N-acetylated-alpha-linked acidic dipeptidase 2

Overview
NameN-acetylated-alpha-linked acidic dipeptidase 2
Smed IDSMED30027481
Length (bp)2370
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-acetylated-alpha-linked acidic dipeptidase 2 (SMED30027481) t-SNE clustered cells

Violin plots show distribution of expression levels for N-acetylated-alpha-linked acidic dipeptidase 2 (SMED30027481) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-acetylated-alpha-linked acidic dipeptidase 2 (SMED30027481) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-acetylated-alpha-linked acidic dipeptidase 2 (SMED30027481) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027481

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30027481SMESG000060624.1 dd_Smed_v4_5864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Human
Match: FOLH1 (folate hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3788])

HSP 1 Score: 261.151 bits (666), Expect = 1.836e-75
Identity = 196/657 (29.83%), Postives = 308/657 (46.88%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDA---GVFGNFKMVSDLQNPELPSLE-----GIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNS-WQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLM------IGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYN---QSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+N +LA+ +++ WK +GL S     Y +  +  N+ +P+ + +   D   +FN +  E        ++ ++P +S++S  G  +G  V++NY    D   L++     C S  I+I R G   R  K+K       K     +++Y DP D+                YPD W LPG     G   N     D   P  P+ E     GI E V   S    IP  PI Y DA KL + M     P+S W+  L       P +  + +  ++++ +++  +   I NVIG + G  + DRYVILG HRD+W  G  DP SG  ++ ++    G   K G +RP RT+LFA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM      +   LKS +  +   S  LY+ W KK P+      PR++ LG G+D   F   LGI S    Y  N      +  P YH+ Y+  +++ K+ DP   +H  V++     +  L+ S ++P+   R   ++LR++ D   K+ SI  +K              L     +F+E  +       DF     +   ++N   MFL R      GLP RP+ R+++ +    N Y G  F G+YD++
Sbjct:   67 HLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINC-SGKIVIARYGKVFRGNKVKNAQLAGAK----GVILYSDPADYFAP---------GVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPS----IPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEG-WRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKS--LYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDC-RDYAVVLRKYAD---KIYSIS-MKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDAL 697          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Human
Match: FOLH1 (folate hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3788])

HSP 1 Score: 261.151 bits (666), Expect = 2.938e-75
Identity = 194/657 (29.53%), Postives = 308/657 (46.88%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSL--------EGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNS-WQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLM------IGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYN---QSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+N +LA+ +++ WK +GL S     Y +  +  N+ +P+ + +   D   +FN +  E        ++ ++P +S++S  G  +G  V++NY    D   L++     C S  I+I R G   R  K+K       K     +++Y DP D+                YPD W LPG     GN   ++   +P  P           GI E V   S    IP  PI Y DA KL + M     P+S W+  L       P +  + +  ++++ +++  +   I NVIG + G  + DRYVILG HRD+W  G  DP SG  ++ ++    G   K G +RP RT+LFA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM      +   LKS +  +   S  LY+ W KK P+      PR++ LG G+D   F   LGI S    Y  N      +  P YH+ Y+  +++ K+ DP   +H  V++     +  L+ S ++P+   R   ++LR++ D   K+ SI  +K              L     +F+E  +       DF     +   ++N   MFL R      GLP RP+ R+++ +    N Y G  F G+YD++
Sbjct:   82 HLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINC-SGKIVIARYGKVFRGNKVKNAQLAGAK----GVILYSDPADYFAP---------GVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPS----IPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEG-WRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKS--LYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDC-RDYAVVLRKYAD---KIYSIS-MKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDAL 712          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Human
Match: NAALAD2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:HGNC Symbol;Acc:HGNC:14526])

HSP 1 Score: 259.225 bits (661), Expect = 1.093e-74
Identity = 212/730 (29.04%), Postives = 340/730 (46.58%), Query Frame = 1
Query:  142 IWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFS-----KMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTN-GPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINS--KKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +W+  L  ++    +G ++G +I       E + S ++      K+ + ++ +  +SFL      +    H AG+E+N  LA+ ++  WK +GL S     Y +  +  N+ N + + +    +  +F  + +E        +  ++P Y+++S  G  +G  V++NY    D   L++ + I+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F       +  P IP  PI YNDA  L +++    P   SW+  L       P +  S +  ++ + V N  +   I NV+G I G  + DRYVILG HRD+W  GA DP SG  +LQ++A   G    +G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K ++ +        S +LY+ WL+K P+  NKN PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++ K+ DP       V++     +  L  S IIP++I    + L         L +  D Q   + + F   S +S +        DF        +N+     + ND          L+ L R F+   GLP + + R+I+ +    N Y G  F G+YD+I
Sbjct:   10 LWM-CLAAALASFLMGFMVGWFI---KPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRS----FTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGK--IVIARYGKIFRGNKVKNAM------LAGAIGIILYSDPADYFA--------PEVQP-YPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKG-WRPRRTIIFASWDAEEFGLLGSTEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSF--DSLFSAVKNFSEAASDFHKRLIQVDLNNPIAVRMMND---------QLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYDAI 702          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Human
Match: NAALAD2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:HGNC Symbol;Acc:HGNC:14526])

HSP 1 Score: 259.225 bits (661), Expect = 1.093e-74
Identity = 212/730 (29.04%), Postives = 340/730 (46.58%), Query Frame = 1
Query:  142 IWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFS-----KMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTN-GPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINS--KKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +W+  L  ++    +G ++G +I       E + S ++      K+ + ++ +  +SFL      +    H AG+E+N  LA+ ++  WK +GL S     Y +  +  N+ N + + +    +  +F  + +E        +  ++P Y+++S  G  +G  V++NY    D   L++ + I+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F       +  P IP  PI YNDA  L +++    P   SW+  L       P +  S +  ++ + V N  +   I NV+G I G  + DRYVILG HRD+W  GA DP SG  +LQ++A   G    +G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K ++ +        S +LY+ WL+K P+  NKN PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++ K+ DP       V++     +  L  S IIP++I    + L         L +  D Q   + + F   S +S +        DF        +N+     + ND          L+ L R F+   GLP + + R+I+ +    N Y G  F G+YD+I
Sbjct:   10 LWM-CLAAALASFLMGFMVGWFI---KPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRS----FTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGK--IVIARYGKIFRGNKVKNAM------LAGAIGIILYSDPADYFA--------PEVQP-YPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKG-WRPRRTIIFASWDAEEFGLLGSTEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSF--DSLFSAVKNFSEAASDFHKRLIQVDLNNPIAVRMMND---------QLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYDAI 702          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Human
Match: NAALAD2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:HGNC Symbol;Acc:HGNC:14526])

HSP 1 Score: 244.202 bits (622), Expect = 1.485e-69
Identity = 206/722 (28.53%), Postives = 329/722 (45.57%), Query Frame = 1
Query:  142 IWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFS-----KMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINS--KKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +W+  L  ++    +G ++G +I       E + S ++      K+ + ++ +  +SFL      +    H AG+E+N  LA+ ++  WK +GL S     Y +  +  N+ N + + +    +  +F  + +E        +  ++P Y+++S  G  +G  V++NY    D   L++ + I+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F       +  P IP  PI YNDA  L +                         ++ + V N  +   I NV+G I G  + DRYVILG HRD+W  GA DP SG  +LQ++A   G    +G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K ++ +        S +LY+ WL+K P+  NKN PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++ K+ DP       V++     +  L  S IIP++I    + L         L +  D Q   + + F   S +S +        DF        +N+     + ND          L+ L R F+   GLP + + R+I+ +    N Y G  F G+YD+I
Sbjct:   10 LWM-CLAAALASFLMGFMVGWFI---KPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRS----FTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGK--IVIARYGKIFRGNKVKNAM------LAGAIGIILYSDPADYFA--------PEVQP-YPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLR-------------------------KVRMHVYNINKITRIYNVVGTIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKG-WRPRRTIIFASWDAEEFGLLGSTEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSF--DSLFSAVKNFSEAASDFHKRLIQVDLNNPIAVRMMND---------QLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYDAI 669          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Celegans
Match: gcp-2.2 (Glutamate CarboxyPeptidase 2 homolog [Source:UniProtKB/TrEMBL;Acc:Q93332])

HSP 1 Score: 221.476 bits (563), Expect = 2.646e-61
Identity = 190/713 (26.65%), Postives = 334/713 (46.84%), Query Frame = 1
Query:  154 ILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDK-IVFNLTTVELNGLL-----PLYS----SYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVN----FSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSA----NNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSST-------TLYQDWLKKMPNSANKN-EPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLV-DLLLRRFKDLQKKLNSIPFI-KQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFN----DFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            ++++++  +A+ II+   I     +  NS       ++ N++  ++   +   L     + H AG+E NL++AE++ +     GL++   ++Y +  +  N   P+I+ +   ++ +VF+ T   ++ +      PL      +YS AG  +G  V++N    SD+  L+ L I     D I + R   + R    +  +K+  K    + LVY DP   A    +  + P+ T  Y ++  +P +    G+  + + D + P  PS+  +F+           + P IP  PI+Y  A  LF+ M    V   +Q  L    +      NN +L V V+ + +E  I N++G I G  + D++V++ NH DAW  GA DP SGT  L +V+  L     +  + P R++LFA+WD EE GLIGS EF  ++   L+ R +A +NMD  I G+ +  G + P +   +  ++ NV   + T       TLY  W    P+  N++  P      GGSDH+PF   LGIP  +       +    P YHT Y+   ++   +DP    H+ ++   I+ +++ + S I+PY ++ L+ D +      L+ +LN    I  +++Y    + Q  LL  T    SE +  ++N+       F     +N+ L+   + F+   G    P  R++L      N Y G   + V+D I
Sbjct:   40 VVLVAVSTVALTIILSNAI--HQSYKSNSKPLPKLSIATNIKQLINVDNIRSNLHSLTKKPHVAGTENNLRVAEMIRDQMITQGLENVHFNEYNVMLSYPNWTTPNIIEILKENRDLVFSTTGRSVSVIKEEQNDPLAEIQWLAYSAAGTVEGDIVYVNNANPSDIEYLESLGIDL--KDKIFLARYSSNYRGNIAQMAVKKGAK----ACLVYSDPKQVA----SLGTGPNET--YGNTDKMPSNTVQMGSVYIGLGDPRTPAFPSIGDLFKEKTEQDLLDEKKIPTIPMLPITYATAQILFENMKGDAVNADFQGKLNVTYRYGPGLINNQKLRVTVHAENEERKIQNIMGYIKGSQEPDKFVLVSNHYDAWTYGAVDPNSGTSTLLEVSRALKQYQNQTGWIPARSILFAHWDAEEYGLIGSTEFAEEYRLQLMRRAVAVINMDL-IGGNQTLLGLSNPTVANVLRSAAANVEQPNPTEMEQGRKTLYDSWKYYAPSKNNRSTHPYQRIPAGGSDHLPFFDYLGIPIVFFITSSLDAPPTYPLYHTIYETPYLIENIMDPGYKVHKAIAGMFIECILKFTESKILPYDLNELMDDSIFEYLPKLEDRLNKTLMIGTKTDYLLDAQKQFKLLQKTVLELSEIV-QRRNVSKLEELPFGSRVDINNRLIEFEKCFINPHGAIGNPQARHVLFHPSPDNWYDGDAISQVHDLI 736          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Celegans
Match: gcp-2.1 (Glutamate carboxypeptidase 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91406])

