNIDFIGIDKNQEKIDRNQQDIDEEQKPKKNKLKTKKKEEKTKNPFFTNLESANQKIPNKKIGIIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKERKHEVLKSLYGNGSDEEIKTE+EQEGPEEKFSLSKAARKRARKNAKKRRVHERLSGSES ENQQISGSQIDTELNEPKKKKIKF+NDSFKGQKKNQKIDFEKSDKIDIGLDE ++ +++          K    KIDSEKS KI I   E++
Sbjct:    1 MELEINETFTKHYNKYREREEAAKTKKTLKKQIKEIEEESSSSSDSDSDEIYRNQFVNRCDFVLREFENNKKNALLNKEFFKDMEPTKSTENNEKPVYAKDLNRQILLEDGAENYKELIEIENSSKIDSDFIIKQTKSSFEFDVINDDNDEDFLKPSTKPPKFVVKNIIKENSDSESEIHFDNEEDEEKKSESSKMHIEINRDRKLETVRVSKTTTRSERRKEKKERKEKELKEKMKKLKEIKQKMLQEKIDRIKKIVPQAADELILDELEEDFDVDEVSRKLTEFFQQQDGSMPIDEEKPIFSDLSDDDPIEIDSDQEEIDYDDGKINKKRKNNKNIDFIGIDKNQEKIDRNQQDIDEEQKPKKNKLKTKKKEEKTKNPFFTNLESANQKIPNKKIGIIQKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAVEQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKERKHEVLKSLYGNGSDEEIKTEKEQEGPEEKFSLSKAARKRARKNAKKRRVHERLSGSESNENQQISGSQIDTELNEPKKKKIKFENDSFKGQKKNQKIDFEKSDKIDIGLDELEEDETKFEKESLKKSKKKKNQKIDSEKSDKIDIALDELE 652          

HSP 2 Score: 171.014 bits (432), Expect = 5.988e-44
Identity = 120/141 (85.11%), Postives = 122/141 (86.52%), Query Frame = 1
Query: 1807 IDFEKSDKIDIGLDEHKKIDSEKSVEIKIDSEKSVKIKIDSSEIDILSDQITDEKNTSDRNATENQEG--------KKNTANEMANQNDVKIEXXXXXXXXXXXXXXXXXXXXXPYLGKSRLASIQLNEGYYYHALKATHK 2205
            ID EKSDKI+IGLDEHKKIDSEKSV          KIKIDSSEIDI+SDQITDEKNTSDRNATENQEG        KKNTANEMANQNDVKIEKISGDQSKIKKSKKRKNESSIPYLGKSRLASIQLNEGYYYHALKATHK
Sbjct:  747 IDSEKSDKIEIGLDEHKKIDSEKSV----------KIKIDSSEIDIVSDQITDEKNTSDRNATENQEGKKRIKKSKKKNTANEMANQNDVKIEKISGDQSKIKKSKKRKNESSIPYLGKSRLASIQLNEGYYYHALKATHK 877          
The following BLAST results are available for this feature:
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KRI12.446e-1141.00KRI1 homolog [Source:HGNC Symbol;Acc:HGNC:25769][more]
KRI12.481e-1141.00KRI1 homolog [Source:HGNC Symbol;Acc:HGNC:25769][more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F54C9.97.227e-1344.44pep chromosome:WBcel235:II:8578049:8581513:1 gene:... [more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG56453.309e-1740.00gene:FBgn0036254 transcript:FBtr0076024[more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kri14.942e-1036.52KRI1 homolog [Source:NCBI gene;Acc:402800][more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndufa41.204e-1137.72NDUFA4, mitochondrial complex associated [Source:X... [more]
ndufa41.430e-1137.72NDUFA4, mitochondrial complex associated [Source:X... [more]
ndufa41.572e-1137.72NDUFA4, mitochondrial complex associated [Source:X... [more]
ndufa41.867e-1137.72NDUFA4, mitochondrial complex associated [Source:X... [more]
ndufa41.895e-1135.43NDUFA4, mitochondrial complex associated [Source:X... [more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Kri12.526e-1139.00KRI1 homolog [Source:MGI Symbol;Acc:MGI:2384899][more]
Kri13.617e-1139.00KRI1 homolog [Source:MGI Symbol;Acc:MGI:2384899][more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VTU0|KRI1_DROME3.317e-1640.00Protein KRI1 homolog OS=Drosophila melanogaster OX... [more]