HSP 1 Score: 216.853 bits (551), Expect = 8.109e-60
Identity = 192/700 (27.43%), Postives = 317/700 (45.29%), Query Frame = 1
Query:  274 LQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNP-SIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGH----------AKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV-SDLQNPELPSLEGIF-----ETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQS------ANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSS-------TTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQ-LVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTAN-------SFSEFINSKKNLFN----DFXXXXXXXXXXXXXPRMFLTREGLPMR-PYLRNILLSTKLKNSYQGSIFTGVYDSIDLY--NGRKVGLTVVLRQ 2238
            +Q+ +    +   L I+  + H AG+E N K+A  + N W   GL+      Y +  +  +  NP S++      K VF    V    ++P   S   AGH          A    V+IN+G  +D   L  + +   G   I + R G   R  K    I +  +      +++ D  D A D   +S N     VYP   W+P +    G+      D  +P  PS + +F     E      +   IP  P+SY    ++ + ++  P P+ WQ  +   L         N  +L + V+++++   I NVIG I G  + D Y++LGNH DAW  G+ DP SGT +L +VA  +       +++P RT++F  WD EE GLIGS EF  +F + L +R + Y+NMDC I+G+ S +    P++   ++++S+ V   S         TLY  W+K  P+      P++   GGGSDH PF    G+P     +K   +    P YHT Y+     +  +D   L  H+ + ++  +     +   I+P +      ++L+ +    K   S   + +S++ D I +Q  LL  +A         F E I+  ++ F+    D   +  +N+ L +  R F+   G+ M  P  R++L S    +SY  S+  GV ++I+ Y  N  K GL  ++ Q
Sbjct:   49 IQDNIKTENIKKYLRIFTKDPHVAGTEANKKVAYEIANAWSEAGLEDVHTLPYEVLLSYPDFENPNSVIIKSSAGKEVFKSKGVS-PVIIPDEQSGKYAGHQWLAYAGNGSASADVVYINHGTANDFKNLKLMGVDIKGK--IALMRYGHGFRGDK----IHKAQQAGAIGAILFSDTQDVAQD-GVESEN-----VYPKKIWMPNEGVQRGSLMHGDGDALSPYYPSKKELFKGRTIEEAKEDGVLPSIPVLPVSYTTGYEILKRLSGRPAPSDWQGFVGGNLTYKLGPGFVNGEKLSINVHSELRTKRIRNVIGYIRGSEEPDSYIMLGNHFDAWVYGSIDPNSGTAVLAEVARAMMQTINETSWKPARTIVFNAWDAEEFGLIGSTEFVEEFVNILQKRAVVYINMDC-IQGNISLHVDTVPILEHAVIEASKQVENPSKRERSRGRKTLYDTWMKVFPDK-KAGVPKIRVPGGGSDHAPFLNFAGVPVINFTFKNYTTWDTYPLYHTMYETPFSNIHLLDTDNLSVHKAIGQYWAELAKTFADDVILPMNTTHFASVMLKTYLPQLKTTISGINVSRSDFED-IRTQYALLSKSAQDLLTMSKKFQETIHFTQHSFSQNPYDPKHVNAVNERLKSTERCFINPRGVSMHNPSARHVLFSVSDSDSYSSSLMAGVQNAINSYDLNPTKKGLREIINQ 732          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Celegans
Match: gcp-2.1 (Glutamate carboxypeptidase 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91406])

HSP 1 Score: 216.853 bits (551), Expect = 1.084e-59
Identity = 192/700 (27.43%), Postives = 317/700 (45.29%), Query Frame = 1
Query:  274 LQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNP-SIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGH----------AKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV-SDLQNPELPSLEGIF-----ETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQS------ANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSS-------TTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQ-LVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTAN-------SFSEFINSKKNLFN----DFXXXXXXXXXXXXXPRMFLTREGLPMR-PYLRNILLSTKLKNSYQGSIFTGVYDSIDLY--NGRKVGLTVVLRQ 2238
            +Q+ +    +   L I+  + H AG+E N K+A  + N W   GL+      Y +  +  +  NP S++      K VF    V    ++P   S   AGH          A    V+IN+G  +D   L  + +   G   I + R G   R  K    I +  +      +++ D  D A D   +S N     VYP   W+P +    G+      D  +P  PS + +F     E      +   IP  P+SY    ++ + ++  P P+ WQ  +   L         N  +L + V+++++   I NVIG I G  + D Y++LGNH DAW  G+ DP SGT +L +VA  +       +++P RT++F  WD EE GLIGS EF  +F + L +R + Y+NMDC I+G+ S +    P++   ++++S+ V   S         TLY  W+K  P+      P++   GGGSDH PF    G+P     +K   +    P YHT Y+     +  +D   L  H+ + ++  +     +   I+P +      ++L+ +    K   S   + +S++ D I +Q  LL  +A         F E I+  ++ F+    D   +  +N+ L +  R F+   G+ M  P  R++L S    +SY  S+  GV ++I+ Y  N  K GL  ++ Q
Sbjct:   68 IQDNIKTENIKKYLRIFTKDPHVAGTEANKKVAYEIANAWSEAGLEDVHTLPYEVLLSYPDFENPNSVIIKSSAGKEVFKSKGVS-PVIIPDEQSGKYAGHQWLAYAGNGSASADVVYINHGTANDFKNLKLMGVDIKGK--IALMRYGHGFRGDK----IHKAQQAGAIGAILFSDTQDVAQD-GVESEN-----VYPKKIWMPNEGVQRGSLMHGDGDALSPYYPSKKELFKGRTIEEAKEDGVLPSIPVLPVSYTTGYEILKRLSGRPAPSDWQGFVGGNLTYKLGPGFVNGEKLSINVHSELRTKRIRNVIGYIRGSEEPDSYIMLGNHFDAWVYGSIDPNSGTAVLAEVARAMMQTINETSWKPARTIVFNAWDAEEFGLIGSTEFVEEFVNILQKRAVVYINMDC-IQGNISLHVDTVPILEHAVIEASKQVENPSKRERSRGRKTLYDTWMKVFPDK-KAGVPKIRVPGGGSDHAPFLNFAGVPVINFTFKNYTTWDTYPLYHTMYETPFSNIHLLDTDNLSVHKAIGQYWAELAKTFADDVILPMNTTHFASVMLKTYLPQLKTTISGINVSRSDFED-IRTQYALLSKSAQDLLTMSKKFQETIHFTQHSFSQNPYDPKHVNAVNERLKSTERCFINPRGVSMHNPSARHVLFSVSDSDSYSSSLMAGVQNAINSYDLNPTKKGLREIINQ 751          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Celegans
Match: gcp-2.1 (Glutamate carboxypeptidase 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91406])

HSP 1 Score: 197.978 bits (502), Expect = 2.079e-54
Identity = 150/514 (29.18%), Postives = 236/514 (45.91%), Query Frame = 1
Query:  274 LQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNP-SIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGH----------AKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV-SDLQNPELPSLEGIF-----ETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQS------ANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSS-------TTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYD 1725
            +Q+ +    +   L I+  + H AG+E N K+A  + N W   GL+      Y +  +  +  NP S++      K VF    V    ++P   S   AGH          A    V+IN+G  +D   L  + +   G   I + R G   R  K    I +  +      +++ D  D A D   +S N     VYP   W+P +    G+      D  +P  PS + +F     E      +   IP  P+SY    ++ + ++  P P+ WQ  +   L         N  +L + V+++++   I NVIG I G  + D Y++LGNH DAW  G+ DP SGT +L +VA  +       +++P RT++F  WD EE GLIGS EF  +F + L +R + Y+NMDC I+G+ S +    P++   ++++S+ V   S         TLY  W+K  P+      P++   GGGSDH PF    G+P     +K   +    P YHT Y+
Sbjct:   49 IQDNIKTENIKKYLRIFTKDPHVAGTEANKKVAYEIANAWSEAGLEDVHTLPYEVLLSYPDFENPNSVIIKSSAGKEVFKSKGVSPV-IIPDEQSGKYAGHQWLAYAGNGSASADVVYINHGTANDFKNLKLMGVDIKGK--IALMRYGHGFRGDK----IHKAQQAGAIGAILFSDTQDVAQD-GVESEN-----VYPKKIWMPNEGVQRGSLMHGDGDALSPYYPSKKELFKGRTIEEAKEDGVLPSIPVLPVSYTTGYEILKRLSGRPAPSDWQGFVGGNLTYKLGPGFVNGEKLSINVHSELRTKRIRNVIGYIRGSEEPDSYIMLGNHFDAWVYGSIDPNSGTAVLAEVARAMMQTINETSWKPARTIVFNAWDAEEFGLIGSTEFVEEFVNILQKRAVVYINMDC-IQGNISLHVDTVPILEHAVIEASKQVENPSKRERSRGRKTLYDTWMKVFPDK-KAGVPKIRVPGGGSDHAPFLNFAGVPVINFTFKNYTTWDTYPLYHTMYE 547          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Celegans
Match: gcp-2.3 (Glutamate CarboxyPeptidase 2 homolog [Source:UniProtKB/TrEMBL;Acc:Q58A98])

HSP 1 Score: 150.984 bits (380), Expect = 9.606e-38
Identity = 152/586 (25.94%), Postives = 264/586 (45.05%), Query Frame = 1
Query:  262 MSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTT--------VELNGLLP--LYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDL--QNPELPS-----LEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSA----NNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGT-FRPF------------RTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPS----AYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRR-FKDLQKKLN 1902
            ++NN++  ++   +   L     + H AG+E NL++AEI+ +     GL++   ++Y +  +  +   P+IV +   +  VF  TT         E N L+    + +YS  G  +G  V++N G   D+  ++ L I     D I++ R   + R    +  +K+  K    + L+Y DP   A           +    P  ++    A  F  F ++     +  ++PS     + G  +  N+S +       PI Y+ A  LF+ M    V   +Q  L    +      NN +L V V+   +E  I NV+G I G  + D++V++GNH DAW  GA DP S T  L +V   L  AY+  T +RP             R++LFA+WD EE GLIGS EF  +  + L+ R +AY+N D  I G+ S    A P ++  +  ++  +   +  T        +P+      P ++F       +     L I      +   + +   L  +P+YHT Y+   ++   +DP+   H+ +   +I+ ++  S S I+PY +  L+D +L   F  +Q+ +N
Sbjct:   46 IANNIRQLINTDKIRSNLHSLTKKAHVAGTENNLRVAEIIRDQMISQGLENVHFNEYNVLLSYPDWTTPNIVEILEENGDVFYKTTGRSISIIEEEQNDLVSEIQWLAYSADGTVEGDIVYVNKGTPKDIEHIESLGIDL--KDKIVLARYSSNFRGNIAQMAVKKGAK----ACLLYSDPMQVA-----------SLGTGPSEFFKIIQAN-FNPFFVIDSTYGRTDKMPSHAVQRVVGWKKDPNYSLL-------PIPYSAAQILFEKMKGDAVIADFQGKLDVTYRYGPGLINNQKLRVTVHAKNEERKIQNVLGYIKGSQEPDKFVLVGNHYDAWTYGAVDPNSVTSTLLEVTRAL-KAYQNLTGWRPVTFTLVLKMGFLTRSILFAHWDAEEYGLIGSTEFAEEHRTQLMRRAVAYINTDM-IGGNQSLLAMANPTVVNVLRAAAAKISHPNPKTF-------LPHKTII--PHIHFTSFQQVAVIICLSLIIWVFRWFSLSHHHWTARLF-IPSYHTIYETPYLIDNILDPEYKMHKAMGEMLIECILNFSESRILPYDLKELMDRVLDEYFPRIQQHIN 594          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Zebrafish
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1025])

HSP 1 Score: 249.595 bits (636), Expect = 2.298e-71
Identity = 197/695 (28.35%), Postives = 318/695 (45.76%), Query Frame = 1
Query:  253 FSKMSNNLQNKVSESFLLDQL-SIYASEI-----------HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRL--WFGDKIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATP----LMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYN---QSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNL---FNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            F++ S+    + S+SFL D L  ++A  I           H AG+++NL LAE + N W  +GL S     Y +  +  N+ NP+ + +    G++I F  +  E        +  ++P YS++S  G  +   V++NYG   D   L++ L I+  G   ILI R G   R  K+K  +    K     ++++ DP D+  +         +   YP  W LPG     GN        D   P  P+ E  + +    ++  P IP  PI ++DA  L Q M     P+SW+  L       P +       ++ + ++ + Q   I NVIG I G  + DRY+ILG HRDAW  G  DPVSG  ++ +     G   K+G +RP RTL+FA+WD EE GL GS E+       L ER +AY+N D  I+G ++     TP    L+     K S         +LY+ W K+  N   K++P ++ LG GSD   +   LGI S    Y  N   +  ++ P YH+ Y+  +++ ++ DP+    + V+R     +  L+ S ++P          +     L    NSI  + +  + + ++   V  D   ++   F  + ++     +       L   ++N   M+L R      GLP RP+ R+I+ +    N Y G  F G+YD++
Sbjct:   30 FARPSSVNHERTSKSFLRDFLDEMHAENIKHHLRKFTRLPHLAGTQQNLNLAEQIRNEWMEFGLDSVELVPYDVLLSYPNKTNPNYISIVDQLGNEI-FKTSLAEPVPEGYEDVADIVPPYSAFSAKGQPEDELVYVNYGRTEDFFKLERELGINCTGK--ILIARYGKIFRGNKVKNAVLAGAK----GIILFSDPADYWAE---------DVEPYPKGWNLPGGGAQRGNVLNLNGAGDPLTPGYPAKEYTYRSSLEDAVGLPKIPVHPIGFHDAVHLLQNMGGPAPPDSWKGALNVSYRIGPGFTDGFRQKKVRMNIHTNNQVTRIYNVIGWIRGAVEPDRYIILGGHRDAWVFGGIDPVSGAAVVHENVRAAGKLMKKG-WRPRRTLIFASWDAEEFGLQGSTEWAEDNARVLQERAVAYINADSAIEGMYTLRVDCTPSLHTLVYDITKKVSSPEEGEEGMSLYESWHKR-DNWPEKDKPWISKLGSGSDFEAYFIRLGIMSGRARYTKNRKTERYSSYPVYHSVYETYEIVERFYDPRFRRLEAVARVRGGLIFSLADSAVLPLD-------CVEYATSLSTYANSIHQLAK-KHPEAMQQYAVSFDSLFSAAENFTVAARDFHQRLDQLDSSNALAVRMVNDQLMYLERAFIDPLGLPGRPFYRHIIFAPSSHNKYAGESFPGIYDAL 698          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Zebrafish
Match: si:ch211-214j8.1 (si:ch211-214j8.1 [Source:ZFIN;Acc:ZDB-GENE-060526-100])

HSP 1 Score: 224.172 bits (570), Expect = 2.963e-62
Identity = 178/585 (30.43%), Postives = 272/585 (46.50%), Query Frame = 1
Query:  175 VLAVGIIIGIY-IPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLD--------QLSIYASEIHQAGSERNLKLAEIMENNWK--IWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPL---------YSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFS-SMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL--------PQYLQSA---------NNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSST-TLYQDWLKKMPNSANKNE---PRVNFL-GGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSR 1788
             L VGI++G + I + +  PE          S ++   + + FL +         L       H A +  +      M   W+    GL S  R  Y++  +  N++NP+ V +   +  V            P          +++YS AG+ KG+ V+ N G +SD  +L++  +   G+  I ITR G   R+ K    I      + G +LVY +P+D     N+   +   T  YP SW+LP      G++ +   DL  P L + E  +       +   PIPTQPI + DA +L   +     P  WQ           P +  ++         + Y +E I N+       ANV+G+I G  + DRYVI GNHRD+W  GA DP SGT ++ ++  +LG   K G +RP R+++F +W  EE GLIGS E+T ++ S L ER +AY+N+D  +  + +    A+P     +  +S+ V    +T ++Y +W++   N  + N    P V FL G GSD+  F + LGI S    Y Y+QS       PAYHT YD  D    YIDP    HQ V+R
Sbjct:   15 ALTVGILLGHFAIEKGSSAPE-----WVRDASQDVDESIIKKFLAELDTNEIKENLRELTKVPHMATTPGDEATVAFMLKRWQDPKTGLDSAWREDYKVYLSFPNKDNPNKVSVVDPENQVLFTAREREKAYKPEQQDPEVVQPFAAYSPAGNVKGKLVYANQGKMSDYELLNR-TLDLRGT--IAITRYGGEGRSKKA---INGAMFGVVG-VLVYTEPYDI----NDGLVSESET--YPHSWYLPPSGVERGSYNIDFGDLLTPYLAAKEDTYRRPKEEITGIPPIPTQPIGFEDAQRLICELDGEDAPAGWQGAFDCTYKLGGPGFKATSSFTNSTVHLDTYNIEKIENS-------ANVMGVIRGSVEPDRYVIYGNHRDSWVHGAIDPSSGTAVMLEITRVLGKMVKEGKWRPRRSIIFGSWGAEEFGLIGSAEYTEEYFSKLSERTVAYINVDISVFANATLRASASPAAQSVLFTASKQVDAPGTTMSVYDNWIRYY-NRTSPNYGIIPNVGFLTGAGSDYAAFIHYLGITSMDISYYYDQSKTRARIYPAYHTAYDTFDYASTYIDPGFTSHQAVAR 573          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Zebrafish
Match: tfr1a (transferrin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-041220-1])

HSP 1 Score: 136.346 bits (342), Expect = 1.411e-32
Identity = 134/553 (24.23%), Postives = 233/553 (42.13%), Query Frame = 1
Query:  229 PENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKS-TARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFSSMQTP----IPTQPISYNDAGKLFQFMTNGPVPNSWQNCL---PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQL------VHHQIVSRFVIDYMIRLS---YSPII 1833
            PE + S  +S +   L+ K++   +      ++S  HQAGS  +  LA  +   +K  G+   T  H  +++   A+ N     R+ F + +V         G    Y +YS     +G  ++ +YG   D   L +  +S   S+ +++ R G    A K    +         ++L+YPDP ++ + +N                       +FG+  +   D   P  PS    F    F   Q+     IP Q I+   A ++   +     P  W + +    QYL    +  + V VNN + +  I NV G+I G+ D DRY+++G  RDAW  G +    GT +L ++A  + D  K   F+P R+++FA+W   E G +G+ E+   + + L  +  +Y+++D  I GS SF   A+PL+   +  + + V   SS T     L +    +N  +  +  +G       F    GIPS    +  N        +     N+D+        L      V   +  R V D++++L+   Y+ II
Sbjct:  119 PEIAVSLDWSDLRALLKRKLTTENINSNFKEFSSLSHQAGSSGDEMLANKIMGKFKTLGMNPWTDEHYVKVHDPGASNN-----RVLFRNNVV---------GTTEGYLAYSAIKTVQGAALYAHYGRAEDFRRLQE--VSADVSEKVVLVRAGLLSYAEK----VANAASLNASAVLIYPDPVNYQIKENT---------------------ALFGHVHLGTGDPYTPGFPS----FNHTQFPPAQSSGLPSIPAQTITTKQASEIMSKLGGRSSPREWSDGMLADTQYLLGDKDDIITVEVNNVLVQKKIHNVFGVIKGYLDADRYLVIGVQRDAWGPGFARSTVGTSLLVELARTITDMIKNDGFKPKRSIVFASWSAGEFGGVGATEWLEGYLNSLNLKMFSYISLDDLISGSDSFKAAASPLLYDLLESTMKQV---SSPTDSTKSLHEQFAGSNWEKSVIEPMGLSHPSYAFQTFSGIPSLSFRFFTNSRFYPFGTFEDTNQNLDLFTSRKTLVLAKAAGEVAGLVTLRLVHDHLLKLNVAKYTTII 623          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Zebrafish
Match: tfr1a (transferrin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-041220-1])

HSP 1 Score: 136.346 bits (342), Expect = 1.411e-32
Identity = 134/553 (24.23%), Postives = 233/553 (42.13%), Query Frame = 1
Query:  229 PENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKS-TARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFSSMQTP----IPTQPISYNDAGKLFQFMTNGPVPNSWQNCL---PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQL------VHHQIVSRFVIDYMIRLS---YSPII 1833
            PE + S  +S +   L+ K++   +      ++S  HQAGS  +  LA  +   +K  G+   T  H  +++   A+ N     R+ F + +V         G    Y +YS     +G  ++ +YG   D   L +  +S   S+ +++ R G    A K    +         ++L+YPDP ++ + +N                       +FG+  +   D   P  PS    F    F   Q+     IP Q I+   A ++   +     P  W + +    QYL    +  + V VNN + +  I NV G+I G+ D DRY+++G  RDAW  G +    GT +L ++A  + D  K   F+P R+++FA+W   E G +G+ E+   + + L  +  +Y+++D  I GS SF   A+PL+   +  + + V   SS T     L +    +N  +  +  +G       F    GIPS    +  N        +     N+D+        L      V   +  R V D++++L+   Y+ II
Sbjct:  119 PEIAVSLDWSDLRALLKRKLTTENINSNFKEFSSLSHQAGSSGDEMLANKIMGKFKTLGMNPWTDEHYVKVHDPGASNN-----RVLFRNNVV---------GTTEGYLAYSAIKTVQGAALYAHYGRAEDFRRLQE--VSADVSEKVVLVRAGLLSYAEK----VANAASLNASAVLIYPDPVNYQIKENT---------------------ALFGHVHLGTGDPYTPGFPS----FNHTQFPPAQSSGLPSIPAQTITTKQASEIMSKLGGRSSPREWSDGMLADTQYLLGDKDDIITVEVNNVLVQKKIHNVFGVIKGYLDADRYLVIGVQRDAWGPGFARSTVGTSLLVELARTITDMIKNDGFKPKRSIVFASWSAGEFGGVGATEWLEGYLNSLNLKMFSYISLDDLISGSDSFKAAASPLLYDLLESTMKQV---SSPTDSTKSLHEQFAGSNWEKSVIEPMGLSHPSYAFQTFSGIPSLSFRFFTNSRFYPFGTFEDTNQNLDLFTSRKTLVLAKAAGEVAGLVTLRLVHDHLLKLNVAKYTTII 623          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Zebrafish
Match: tfr1b (transferrin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-041220-2])

HSP 1 Score: 135.576 bits (340), Expect = 2.051e-32
Identity = 139/617 (22.53%), Postives = 257/617 (41.65%), Query Frame = 1
Query:  166 SIFVLAVGIIIGIYIPRKN----------CFPENSN-------------SYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVS-DLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSD-------------HIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYM-IRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLN 1902
            ++ V  VG++IG  + RK+          C  E                S  +S +   L +K+S   + +QLS+Y+     AGS  + KL + + + +    ++      Y +     + +NP+  ++WFG++ +         G    + +YS  G  +GR V+ NYG  +DL  +    +S  G+  +++ R G    A K+  + K        + L+YPDP D+                  D      D  ++G+  + S D   P  PS          SS    I  Q I  + A K+   M    VP++++     Y     + ++ + +NN + +  I NV G+I G+ D DRYV++G  RD+  +G +    GT +L ++A +  +  K G F+P R+++FA+W   + G +G+ E+   + + L  +   Y+++D  + G  S    A+PL+                 TL Q  L+K+         +   L  GSD               PF    GIPS    +  +++  +   + T  D  + +      Q+V   +++  V   M +RL +  I+   + +   ++    K++   +N
Sbjct:   85 ALLVFLVGLLIGYSVHRKSDNKSELLETPCSKEIQAEEPDPPQYEPIVPSIDWSDIVKLLNDKLSSKSIEEQLSVYSQIGRSAGSSVDNKLGDTIHDAFTKLNMEPWVDEHY-VKLQNPDSSNPN--KVWFGNEEI---------GSPKGFLAYSETGRREGRVVYANYGEPADLQAVQANEVSLNGT--VVLMRAGRISMAQKVMNVAKLGAV----AALIYPDPADY------------------DGM----DTELYGHVHLGSGDPYTPGFPSFNHTQFAPAKSSGLPEILAQTIPASMARKILSKMGGSEVPSNFKGGFTSYKFGDESNKVALSINNKLVDTKIHNVFGVIKGYVDPDRYVVIGAQRDSMTSGYAKSAVGTTLLMELARVFNELKKEG-FKPKRSIVFASWTAGDFGKVGATEWLEGYWASLDRKAFTYISLDGVVSGKDSLRASASPLL----------------HTLLQKTLEKV---------KAPMLSYGSDFSSILTNMQMDDGAYPFLTFSGIPSVSFSFISSRTTPDYKYFGTEMDTKERLDSVTGQQVVELSMLAAQVAGQMALRLVHDQILRLDVTKYGGVIESHVKNIINHVN 635          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Xenopus
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:NCBI gene;Acc:594947])