sp|Q0V8M0|KRI1_BOVIN6.785e-1139.25Protein KRI1 homolog OS=Bos taurus OX=9913 GN=KRI1... [more]
sp|Q8N9T8|KRI1_HUMAN1.175e-1041.00Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KR... [more]
sp|Q8VDQ9|KRI1_MOUSE2.380e-1039.00Protein KRI1 homolog OS=Mus musculus OX=10090 GN=K... [more]
sp|Q6DRJ4|KRI1_DANRE3.731e-936.52Protein KRI1 homolog OS=Danio rerio OX=7955 GN=kri... [more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8PYP81.422e-1641.80Kri1_C domain-containing protein OS=Stomoxys calci... [more]
A0A1A9YML34.252e-1641.67Kri1_C domain-containing protein OS=Glossina fusci... [more]
A0A0K2U8U05.984e-1631.51Protein KRI1 homolog [Bombus terrestris] OS=Lepeop... [more]
A0A1B0FAA27.456e-1640.83Kri1_C domain-containing protein OS=Glossina morsi... [more]
A0A1A9ZWL89.095e-1640.83Kri1_C domain-containing protein OS=Glossina palli... [more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kri11.178e-1037.39KRI1 homolog [Source:NCBI gene;Acc:103022389][more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO451636.181e-1239.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kri11.230e-1137.07KRI1 homolog [Source:NCBI gene;Acc:402800][more]
kri11.291e-1137.07KRI1 homolog [Source:NCBI gene;Acc:402800][more]
kri12.628e-1038.71KRI1 homolog [Source:NCBI gene;Acc:402800][more]
back to top
BLAST of Low-density lipoprotein receptor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049079.15.988e-4494.48SMESG000049079.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027482 ID=SMED30027482|Name=Low-density lipoprotein receptor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2213bp
TTTTAAGTCTTTACAATGGAATTGGAAATTAATGAAACTTTCACTAAGCA
TTATAATAAATATAGAGAGAGAGAAGAAGCTGCTAAAACCAAAAAGACTT
TAAAAAAACAAATAAAAGAAATTGAAGAAGAATCATCCTCATCTTCTGAT
TCTGATTCTGATGAGATTTATAGGAATCAGTTTGTTAATAGATGCGATTT
TGTATTGCGTGAATTCGAAAATAATAAAAAGAATGCCTTACTAAACAAGG
AATTTTTTAAAGATATGGTACCGACTAAAAGCACTGAAACTAACGAAAAA
CCAGTTTATGCTAAAGATTTAAATAGACAAATCCTATTAGAAGATGGTGC
AGAAAATTATAAAGAATTAATTGAAATTGAAAATTCTTCTAAAATTGACA
GTGATTTCATTATCAAACAAACCAAAAGTTCTTTTGTATTTGATGTTATT
AATGATGACAATGACGAAGATTTCCTTAAACCTTCAACTAAACCGCCAAA
ATTCGTCGTCAAGAATGTTATAAAGGAAAATTCAGATTCAGAATCAGAAA
TCCATTTTGATAATGAAGAAGACGAAGAAAAGAAATCAGAATCGAGTAAA
ATGCATATTGAGATTAACCGAGACAGGAAACTAGAAACTGTCAGAGTGTC
AAAAACGACAACGAGATCAGAAAGAAGGAAAGAGAAAAAAGAACGAAAAG
AAAAAGAATTGAAGGAAAAAATGAAGAAATTAAAAGAAATTAAACAGAAA
ATGCTGCAGGAGAAAATCGATAGGATTAAGAAAATCGTTCCGCAAGCGGC
AGACGAATTGATTTTGGATGAGCTGGAGGAAGATTTCGATGTCGACGAGG
TCAGCAGGAAATTGACGGAATTTTTCCAGCAGCAAGACGGCTCGATGCCG
ATTGATGAAGAAAAACCGATTTTTTCCGACCTCAGTGACGATGATCCCAT
TGAAATGGATTCTGATCAAGAAGAAATCGATTACGATGATGGGAAAATCA
ATAAAAAGCGAAAAAACAATAAAAACATCGATTTTATCGGAATCGATAAA
AATCAAGAAAAAATCGATCGCAATCAACAAGATATTGATGAAGAGCAGAA
ACCAAAGAAAAACAAATTAAAAACAAAGAAAAAAGAAGAAAAGACAAAAA