HSP 1 Score: 265.774 bits (678), Expect = 4.947e-77
Identity = 202/731 (27.63%), Postives = 343/731 (46.92%), Query Frame = 1
Query:  109 TSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIP--RKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQ-------NCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD--FTA-NSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            ++++ C       L I +    +  +GI++G  I    +   P   N  +  ++ + ++ +  + FL D   I     H AG+E+NL+LA+ ++  W  +GL S     Y +  +  N +NP+ + +  G    ++N +  E           ++P Y+++S  G  +G  V++NYG   D   L++ N+    +  I+I R G   R  K+K  +    K     +++Y DP D+          P   P YP  W LP      GN        D   P  P+ E  +       +  P IP  PI Y DA ++ + M   P P +W+       N  P +L++ +  ++ + V+++ +   I +VIG I G  + DRY+ILG HRD+W  G  DP +G  +LQ++A   G   + G +RP RT++FA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM   +   ++ +          +LY+ W +K P+  NK  PR+N LG GSD   +   LGI SA   Y  N+     +N P YHT Y+  +++ +Y DP       V++     +  L+ +P+IP+++    +        L+    SI  + + N S  +E+  V  +  F+A  +F+E  +              L   ++N   MF  R      GLP R + R+++ +    N Y G  F G+YD++
Sbjct:   21 STRRTC-------LLICLTMALLFLLGILVGWVIKPSEERIAPPTQNIRK--ELVSEMKAENIKQFLRDFTKI----PHLAGTEQNLELAKRIQKQWMDFGLDSAKLVHYDVLLSYPNSSNPNYISIIDGHGNEIYNTSLFEPPPTGYENFTDIVPPYNAFSAQGDPEGDLVYVNYGRTEDFFHLER-NMGINCTGKIVIARYGKIFRGNKVKNAMLSGAK----GIILYSDPADYCA--------PGVEP-YPHGWNLPSGGVQRGNVLNLNGAGDPLTPGYPAKEFTYRYEADEGVGLPSIPVHPIGYRDAEEILRLMGGAPPPIAWKGNLDVPYNIGPGFLKNISTGKVRMHVHSNNEVTRIYDVIGTIRGAVEPDRYIILGGHRDSWVFGGIDPTTGAAVLQEIARSFGKKVREG-WRPRRTIIFASWDAEEFGLLGSTEWAEENAKILNERAVAYINSDSAIEGNYTLRVDCTPLMYRLVYNLTKEIASPDQGFEGESLYESWRQKDPSIENKEIPRINKLGSGSDFEAYFQRLGIASARARYTKNRKTDKYSNYPVYHTVYETFELVERYYDPSFKKQLSVAQVRGSLVYELANAPVIPFNVQDYGEA-------LKSYATSIYSLAKRNRSQ-METYGVSFEPLFSAIQNFTEASDGLHQRLEKLDHHNPLAVRIMNDQLMFAERAFTDPLGLPGRQFYRHVIFAPSSHNKYAGESFPGIYDAL 715          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Xenopus
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:NCBI gene;Acc:594947])

HSP 1 Score: 264.233 bits (674), Expect = 5.094e-77
Identity = 189/653 (28.94%), Postives = 312/653 (47.78%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQ-------NCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD--FTA-NSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL+LA+ ++  W  +GL S     Y +  +  N +NP+ + +  G    ++N +  E           ++P Y+++S  G  +G  V++NYG   D   L++ N+    +  I+I R G   R  K+K  +    K     +++Y DP D+          P   P YP  W LP      GN        D   P  P+ E  +       +  P IP  PI Y DA ++ + M   P P +W+       N  P +L++ +  ++ + V+++ +   I +VIG I G  + DRY+ILG HRD+W  G  DP +G  +LQ++A   G   + G +RP RT++FA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM   +   ++ +          +LY+ W +K P+  NK  PR+N LG GSD   +   LGI SA   Y  N+     +N P YHT Y+  +++ +Y DP       V++     +  L+ +P+IP+++    +        L+    SI  + + N S  +E+  V  +  F+A  +F+E  +              L   ++N   MF  R      GLP R + R+++ +    N Y G  F G+YD++
Sbjct:   22 HLAGTEQNLELAKRIQKQWMDFGLDSAKLVHYDVLLSYPNSSNPNYISIIDGHGNEIYNTSLFEPPPTGYENFTDIVPPYNAFSAQGDPEGDLVYVNYGRTEDFFHLER-NMGINCTGKIVIARYGKIFRGNKVKNAMLSGAK----GIILYSDPADYCA--------PGVEP-YPHGWNLPSGGVQRGNVLNLNGAGDPLTPGYPAKEFTYRYEADEGVGLPSIPVHPIGYRDAEEILRLMGGAPPPIAWKGNLDVPYNIGPGFLKNISTGKVRMHVHSNNEVTRIYDVIGTIRGAVEPDRYIILGGHRDSWVFGGIDPTTGAAVLQEIARSFGKKVREG-WRPRRTIIFASWDAEEFGLLGSTEWAEENAKILNERAVAYINSDSAIEGNYTLRVDCTPLMYRLVYNLTKEIASPDQGFEGESLYESWRQKDPSIENKEIPRINKLGSGSDFEAYFQRLGIASARARYTKNRKTDKYSNYPVYHTVYETFELVERYYDPSFKKQLSVAQVRGSLVYELANAPVIPFNVQDYGEA-------LKSYATSIYSLAKRNRSQ-METYGVSFEPLFSAIQNFTEASDGLHQRLEKLDHHNPLAVRIMNDQLMFAERAFTDPLGLPGRQFYRHVIFAPSSHNKYAGESFPGIYDAL 651          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Xenopus
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:NCBI gene;Acc:594947])

HSP 1 Score: 265.003 bits (676), Expect = 5.339e-77
Identity = 189/653 (28.94%), Postives = 312/653 (47.78%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQ-------NCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD--FTA-NSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL+LA+ ++  W  +GL S     Y +  +  N +NP+ + +  G    ++N +  E           ++P Y+++S  G  +G  V++NYG   D   L++ N+    +  I+I R G   R  K+K  +    K     +++Y DP D+          P   P YP  W LP      GN        D   P  P+ E  +       +  P IP  PI Y DA ++ + M   P P +W+       N  P +L++ +  ++ + V+++ +   I +VIG I G  + DRY+ILG HRD+W  G  DP +G  +LQ++A   G   + G +RP RT++FA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM   +   ++ +          +LY+ W +K P+  NK  PR+N LG GSD   +   LGI SA   Y  N+     +N P YHT Y+  +++ +Y DP       V++     +  L+ +P+IP+++    +        L+    SI  + + N S  +E+  V  +  F+A  +F+E  +              L   ++N   MF  R      GLP R + R+++ +    N Y G  F G+YD++
Sbjct:   58 HLAGTEQNLELAKRIQKQWMDFGLDSAKLVHYDVLLSYPNSSNPNYISIIDGHGNEIYNTSLFEPPPTGYENFTDIVPPYNAFSAQGDPEGDLVYVNYGRTEDFFHLER-NMGINCTGKIVIARYGKIFRGNKVKNAMLSGAK----GIILYSDPADYCA--------PGVEP-YPHGWNLPSGGVQRGNVLNLNGAGDPLTPGYPAKEFTYRYEADEGVGLPSIPVHPIGYRDAEEILRLMGGAPPPIAWKGNLDVPYNIGPGFLKNISTGKVRMHVHSNNEVTRIYDVIGTIRGAVEPDRYIILGGHRDSWVFGGIDPTTGAAVLQEIARSFGKKVREG-WRPRRTIIFASWDAEEFGLLGSTEWAEENAKILNERAVAYINSDSAIEGNYTLRVDCTPLMYRLVYNLTKEIASPDQGFEGESLYESWRQKDPSIENKEIPRINKLGSGSDFEAYFQRLGIASARARYTKNRKTDKYSNYPVYHTVYETFELVERYYDPSFKKQLSVAQVRGSLVYELANAPVIPFNVQDYGEA-------LKSYATSIYSLAKRNRSQ-METYGVSFEPLFSAIQNFTEASDGLHQRLEKLDHHNPLAVRIMNDQLMFAERAFTDPLGLPGRQFYRHVIFAPSSHNKYAGESFPGIYDAL 687          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Xenopus
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:NCBI gene;Acc:594947])

HSP 1 Score: 264.618 bits (675), Expect = 7.647e-77
Identity = 189/653 (28.94%), Postives = 312/653 (47.78%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQ-------NCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD--FTA-NSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL+LA+ ++  W  +GL S     Y +  +  N +NP+ + +  G    ++N +  E           ++P Y+++S  G  +G  V++NYG   D   L++ N+    +  I+I R G   R  K+K  +    K     +++Y DP D+          P   P YP  W LP      GN        D   P  P+ E  +       +  P IP  PI Y DA ++ + M   P P +W+       N  P +L++ +  ++ + V+++ +   I +VIG I G  + DRY+ILG HRD+W  G  DP +G  +LQ++A   G   + G +RP RT++FA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM   +   ++ +          +LY+ W +K P+  NK  PR+N LG GSD   +   LGI SA   Y  N+     +N P YHT Y+  +++ +Y DP       V++     +  L+ +P+IP+++    +        L+    SI  + + N S  +E+  V  +  F+A  +F+E  +              L   ++N   MF  R      GLP R + R+++ +    N Y G  F G+YD++
Sbjct:   54 HLAGTEQNLELAKRIQKQWMDFGLDSAKLVHYDVLLSYPNSSNPNYISIIDGHGNEIYNTSLFEPPPTGYENFTDIVPPYNAFSAQGDPEGDLVYVNYGRTEDFFHLER-NMGINCTGKIVIARYGKIFRGNKVKNAMLSGAK----GIILYSDPADYCA--------PGVEP-YPHGWNLPSGGVQRGNVLNLNGAGDPLTPGYPAKEFTYRYEADEGVGLPSIPVHPIGYRDAEEILRLMGGAPPPIAWKGNLDVPYNIGPGFLKNISTGKVRMHVHSNNEVTRIYDVIGTIRGAVEPDRYIILGGHRDSWVFGGIDPTTGAAVLQEIARSFGKKVREG-WRPRRTIIFASWDAEEFGLLGSTEWAEENAKILNERAVAYINSDSAIEGNYTLRVDCTPLMYRLVYNLTKEIASPDQGFEGESLYESWRQKDPSIENKEIPRINKLGSGSDFEAYFQRLGIASARARYTKNRKTDKYSNYPVYHTVYETFELVERYYDPSFKKQLSVAQVRGSLVYELANAPVIPFNVQDYGEA-------LKSYATSIYSLAKRNRSQ-METYGVSFEPLFSAIQNFTEASDGLHQRLEKLDHHNPLAVRIMNDQLMFAERAFTDPLGLPGRQFYRHVIFAPSSHNKYAGESFPGIYDAL 683          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Xenopus
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:NCBI gene;Acc:594947])

HSP 1 Score: 264.618 bits (675), Expect = 1.322e-76
Identity = 189/653 (28.94%), Postives = 312/653 (47.78%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD--FTA-NSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL+LA+ ++  W  +GL S     Y +  +  N +NP+ + +  G    ++N +  E           ++P Y+++S  G  +G  V++NYG   D   L++ N+    +  I+I R G   R  K+K  +    K     +++Y DP D+          P   P YP  W LP      GN        D   P  P+ E  +       +  P IP  PI Y DA ++ + M   P P +W+  L       P +L++ +  ++ + V+++ +   I +VIG I G  + DRY+ILG HRD+W  G  DP +G  +LQ++A   G   + G +RP RT++FA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM   +   ++ +          +LY+ W +K P+  NK  PR+N LG GSD   +   LGI SA   Y  N+     +N P YHT Y+  +++ +Y DP       V++     +  L+ +P+IP+++    +        L+    SI  + + N S  +E+  V  +  F+A  +F+E  +              L   ++N   MF  R      GLP R + R+++ +    N Y G  F G+YD++
Sbjct:   80 HLAGTEQNLELAKRIQKQWMDFGLDSAKLVHYDVLLSYPNSSNPNYISIIDGHGNEIYNTSLFEPPPTGYENFTDIVPPYNAFSAQGDPEGDLVYVNYGRTEDFFHLER-NMGINCTGKIVIARYGKIFRGNKVKNAMLSGAK----GIILYSDPADYCA--------PGVEP-YPHGWNLPSGGVQRGNVLNLNGAGDPLTPGYPAKEFTYRYEADEGVGLPSIPVHPIGYRDAEEILRLMGGAPPPIAWKGNLDVPYNIGPGFLKNISTGKVRMHVHSNNEVTRIYDVIGTIRGAVEPDRYIILGGHRDSWVFGGIDPTTGAAVLQEIARSFGKKVREG-WRPRRTIIFASWDAEEFGLLGSTEWAEENAKILNERAVAYINSDSAIEGNYTLRVDCTPLMYRLVYNLTKEIASPDQGFEGESLYESWRQKDPSIENKEIPRINKLGSGSDFEAYFQRLGIASARARYTKNRKTDKYSNYPVYHTVYETFELVERYYDPSFKKQLSVAQVRGSLVYELANAPVIPFNVQDYGEA-------LKSYATSIYSLAKRNRSQ-METYGVSFEPLFSAIQNFTEASDGLHQRLEKLDHHNPLAVRIMNDQLMFAERAFTDPLGLPGRQFYRHVIFAPSSHNKYAGESFPGIYDAL 709          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Mouse
Match: Naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:MGI Symbol;Acc:MGI:1919810])

HSP 1 Score: 264.618 bits (675), Expect = 8.517e-77
Identity = 198/665 (29.77%), Postives = 312/665 (46.92%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPN-SWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIP----FIKQSNYSDI---IESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL LA+ ++  WK +GL S     Y +  +  N+ N + V +     + +F  + +E        +  ++P Y+++S +G  +G  V++NY    D   L++ +NI+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F      ++  P IP  PI YNDA +L + +     P+ SW+  L       P +  S  +  + + VNN  +   I NVIG I G  + DRYVILG HRD+W  G  DP +GT +LQ++A   G     G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K +  +        S +LY+ WL+K P+  NK  PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++  + DP       V++     +  L+ S +IP++I      L         + +  D Q + +++     F    N+S+       +L  +D         +N ++ L                  R F+   GLP R + R+I+ +    N Y G  F G+YD++
Sbjct:   72 HLAGTEQNLLLAKKIQTQWKKFGLDSANLVHYDVLLSYPNETNANYVSIVDEHGVEIFKTSYLEPPPDGYENVTNIIPPYNAFSASGMPEGELVYVNYARTEDFFKLEREMNINCTGK--IVIARYGKIFRGNKVKNAM------LAGAMGIILYSDPADYFA--------PDVQP-YPKGWNLPGAAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLPVEEAVGIPNIPVHPIGYNDAERLLRNLGGAAPPDKSWKGSLNVSYNIGPGFTGSEYSRNIRMHVNNINKITRIYNVIGTIRGSTEPDRYVILGGHRDSWVFGGIDPTTGTAVLQEIARSFGKLVN-GGWRPRRTIIFASWDAEEFGLLGSTEWAEENAKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFESKSLYESWLEKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAASIFNISKKHDQQLRNHAVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAVRIMNDQQMLLE----------------RAFIDPLGLPGRKFYRHIIFAPSSHNKYAGESFPGIYDAM 702          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Mouse
Match: Naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:MGI Symbol;Acc:MGI:1919810])

HSP 1 Score: 265.003 bits (676), Expect = 1.031e-76
Identity = 198/665 (29.77%), Postives = 312/665 (46.92%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPN-SWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIP----FIKQSNYSDI---IESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL LA+ ++  WK +GL S     Y +  +  N+ N + V +     + +F  + +E        +  ++P Y+++S +G  +G  V++NY    D   L++ +NI+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F      ++  P IP  PI YNDA +L + +     P+ SW+  L       P +  S  +  + + VNN  +   I NVIG I G  + DRYVILG HRD+W  G  DP +GT +LQ++A   G     G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K +  +        S +LY+ WL+K P+  NK  PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++  + DP       V++     +  L+ S +IP++I      L         + +  D Q + +++     F    N+S+       +L  +D         +N ++ L                  R F+   GLP R + R+I+ +    N Y G  F G+YD++
Sbjct:  110 HLAGTEQNLLLAKKIQTQWKKFGLDSANLVHYDVLLSYPNETNANYVSIVDEHGVEIFKTSYLEPPPDGYENVTNIIPPYNAFSASGMPEGELVYVNYARTEDFFKLEREMNINCTGK--IVIARYGKIFRGNKVKNAM------LAGAMGIILYSDPADYFA--------PDVQP-YPKGWNLPGAAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLPVEEAVGIPNIPVHPIGYNDAERLLRNLGGAAPPDKSWKGSLNVSYNIGPGFTGSEYSRNIRMHVNNINKITRIYNVIGTIRGSTEPDRYVILGGHRDSWVFGGIDPTTGTAVLQEIARSFGKLVN-GGWRPRRTIIFASWDAEEFGLLGSTEWAEENAKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFESKSLYESWLEKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAASIFNISKKHDQQLRNHAVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAVRIMNDQQMLLE----------------RAFIDPLGLPGRKFYRHIIFAPSSHNKYAGESFPGIYDAM 740          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Mouse
Match: Naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:MGI Symbol;Acc:MGI:1919810])

HSP 1 Score: 265.003 bits (676), Expect = 1.031e-76
Identity = 198/665 (29.77%), Postives = 312/665 (46.92%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPN-SWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIP----FIKQSNYSDI---IESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL LA+ ++  WK +GL S     Y +  +  N+ N + V +     + +F  + +E        +  ++P Y+++S +G  +G  V++NY    D   L++ +NI+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F      ++  P IP  PI YNDA +L + +     P+ SW+  L       P +  S  +  + + VNN  +   I NVIG I G  + DRYVILG HRD+W  G  DP +GT +LQ++A   G     G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K +  +        S +LY+ WL+K P+  NK  PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++  + DP       V++     +  L+ S +IP++I      L         + +  D Q + +++     F    N+S+       +L  +D         +N ++ L                  R F+   GLP R + R+I+ +    N Y G  F G+YD++
Sbjct:  110 HLAGTEQNLLLAKKIQTQWKKFGLDSANLVHYDVLLSYPNETNANYVSIVDEHGVEIFKTSYLEPPPDGYENVTNIIPPYNAFSASGMPEGELVYVNYARTEDFFKLEREMNINCTGK--IVIARYGKIFRGNKVKNAM------LAGAMGIILYSDPADYFA--------PDVQP-YPKGWNLPGAAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLPVEEAVGIPNIPVHPIGYNDAERLLRNLGGAAPPDKSWKGSLNVSYNIGPGFTGSEYSRNIRMHVNNINKITRIYNVIGTIRGSTEPDRYVILGGHRDSWVFGGIDPTTGTAVLQEIARSFGKLVN-GGWRPRRTIIFASWDAEEFGLLGSTEWAEENAKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFESKSLYESWLEKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAASIFNISKKHDQQLRNHAVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAVRIMNDQQMLLE----------------RAFIDPLGLPGRKFYRHIIFAPSSHNKYAGESFPGIYDAM 740          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Mouse
Match: Naaladl1 (N-acetylated alpha-linked acidic dipeptidase-like 1 [Source:MGI Symbol;Acc:MGI:2685810])

HSP 1 Score: 258.07 bits (658), Expect = 2.400e-74
Identity = 181/576 (31.42%), Postives = 289/576 (50.17%), Query Frame = 1
Query:  268 NNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWK--IWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVF--------NLTTVELN-GLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNF-KMVSDLQNPELPSLEGIFE-TVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSAN---NYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSST--TLYQDWLKKMPNSANKNE--PRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNS 1905
            +++  ++  S + + L   + E H A S R+  L +++   WK    GL S   ++YR+  +  N   P+ V +   +   F        NLT  +    +L  Y++Y+  G  KG  V+ N G   D   L+   I+  G+  I +TR G   R AK         KH    +LVY DP D     N+  S P+ T  +P+SW LP      G++ +   D   P LP+    F    + +S   PIPTQPI + DA  L   +T    P  WQ  L       P +  + +     E++V V+N ++  T +NV+G+I G  + DRYVI GNHRD+W  GA DP SGT +L +++ +LG   K+GT+RP R+++FA+W  EE GLIGS EFT +F S L ER +AY+N+D  +  + +   + TP +   +  +++ +    S+  ++Y +W++    ++      P +  LG GSD+  F + LGI S    Y Y++S  +    P YHT +D  D + K++DP    HQ V+R     ++RLS S  +P ++    + L    +  Q+ L +
Sbjct:   51 DSVMGQLDASRIRENLRELSKEPHVATSPRDEALVQLLLGRWKDTATGLDSAKTYEYRVLLSFPNAEQPNSVEVVGPNGTTFHSFQPFEKNLTGEQAGPNVLQPYAAYAPPGTPKGLLVYANQGSEEDFKELETQGINLEGT--IALTRYGGVGRGAKAI----NAAKHGVVGVLVYTDPGDI----NDGKSLPNET--FPNSWRLPPSGVERGSYYEYFGDPLTPYLPAHPSSFRLDPHNTSGFPPIPTQPIGFEDARDLLCNLTGTSAPAFWQGALGCEYKLGPGFEPNGSFPAGSEVKVSVHNRLELRTSSNVLGIIQGAVEPDRYVIYGNHRDSWVHGAVDPSSGTAVLLEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVAYINVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSSGLSIYDNWIRYTNRTSPVYGLVPSLGTLGAGSDYAAFVHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRLSDSLFLPLNVSDYSETLQSFLQAAQEALGT 614          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Mouse
Match: Folh1 (folate hydrolase 1 [Source:MGI Symbol;Acc:MGI:1858193])

HSP 1 Score: 252.677 bits (644), Expect = 2.012e-72
Identity = 196/725 (27.03%), Postives = 341/725 (47.03%), Query Frame = 1
Query:  145 WLKI--LIISIF-VLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVP--NSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLM------IGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYN---QSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD--FTA-NSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            WL++  L++++     +G + G +I   N   E + +   S M     +++    +   L  +    H AG++ N +LA+ + + WK +GL       Y +  +  N+ +P+ + +   D   +F  +  E        ++ ++P YS++S  G  +G  V++NY    D   L++ + IS  G   I+I R G   R   +K       K     +++Y DP D+ V              YPD W LPG     GN        D   P  P+ E  +     +++  P IP  PI Y+DA KL + M  GP P  +SW+  L       P +  + +  ++++ +++  +   I NVIG + G  + DRYVILG HRDAW  G  DP SG  ++ ++    G   K+G  RP RT+LFA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM      +   L+S +  +     +LY  W +K P+      PR++ LG G+D   F   LGI S    Y  N     +++ P YH+ Y+  ++++K+ DP   +H  V++     +  L+ S ++P+       + L+++ D    ++         +   +++ ++  D  F+A N+F++  +       +      +   ++N   M+L R      GLP RP+ R+I+ +    N Y G  F G+YD++
Sbjct:   20 WLRVGTLVLALTGTFLIGFLFGWFIKPSN---EATGNVSHSGMKKEFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQWKEFGLDLVELSHYDVLLSYPNKTHPNYISIINEDGNEIFKTSLSEQPPPGYENISDVVPPYSAFSPQGTPEGDLVYVNYARTEDFFKLEREMKISCSGK--IVIARYGKVFRGNMVKNAQLAGAK----GMILYSDPADYFVPA---------VKSYPDGWNLPGGGVQRGNVLNLNGAGDPLTPGYPANEHAYRHELTNAVGLPSIPVHPIGYDDAQKLLEHM-GGPAPPDSSWKGGLKVPYNVGPGFAGNFSTQKVKMHIHSYTKVTRIYNVIGTLKGALEPDRYVILGGHRDAWVFGGIDPQSGAAVVHEIVRSFGTLKKKGR-RPRRTILFASWDAEEFGLLGSTEWAEEHSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELQSPDEGF--EGKSLYDSWKEKSPSPEFIGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWKTNKVSSYPLYHSVYETYELVVKFYDPTFKYHLTVAQVRGAMVFELANSIVLPFDCQSYA-VALKKYADTIYNIS-------MKHPQEMKAYMISFDSLFSAVNNFTDVASKFNQRLQELDKSNPILLRIMNDQLMYLERAFIDPLGLPGRPFYRHIIYAPSSHNKYAGESFPGIYDAL 714          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. UniProt/SwissProt
Match: sp|Q9CZR2|NALD2_MOUSE (N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus OX=10090 GN=Naalad2 PE=1 SV=2)