ATCCATTTTTTACCAATTTGGAATCAGCCAATCAAAAAATCCCGAATAAA
AAAATCGGAATAATTCAGAAAACTGACGAAATCTTCGATGCGGAGAAACA
CAAAAGCTTTACAGATTTCCTGCGGAAGAATTTCGATTATTTCTGCGAGG
ATTTGATCGTTGGCAAGGCGGAAGGAGAGGGGGACATCGCGTGCAGGTTC
AAATTTCGGGCTGTCGAGCAACAGGATTTCGGGCTGGACACGGAGGAGAT
CCTGTTCACGGAACCGAGGGAACTCAATCAGTGGGTTTCACTGAAGAAAA
TCACTCAAATCCGGACGAAGGCCGAAGAAGAGAAAGATCGAATTTACTAC
GAGAGAGTCAAGGAGAGAAAGCACGAAGTTTTGAAAAGTCTCTATGGTAA
TGGATCAGACGAGGAAATTAAAACCGAGGAAGAGCAAGAAGGACCCGAAG
AAAAATTCTCATTATCAAAAGCAGCAAGAAAAAGAGCAAGAAAAAACGCG
AAAAAAAGAAGAGTTCATGAAAGGTTGTCAGGATCAGAATCATATGAGAA
TCAACAAATATCAGGATCACAAATCGATACCGAATTGAATGAGCCGAAGA
AAAAGAAAATTAAATTCAAAAATGATTCTTTTAAAGGACAAAAGAAAAAT
CAAAAAATCGATTTTGAAAAATCGGATAAAATCGATATCGGATTGGATGA
ACATAAAAAAATCGATTCAGAAAAATCTGTTGAAATCAAAATCGATTCAG
AAAAATCTGTGAAAATCAAAATCGATTCATCAGAAATCGATATTCTATCG
GACCAAATAACGGACGAAAAAAACACATCGGATAGAAATGCAACTGAAAA
TCAAGAAGGTAAAAAAAACACGGCAAATGAAATGGCCAATCAAAATGATG
TAAAAATAGAAAAAATTTCAGGTGATCAGAGTAAAATAAAAAAATCGAAA
AAGAGGAAGAATGAGTCGTCGATTCCGTATTTAGGTAAAAGTCGCCTCGC
ATCAATCCAACTTAATGAAGGTTACTATTACCACGCGTTAAAGGCAACAC
ATAAATAATTGTC
back to top

protein sequence of SMED30027482-orf-1

>SMED30027482-orf-1 ID=SMED30027482-orf-1|Name=SMED30027482-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=731bp
MELEINETFTKHYNKYREREEAAKTKKTLKKQIKEIEEESSSSSDSDSDE
IYRNQFVNRCDFVLREFENNKKNALLNKEFFKDMVPTKSTETNEKPVYAK
DLNRQILLEDGAENYKELIEIENSSKIDSDFIIKQTKSSFVFDVINDDND
EDFLKPSTKPPKFVVKNVIKENSDSESEIHFDNEEDEEKKSESSKMHIEI
NRDRKLETVRVSKTTTRSERRKEKKERKEKELKEKMKKLKEIKQKMLQEK
IDRIKKIVPQAADELILDELEEDFDVDEVSRKLTEFFQQQDGSMPIDEEK
PIFSDLSDDDPIEMDSDQEEIDYDDGKINKKRKNNKNIDFIGIDKNQEKI
DRNQQDIDEEQKPKKNKLKTKKKEEKTKNPFFTNLESANQKIPNKKIGII
QKTDEIFDAEKHKSFTDFLRKNFDYFCEDLIVGKAEGEGDIACRFKFRAV
EQQDFGLDTEEILFTEPRELNQWVSLKKITQIRTKAEEEKDRIYYERVKE
RKHEVLKSLYGNGSDEEIKTEEEQEGPEEKFSLSKAARKRARKNAKKRRV
HERLSGSESYENQQISGSQIDTELNEPKKKKIKFKNDSFKGQKKNQKIDF
EKSDKIDIGLDEHKKIDSEKSVEIKIDSEKSVKIKIDSSEIDILSDQITD
EKNTSDRNATENQEGKKNTANEMANQNDVKIEKISGDQSKIKKSKKRKNE
SSIPYLGKSRLASIQLNEGYYYHALKATHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR018034Kri1
IPR024626Kri1-like_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 488..493
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..471
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 109..130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 54..74
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 338..361
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 281..300
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 301..315
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 322..337
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 281..361
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 109..139
IPR024626Kri1-like, C-terminalPFAMPF12936Kri1_Ccoord: 181..266
e-value: 2.9E-18
score: 65.8
IPR018034KRR1 interacting protein 1PANTHERPTHR14490ZINC FINGER, ZZ TYPEcoord: 2..319