HSP 1 Score: 264.618 bits (675), Expect = 5.957e-76
Identity = 198/665 (29.77%), Postives = 312/665 (46.92%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPN-SWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIP----FIKQSNYSDI---IESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+NL LA+ ++  WK +GL S     Y +  +  N+ N + V +     + +F  + +E        +  ++P Y+++S +G  +G  V++NY    D   L++ +NI+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F      ++  P IP  PI YNDA +L + +     P+ SW+  L       P +  S  +  + + VNN  +   I NVIG I G  + DRYVILG HRD+W  G  DP +GT +LQ++A   G     G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K +  +        S +LY+ WL+K P+  NK  PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++  + DP       V++     +  L+ S +IP++I      L         + +  D Q + +++     F    N+S+       +L  +D         +N ++ L                  R F+   GLP R + R+I+ +    N Y G  F G+YD++
Sbjct:   72 HLAGTEQNLLLAKKIQTQWKKFGLDSANLVHYDVLLSYPNETNANYVSIVDEHGVEIFKTSYLEPPPDGYENVTNIIPPYNAFSASGMPEGELVYVNYARTEDFFKLEREMNINCTGK--IVIARYGKIFRGNKVKNAM------LAGAMGIILYSDPADYFA--------PDVQP-YPKGWNLPGAAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLPVEEAVGIPNIPVHPIGYNDAERLLRNLGGAAPPDKSWKGSLNVSYNIGPGFTGSEYSRNIRMHVNNINKITRIYNVIGTIRGSTEPDRYVILGGHRDSWVFGGIDPTTGTAVLQEIARSFGKLVN-GGWRPRRTIIFASWDAEEFGLLGSTEWAEENAKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFESKSLYESWLEKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAASIFNISKKHDQQLRNHAVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAVRIMNDQQMLLE----------------RAFIDPLGLPGRKFYRHIIFAPSSHNKYAGESFPGIYDAM 702          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. UniProt/SwissProt
Match: sp|Q04609|FOLH1_HUMAN (Glutamate carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=FOLH1 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.411e-74
Identity = 194/657 (29.53%), Postives = 308/657 (46.88%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGD-KIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSL--------EGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNS-WQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLM------IGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYN---QSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTRE-----GLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            H AG+E+N +LA+ +++ WK +GL S     Y +  +  N+ +P+ + +   D   +FN +  E        ++ ++P +S++S  G  +G  V++NY    D   L++     C S  I+I R G   R  K+K       K     +++Y DP D+                YPD W LPG     GN   ++   +P  P           GI E V   S    IP  PI Y DA KL + M     P+S W+  L       P +  + +  ++++ +++  +   I NVIG + G  + DRYVILG HRD+W  G  DP SG  ++ ++    G   K G +RP RT+LFA+WD EE GL+GS E+  +    L ER +AY+N D  I+G+++     TPLM      +   LKS +  +   S  LY+ W KK P+      PR++ LG G+D   F   LGI S    Y  N      +  P YH+ Y+  +++ K+ DP   +H  V++     +  L+ S ++P+   R   ++LR++ D   K+ SI  +K              L     +F+E  +       DF     +   ++N   MFL R      GLP RP+ R+++ +    N Y G  F G+YD++
Sbjct:   82 HLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINC-SGKIVIARYGKVFRGNKVKNAQLAGAK----GVILYSDPADYFAP---------GVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPS----IPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEG-WRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKS--LYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDC-RDYAVVLRKYAD---KIYSIS-MKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDAL 712          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. UniProt/SwissProt
Match: sp|O54697|NALDL_RAT (Aminopeptidase NAALADL1 OS=Rattus norvegicus OX=10116 GN=Naaladl1 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 1.514e-74
Identity = 195/627 (31.10%), Postives = 309/627 (49.28%), Query Frame = 1
Query:  145 WLKILIISI---FVLAVGIIIGIYIPRKNCFPENSNSYQFSKMS----NNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWK--IWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVF--------NLT--TVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNF-KMVSDLQNPELPSLEGIF--ETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSAN---NYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSST--TLYQDWLKKMPNSANKNE--PRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSI 1908
            W KIL + I    +L +GII+G +   K   P  S+      +     +++  ++  S + + L   + E H A S R+  L +++   WK    GL +   ++Y +  +  +   P+ V +   +  VF        NLT    E N L P Y++Y+  G  KG  V+ N G   D   L+   I+  G+  I +TR G   R AK         +H    +LVY DP D     N+  S P+ T  +P+SW LP      G++ +   D   P LP+    F  +  N S    PIPTQPI + DA  L   +     P+SWQ  L       P +  + N     E++V V N ++    +NV+G+I G  + DRYVI GNHRD+W  GA DP SGT +L +++ +LG   K+GT+RP R+++FA+W  EE GLIGS EFT +F S L ER + Y+N+D  +  + +   + TP +   +  +++ +    S+  ++Y +W++    S+      P +  LG GSD+  F + LGI S    Y Y++S  +    P YHT +D  D + K++DP    HQ V+R     ++RLS S  +P ++    + L    +  Q+ L ++
Sbjct:    3 WAKILGVGIGAAALLGLGIILGHFAIPKATEPLASSVSDSQDLDLAILDSVMGQLDASRIRENLRELSKEPHVATSARDEALVQLLLGRWKDSASGLDTAKTYEYTVLLSFPSTEQPNSVEVVGPNGTVFHSFQPFEKNLTGEQAEPNVLQP-YAAYAPPGTPKGPLVYANRGSEDDFKKLEAEGINLKGT--IALTRYGSVGRGAKAIN----AARHGVVGVLVYTDPGDI----NDGKSLPNET--FPNSWGLPPSGVERGSYYEYFGDPLTPYLPAHPVSFRLDPHNISGFP-PIPTQPIGFEDAKNLLCNLNGTSAPDSWQGALGCEYKLGPGFEPNGNFPAGSEVKVSVYNRLELRNSSNVLGIIQGAVEPDRYVIYGNHRDSWVHGAVDPSSGTAVLLEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVTYINVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSSGLSIYDNWIRYTNRSSPVYGLVPSMGTLGAGSDYASFIHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRLSDSLFLPLNVSDYSETLQSFLQAAQENLGAL 615          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. UniProt/SwissProt
Match: sp|Q9Y3Q0|NALD2_HUMAN (N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens OX=9606 GN=NAALAD2 PE=1 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 5.248e-74
Identity = 212/730 (29.04%), Postives = 340/730 (46.58%), Query Frame = 1
Query:  142 IWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFS-----KMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI-VFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSL--LVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTN-GPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN----SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLL---------LRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINS--KKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +W+  L  ++    +G ++G +I       E + S ++      K+ + ++ +  +SFL      +    H AG+E+N  LA+ ++  WK +GL S     Y +  +  N+ N + + +    +  +F  + +E        +  ++P Y+++S  G  +G  V++NY    D   L++ + I+  G   I+I R G   R  K+K  +      L G++  ++Y DP D+          P   P YP  W LPG A   GN        D   P  P+ E  F       +  P IP  PI YNDA  L +++    P   SW+  L       P +  S +  ++ + V N  +   I NV+G I G  + DRYVILG HRD+W  GA DP SG  +LQ++A   G    +G +RP RT++FA+WD EE GL+GS E+  +    L ER IAY+N D  I+G+++     TPL+   + K ++ +        S +LY+ WL+K P+  NKN PR+N LG GSD   +   LGI S    Y  N+     ++ P YHT Y+  +++ K+ DP       V++     +  L  S IIP++I    + L         L +  D Q   + + F   S +S +        DF        +N+     + ND          L+ L R F+   GLP + + R+I+ +    N Y G  F G+YD+I
Sbjct:   10 LWM-CLAAALASFLMGFMVGWFI---KPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRS----FTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGK--IVIARYGKIFRGNKVKNAM------LAGAIGIILYSDPADYFA--------PEVQP-YPKGWNLPGTAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKG-WRPRRTIIFASWDAEEFGLLGSTEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSF--DSLFSAVKNFSEAASDFHKRLIQVDLNNPIAVRMMND---------QLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYDAI 702          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. UniProt/SwissProt
Match: sp|Q7M758|NALDL_MOUSE (Aminopeptidase NAALADL1 OS=Mus musculus OX=10090 GN=Naaladl1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.679e-73
Identity = 181/576 (31.42%), Postives = 289/576 (50.17%), Query Frame = 1
Query:  268 NNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWK--IWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVF--------NLTTVELN-GLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNF-KMVSDLQNPELPSLEGIFE-TVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSAN---NYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSST--TLYQDWLKKMPNSANKNE--PRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNS 1905
            +++  ++  S + + L   + E H A S R+  L +++   WK    GL S   ++YR+  +  N   P+ V +   +   F        NLT  +    +L  Y++Y+  G  KG  V+ N G   D   L+   I+  G+  I +TR G   R AK         KH    +LVY DP D     N+  S P+ T  +P+SW LP      G++ +   D   P LP+    F    + +S   PIPTQPI + DA  L   +T    P  WQ  L       P +  + +     E++V V+N ++  T +NV+G+I G  + DRYVI GNHRD+W  GA DP SGT +L +++ +LG   K+GT+RP R+++FA+W  EE GLIGS EFT +F S L ER +AY+N+D  +  + +   + TP +   +  +++ +    S+  ++Y +W++    ++      P +  LG GSD+  F + LGI S    Y Y++S  +    P YHT +D  D + K++DP    HQ V+R     ++RLS S  +P ++    + L    +  Q+ L +
Sbjct:   51 DSVMGQLDASRIRENLRELSKEPHVATSPRDEALVQLLLGRWKDTATGLDSAKTYEYRVLLSFPNAEQPNSVEVVGPNGTTFHSFQPFEKNLTGEQAGPNVLQPYAAYAPPGTPKGLLVYANQGSEEDFKELETQGINLEGT--IALTRYGGVGRGAKAI----NAAKHGVVGVLVYTDPGDI----NDGKSLPNET--FPNSWRLPPSGVERGSYYEYFGDPLTPYLPAHPSSFRLDPHNTSGFPPIPTQPIGFEDARDLLCNLTGTSAPAFWQGALGCEYKLGPGFEPNGSFPAGSEVKVSVHNRLELRTSSNVLGIIQGAVEPDRYVIYGNHRDSWVHGAVDPSSGTAVLLEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVAYINVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSSGLSIYDNWIRYTNRTSPVYGLVPSLGTLGAGSDYAAFVHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRLSDSLFLPLNVSDYSETLQSFLQAAQEALGT 614          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. TrEMBL
Match: A0A183P8F3 (Peptidase_M28 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10639 PE=4 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 8.741e-111
Identity = 224/656 (34.15%), Postives = 349/656 (53.20%), Query Frame = 1
Query:  253 FSKMSNNLQNKVSESFLLDQL-SIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWF----GDKIVF-----------------NLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLN-------ISYCGSDVILITRLGFSIRAAKMKTIIKRCG---------KHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV----SDLQNPELPSLEGIFETVNF--SSMQTPIPTQPISYNDAGKLFQFMTNGP-VPNSWQNCLPQYLQSANNYELEVIVNNDVQE--VTIANVIGMIPG-----FPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN---SSTTLYQDWLK-KMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDP------QLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRF-KDLQKKLNSIPFIKQSNYS-DIIESQLVLLDFTANSFSEFINSKKNLFNDF 2028
            + ++S NL   VS++FLL+ +  +     H +GS+ N ++A  +E +WK WG     R ++ +   +    N     +      G +++                  N+T    +  LP+Y +YS +G + G FVF+NY    DLL+ DKL           C  +VI+I RLG   R +K+K +++ C           H PG+L++YPDP DFAV          N  VYP    LPGDA VFG+  M      D      PSL  I+ T         T IP QPI Y+DA K+F     GP +P+ W   L  +L  +    L+V+V+N V +  V + NV+G++PG       + D+YVI+GNH DAW  GA DP SG +ILQ++A ILG+AY+ G F+P RT++  +WDGEE  ++GS  F ++   +LL RC+ Y+N DCP+KG  +F+ R   L+I  ++ +++ V ++   +  + Y +WL  KM   +++NEP +  LGGGSDHIPFAY LGIPS YPE+  +  L N P YHT YD ID++ ++ DP          H++++R ++  +I+ + +P +P SI R    LL  + K ++   + IP I + + + D +  ++     ++  F +F N+ +     F
Sbjct:    2 WQEISQNLCKNVSDTFLLEYMHKLCGGNPHCSGSKGNYEIANFIERSWKEWGWPIVDRQEFYVTLPLGPPENGPWNEVLLTNSDGTEVIHRAQNSVTVPSKSEICSQNVTVDNCSNQLPVYQAYSCSGESFGYFVFVNYARRKDLLLFDKLQGRKKGEPSHICNKNVIVIARLGNGTRQSKLKNLMEHCTCGQNNTSLPDHHPGALILYPDPQDFAV----------NGLVYPSGKGLPGDAPVFGHMNMKYAGGGDPTCTGFPSLPHIYRTDTLVRGDALTQIPVQPIGYDDA-KIFLSRLEGPTIPDDWDTRLVTHLGPSTKTCLKVVVHNQVSKNPVRLCNVVGIMPGEMTPTSSESDQYVIMGNHHDAWVQGACDPGSGMVILQEIARILGEAYRNG-FKPRRTIILGSWDGEEFSVLGSTHFVHKSEYELLSRCVVYINSDCPVKGHKTFSARTDSLLIDSLINAAKLVPVDPPINMQSFYDEWLNNKM---SDRNEPVITSLGGGSDHIPFAYRLGIPSTYPEFLPDDGLYNTPVYHTAYDIIDVVERFTDPASPFTGHFPRHRLIARLILTLIIQFACAPRLPLSILRCSQCLLDDWLKFMELVTHQIPNISEYDVNLDWVLEEIQKFKKSSQDFEDFANTMERNCTSF 642          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. TrEMBL
Match: A0A095BTG2 (N-acetylated-alpha-linked acidic dipeptidase 2 OS=Schistosoma haematobium OX=6185 GN=MS3_00248 PE=4 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 2.200e-110
Identity = 227/657 (34.55%), Postives = 352/657 (53.58%), Query Frame = 1
Query:  253 FSKMSNNLQNKVSESFLLDQL-SIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVAN-QNNP-------------------SIVRLWFGDKIVFNLTTVE--LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLN-------ISYCGSDVILITRLGFSIRAAKMKTIIKRCG---------KHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV----SDLQNPELPSLEGIFETVNF--SSMQTPIPTQPISYNDAGKLFQFMTNGP-VPNSWQNCLPQYLQSANNYELEVIVNNDVQE--VTIANVIGMIPG-----FPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN---SSTTLYQDWLK-KMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDP------QLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRF-KDLQKKLNSIPFIKQSNYS-DIIESQLVLLDFTANSFSEFINSKKNLFNDF 2028
            + ++S NL   VS++FLL+ +  +     H +GS+ N ++A  +E +WK WG     R ++ +   +   +N P                   + V +    +I     TV+   +  LP+Y +YS +G + G FVF+NY    DLL+ DKL           C  +VI+I RLG   R +K+K +++ C           H PG+L++YPDP DFAV          N  VYP    LPGDA VFG+  M      D      PSL  I+ T         T IP QPI Y+DA K+F     GP +PN W   L  +L  +    L+V+V+N+V +  V + NV+G++PG       + D+YVI+GNH DAW  GA DP SG +ILQ++A ILG+AY+ G F+P RT++  +WDGEE  ++GS  F ++   +LL RC+ Y+N DCP+KG  +F+ R   L+I  ++ +++ V ++   +  + Y +WL  KM   +++NEP +  LGGGSDHIPFAY LGIPS YPE+  +  L N P YHT YD ID++ ++ DP          H++++R ++  +I+ + +P +P SI R    LL  + K ++   + IP I + + + D +  ++     ++  F +F N+ +     F
Sbjct:    2 WQEISQNLCKNVSDTFLLEYMHKLCGGNPHCSGSKGNYEIANFIERSWKEWGWPVVDRQEFYVTLPLGPPENGPWNEVLLTNSDGTEVIHRAQNSVTVPSKSEICSQNVTVDNSCSNQLPVYQAYSCSGESFGYFVFVNYARRKDLLLFDKLQDRKKGEPSHICNKNVIVIARLGNGTRQSKLKNLMEHCTCGQNNTSLPDHHPGALILYPDPQDFAV----------NDLVYPSGKGLPGDAPVFGHMNMKYAGGGDPTCTGFPSLPHIYRTDTLVQGDALTQIPVQPIGYDDA-KIFLSSLEGPTIPNDWDTRLATHLGPSTKTCLKVVVHNEVSKNPVKLCNVVGIMPGEMTPTSTESDQYVIMGNHHDAWVQGACDPGSGMMILQEIARILGEAYRNG-FKPRRTIILGSWDGEEFSVLGSTHFVHKSEYELLSRCVVYINSDCPVKGHKTFSARTDSLLIDSLINAAKLVPVDPPINMQSFYDEWLNNKM---SDRNEPIITSLGGGSDHIPFAYRLGIPSTYPEFLPDDGLYNTPVYHTAYDIIDVVERFTDPASPFTGHFPRHRLIARLILTLIIQFACAPRLPLSILRCSQCLLDDWLKFMELVTHQIPNISEYDVNLDWVLEEIQKFKKSSQDFEDFANTMERNCTSF 643          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. TrEMBL
Match: A0A430QMF8 (N-acetylated-alpha-linked acidic dipeptidase OS=Schistosoma bovis OX=6184 GN=DC041_0003249 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.796e-109
Identity = 219/620 (35.32%), Postives = 333/620 (53.71%), Query Frame = 1
Query:  253 FSKMSNNLQNKVSESFLLDQL-SIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQN----NPSIVRLWFGDKIVF---NLTTV---------------ELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLN-------ISYCGSDVILITRLGFSIRAAKMKTIIKRCG---------KHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV----SDLQNPELPSLEGIF--ETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGP-VPNSWQNCLPQYLQSANNYELEVIVNNDVQE--VTIANVIGMIPG-----FPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSS---TTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDP------QLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRF-KDLQKKLNSIPFIKQ 1923
            + ++S NL   VS++FLL+ +  +     H +GS  N ++A  +E +WK WG     R ++ +   +        N  ++    G +++    N  TV                 +  LP+Y +YS +G + G FVF+NY    DLL+ DKL           C  +VI+I RLG   R +K+K +++ C           H PG+L++YPDP DFAV          N  VYP    LPGDA VFG+  M      D      PSL  I+  +T+      T IP QPI Y+DA K+F     GP +PN W   L  +L  +    L+V+V+N V +  V + NV+G++PG       + D+YVI+GNH DAW  GA DP SG +ILQ++A ILG+AY+ G F+P RT++  +WDGEE  ++GS  F ++   +LL RC+ Y+N DCP+KG  +F+ R   L+I  ++ +++ V ++      + Y +WL      +++NEP +  LGGGSDHIPFAY LGIPS YPE+  +  L N P YHT YD ID++ ++ DP          H++++R ++  +I+ + +P +P SI R    LL  + K ++   + IP I +
Sbjct:    2 WQEISQNLCKNVSDTFLLEYMHKLCGGNPHCSGSRGNYEIANFIERSWKEWGWPIVDRQEFYVTLPLGPPEDGPWNEVLLTNSDGTEVIHRAQNSVTVPSKPEICSQNVTVDNSCSNQLPVYQAYSCSGESFGYFVFVNYARRKDLLLFDKLQGRKKGEPSHICNKNVIVIARLGNGTRQSKLKNLMEHCTCGQNNTSLPDHHPGALILYPDPQDFAV----------NDLVYPSGKGLPGDAPVFGHMNMKYAGGGDPTCAGFPSLPHIYRIDTLVQGDALTQIPVQPIGYDDA-KIFLSSLEGPTIPNDWDTRLATHLGPSTKTCLKVVVHNQVSKNPVKLCNVVGIMPGEMTPTSTESDQYVIMGNHHDAWVQGACDPGSGMVILQEIARILGEAYRNG-FKPRRTIILGSWDGEEFSVLGSTHFVHKSEYELLSRCVVYINSDCPVKGHKTFSARTDSLLIDSLINAAKLVPVDPPINMQSFYDEWLNN--KISDRNEPVITSLGGGSDHIPFAYRLGIPSTYPEFLPDDGLYNTPVYHTAYDIIDVVERFTDPASPFTGHFPRHRLIARLILTLIIQFACAPRLPLSILRCSQCLLDDWLKFMELVTHQIPNISE 607          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. TrEMBL
Match: G4VIQ5 (NAALADASE L peptidase (M28 family) OS=Schistosoma mansoni OX=6183 GN=Smp_135510 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.790e-106
Identity = 219/652 (33.59%), Postives = 344/652 (52.76%), Query Frame = 1
Query:  253 FSKMSNNLQNKVSESFLLDQLSIYAS-EIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNN--------------------------PSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLN-------ISYCGSDVILITRLGFSIRAAKMKTIIKRCG---------KHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV----SDLQNPELPSLEGIFETVNF--SSMQTPIPTQPISYNDAGKLFQFMTNGP-VPNSWQNCLPQYLQSANNYELEVIVNNDVQE--VTIANVIGMIPG-----FPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN---SSTTLYQDWLK-KMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDP-----QLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRF-KDLQKKLNSIPFIKQSNYS-DIIESQLVLLDFTANSFSEFINS 2004
            + ++S NL   VS++FLL+ +  +     H +GSE N ++A  +E +W  WG     R ++ +   +    N                          PS   +   +  V N  + +L    P+Y +YS +G + G  VF+NY    DLL+ DKL           C  ++I+I RLG   R +K+K +++ C           H PG+L++YPDP DFA D            VYP+   LPGDA VFG+  M      D      PSL  I+ T         T IP QP+ Y+DA K+F     GP +PN W   L  +L  +    L+V+V+N V +  V + N++G++PG       + D+Y+I+GNH D+W  GA DP SG +ILQ++A ILG+AY+ G F+P RT++  +WDGEE  ++GS  F ++   +LL RC+ Y+N DCP+KG  +F+ R   L+I  ++ +++ V ++   +  + Y +WL  KM   +++NEP +  LGGGSDHIPFAY LGIPS YPE+  +  L N P YHT YD ID++ ++ DP      L  H++++R ++  +I+ + +P +P SI R    LL  + K ++   + IP I +   + D +  ++     ++  F +F N+
Sbjct:    2 WQEISQNLCKNVSDTFLLEYMHKFCGGNPHCSGSEGNYEIANFIERSWIEWGWPVVDRQEFYVTLPLGPPENGPWNEVLLTNSDGTEVIHGAQNSVTVPSKSEICSQNVTVDNSDSKQL----PVYQAYSCSGVSFGYLVFVNYARRKDLLLFDKLQGRKKGEPSHICNKNLIVIARLGNGTRQSKLKNLMEHCTCGQNNTSLPDHHPGALILYPDPQDFAAD----------GLVYPNGKGLPGDAPVFGHMNMKYAGGGDSTCTGFPSLPHIYRTDTLVQGDALTQIPVQPVGYDDA-KIFLSSLEGPTIPNDWDTRLATHLGPSTKTCLKVVVHNQVSKNPVKLCNIVGIMPGEITPTSTESDQYIIMGNHHDSWVQGACDPGSGMVILQEIARILGEAYRNG-FKPRRTIILGSWDGEEFSVLGSTHFVHKSEYELLSRCVVYINSDCPVKGHKNFSARTDSLLIDSLINAAKLVPVDPPINMQSFYDEWLNNKM---SDRNEPVITSLGGGSDHIPFAYRLGIPSTYPEFLPDDGLYNTPVYHTAYDIIDVVERFTDPASFTGHLPRHRLITRLILTLIIQFACTPRLPLSILRCSQCLLDDWLKFMELVTHQIPNISEYGVNLDWVLEEIQKFKKSSQDFEDFANT 634          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. TrEMBL
Match: A0A5K4ENR6 (NAALADASE L peptidase (M28 family) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 4.729e-106
Identity = 219/652 (33.59%), Postives = 344/652 (52.76%), Query Frame = 1
Query:  253 FSKMSNNLQNKVSESFLLDQLSIYAS-EIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNN--------------------------PSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLN-------ISYCGSDVILITRLGFSIRAAKMKTIIKRCG---------KHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMV----SDLQNPELPSLEGIFETVNF--SSMQTPIPTQPISYNDAGKLFQFMTNGP-VPNSWQNCLPQYLQSANNYELEVIVNNDVQE--VTIANVIGMIPG-----FPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN---SSTTLYQDWLK-KMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDP-----QLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRF-KDLQKKLNSIPFIKQSNYS-DIIESQLVLLDFTANSFSEFINS 2004
            + ++S NL   VS++FLL+ +  +     H +GSE N ++A  +E +W  WG     R ++ +   +    N                          PS   +   +  V N  + +L    P+Y +YS +G + G  VF+NY    DLL+ DKL           C  ++I+I RLG   R +K+K +++ C           H PG+L++YPDP DFA D            VYP+   LPGDA VFG+  M      D      PSL  I+ T         T IP QP+ Y+DA K+F     GP +PN W   L  +L  +    L+V+V+N V +  V + N++G++PG       + D+Y+I+GNH D+W  GA DP SG +ILQ++A ILG+AY+ G F+P RT++  +WDGEE  ++GS  F ++   +LL RC+ Y+N DCP+KG  +F+ R   L+I  ++ +++ V ++   +  + Y +WL  KM   +++NEP +  LGGGSDHIPFAY LGIPS YPE+  +  L N P YHT YD ID++ ++ DP      L  H++++R ++  +I+ + +P +P SI R    LL  + K ++   + IP I +   + D +  ++     ++  F +F N+
Sbjct:   34 WQEISQNLCKNVSDTFLLEYMHKFCGGNPHCSGSEGNYEIANFIERSWIEWGWPVVDRQEFYVTLPLGPPENGPWNEVLLTNSDGTEVIHGAQNSVTVPSKSEICSQNVTVDNSDSKQL----PVYQAYSCSGVSFGYLVFVNYARRKDLLLFDKLQGRKKGEPSHICNKNLIVIARLGNGTRQSKLKNLMEHCTCGQNNTSLPDHHPGALILYPDPQDFAAD----------GLVYPNGKGLPGDAPVFGHMNMKYAGGGDSTCTGFPSLPHIYRTDTLVQGDALTQIPVQPVGYDDA-KIFLSSLEGPTIPNDWDTRLATHLGPSTKTCLKVVVHNQVSKNPVKLCNIVGIMPGEITPTSTESDQYIIMGNHHDSWVQGACDPGSGMVILQEIARILGEAYRNG-FKPRRTIILGSWDGEEFSVLGSTHFVHKSEYELLSRCVVYINSDCPVKGHKNFSARTDSLLIDSLINAAKLVPVDPPINMQSFYDEWLNNKM---SDRNEPVITSLGGGSDHIPFAYRLGIPSTYPEFLPDDGLYNTPVYHTAYDIIDVVERFTDPASFTGHLPRHRLITRLILTLIIQFACTPRLPLSILRCSQCLLDDWLKFMELVTHQIPNISEYGVNLDWVLEEIQKFKKSSQDFEDFANT 666          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Cavefish
Match: naalad2 (N-acetylated alpha-linked acidic dipeptidase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1025])

HSP 1 Score: 253.832 bits (647), Expect = 2.089e-73
Identity = 196/680 (28.82%), Postives = 315/680 (46.32%), Query Frame = 1
Query:  250 QFSKMSNNLQNKVSESF---LLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRL--WFGDKIVFNLTTVE--------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGN---FKMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWI----NSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSL---ANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNL-FNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            Q  +  + LQN + E     +   L  +    H AG+++NL+LA+ + + W  +GL S     Y +  +  N + P+ + +    GD+ VFN +  E        +  ++P YS++S  G  +G  V++NYG   D   L++ + I+  G   I+I R G   R  K+K  +    K     +++Y DP D+  +             YP  W LPG     GN        D   P  P+ E  + +     +  P IP  PI Y+DA  L + M     P  W   L       P +    +   + +   N+V    I NVIG I G  + DRY+ILG HRDAW  G  DPVSG  ++ + A   G   ++G +RP RT++FA+WD EE GL+GS E+       L ER +AY+N D  I+G ++     TP +   +   ++ V          TLY+ W K+   + +++ PR++ LG GSD   +   LGI S    Y  N+     ++ P YH+ Y+  +++ ++ DP     + V R     + RL+   IIP   +     L +    +++     P   Q  YS   ++    +    ++ + F +  K L   D L +R +ND L+ L R F+   GLP RP+ R+++ +    N Y G  F GVYD++
Sbjct:    2 QHHEKPDYLQNFLKEIHADNIKQHLRKFTRLPHLAGTQQNLRLAKQIRDEWLAYGLDSAELVWYDVLLSYPNGSRPNYISIVDQHGDE-VFNSSLSEPVPEGYEHVTDIVPPYSAFSSQGQPEGDLVYVNYGRTEDFFKLEREMGINCTGK--IVIARYGKIFRGNKVKNAMLAGAK----GIVMYSDPADYCAE---------GVEPYPAGWNLPGGGAQRGNVLNLNGAGDPLTPGYPAKEYTYRSSLEEGVGLPKIPVHPIGYHDALHLLKNMGGASPPAGWTGALNVSYRIGPGFTNDFHKVRMNIHTYNEV--TRIYNVIGKIRGAQEPDRYIILGGHRDAWVFGGIDPVSGAAVVHETARAAGKQMQKG-WRPRRTVIFASWDAEEFGLLGSTEWAEDNAKMLQERAVAYINADSAIEGMYTLRVDCTPSLHTVVYDITKQVMSPEKGEERMTLYESWHKRDNWTNDRDAPRISKLGSGSDFEAYFIRLGITSGRARYTKNRKTELYSSYPVYHSVYETFELVERFYDPSFRRLEAVGRVRAGLVFRLADDLIIPLDCNEYAQSLAQYSHTIEQLAMKHPQEMQM-YSVKFDALFSAVQNFTDAAAGFHHRLKALDTTDALAVRMVNDQLMYLERAFIDPLGLPGRPFYRHVIFAPSSHNKYAGESFPGVYDAL 661          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Cavefish
Match: si:ch211-214j8.1 (N-acetylated alpha-linked acidic dipeptidase like 1 [Source:NCBI gene;Acc:103033129])

HSP 1 Score: 247.284 bits (630), Expect = 1.432e-70
Identity = 186/591 (31.47%), Postives = 281/591 (47.55%), Query Frame = 1
Query:  151 KILIIS---IFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFL--LDQLSIYA-----SEI-HQAGSERNLKLAEIMENNW--KIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLP---------LYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQT----PIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQY-------LQSANNY---ELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSE--NVWINSSTTLYQDWLKKMPNSANKNE--PRVNFL-GGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSR 1788
            KIL+     + VLAVGI+IG +   ++  P+         +S N+   + + F+  +D + I       +E+ H A +  +    E M   W  K  GL +  R  YR+  +   ++ P+ V +      V      +     P          Y++Y  AGHA+G+ V+ N G +SD  +L++ L++S      I I R G + R AK    I      + G +LVY DP+D      N          YP SW+LP      G+F   SD  +P  P L    +T            PIP QPI + DA  L   +     P  WQ   P          + A+ Y   E+++ V N  +     NV+G+I G  + DRYV+ GNHRD+W  GA DP SGT ++ ++  ILG+  K G +RP RT++F +W  EE GLIGS E+  ++ S L +R +AY+N+D  +  + +    A+P+    +  +S+  N   +SS ++Y +WLK    ++      P V +L G GSD+ PF + +GI S    Y Y++S       PAYHT YD  D   KYIDP    HQ V+R
Sbjct:    4 KILLFGFAGLAVLAVGILIGHFGIEQDNSPK-----WVRDLSQNVDESLIKKFIAEVDNMKIQENLRKLTEVPHMATTPGDEATVEYMLKRWQDKDSGLDAAWREDYRVYLSFPKKDTPNTVTVVSPSNAVLFKAQEKEKAYTPDQEDPEVVQPYAAYGPAGHARGKLVYANQGKVSDYELLNRTLDLS----GTIAIVRYGGAGRGAKA---INAAPFGVVG-VLVYTDPYDI-----NDGLMSDENETYPHSWYLPPSGAERGSF--TSDFGDPLTPYLAAKKDTYRIPEENINGAPPIPIQPIGFGDAQALICELGGSAAPTDWQGSFPCTYNFGGPGFRDASTYRDSEVKLDVYNAGELRNSTNVMGVIWGSVEPDRYVMYGNHRDSWVHGAIDPSSGTAVMLEITRILGEKVKSGKWRPRRTIIFGSWGAEEFGLIGSAEYAEEYISKLSQRAVAYINVDISVFANATLRASASPIAQNVIFTASKQVNAAGSSSVSVYDNWLKYFNRTSPTYGLIPNVGYLTGAGSDYAPFIHYMGITSMDLSYTYDRSKTRARIYPAYHTAYDTFDYASKYIDPGFTSHQTVAR 574          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Cavefish
Match: si:ch211-214j8.1 (N-acetylated alpha-linked acidic dipeptidase like 1 [Source:NCBI gene;Acc:103033129])

HSP 1 Score: 240.736 bits (613), Expect = 9.787e-69
Identity = 194/633 (30.65%), Postives = 296/633 (46.76%), Query Frame = 1
Query:  151 KILIIS---IFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFL--LDQLSIYA-----SEI-HQAGSERNLKLAEIMENNW--KIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLP---------LYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQT----PIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQY-------LQSANNY---ELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSE--NVWINSSTTLYQDWLKKMPNSANKNE--PRVNFL-GGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVS--------RFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQ 1890
            KIL+     + VLAVGI+IG +   ++  P+         +S N+   + + F+  +D + I       +E+ H A +  +    E M   W  K  GL +  R  YR+  +   ++ P+ V +      V      +     P          Y++Y  AGHA+G+ V+ N G +SD  +L++ L++S      I I R G + R AK    I      + G +LVY DP+D      N          YP SW+LP      G+F   SD  +P  P L    +T            PIP QPI + DA  L   +     P  WQ   P          + A+ Y   E+++ V N  +     NV+G+I G  + DRYV+ GNHRD+W  GA DP SGT ++ ++  ILG+  K G +RP RT++F +W  EE GLIGS E+  ++ S L +R +AY+N+D  +  + +    A+P+    +  +S+  N   +SS ++Y +WLK    ++      P V +L G GSD+ PF + +GI S    Y Y++S       PAYHT YD  D   KYIDP+ +   + S          VI     L+ +P+    I+  + LL R F D Q
Sbjct:    4 KILLFGFAGLAVLAVGILIGHFGIEQDNSPK-----WVRDLSQNVDESLIKKFIAEVDNMKIQENLRKLTEVPHMATTPGDEATVEYMLKRWQDKDSGLDAAWREDYRVYLSFPKKDTPNTVTVVSPSNAVLFKAQEKEKAYTPDQEDPEVVQPYAAYGPAGHARGKLVYANQGKVSDYELLNRTLDLS----GTIAIVRYGGAGRGAKA---INAAPFGVVG-VLVYTDPYDI-----NDGLMSDENETYPHSWYLPPSGAERGSF--TSDFGDPLTPYLAAKKDTYRIPEENINGAPPIPIQPIGFGDAQALICELGGSAAPTDWQGSFPCTYNFGGPGFRDASTYRDSEVKLDVYNAGELRNSTNVMGVIWGSVEPDRYVMYGNHRDSWVHGAIDPSSGTAVMLEITRILGEKVKSGKWRPRRTIIFGSWGAEEFGLIGSAEYAEEYISKLSQRAVAYINVDISVFANATLRASASPIAQNVIFTASKQVNAAGSSSVSVYDNWLKYFNRTSPTYGLIPNVGYLTGAGSDYAPFIHYMGITSMDLSYTYDRSKTRARIYPAYHTAYDTFDYASKYIDPEPLKEAVKSFRNAAANLDRVIHSSDLLNETPLKARRINDQLMLLDRAFVDPQ 616          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Cavefish
Match: si:ch211-214j8.1 (N-acetylated alpha-linked acidic dipeptidase like 1 [Source:NCBI gene;Acc:103033129])

HSP 1 Score: 239.965 bits (611), Expect = 2.319e-68
Identity = 168/518 (32.43%), Postives = 247/518 (47.68%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNW--KIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLP---------LYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQT----PIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQY-------LQSANNY---ELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSE--NVWINSSTTLYQDWLKKMPNSANKNE--PRVNFL-GGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSR 1788
            H A +  +    E M   W  K  GL +  R  YR+  +   ++ P+ V +      V      +     P          Y++Y  AGHA+G+ V+ N G +SD  +L++ L++S      I I R G + R AK    I      + G +LVY DP+D      N          YP SW+LP      G+F   SD  +P  P L    +T            PIP QPI + DA  L   +     P  WQ   P          + A+ Y   E+++ V N  +     NV+G+I G  + DRYV+ GNHRD+W  GA DP SGT ++ ++  ILG+  K G +RP RT++F +W  EE GLIGS E+  ++ S L +R +AY+N+D  +  + +    A+P+    +  +S+  N   +SS ++Y +WLK    ++      P V +L G GSD+ PF + +GI S    Y Y++S       PAYHT YD  D   KYIDP    HQ V+R
Sbjct:   15 HMATTPGDEATVEYMLKRWQDKDSGLDAAWREDYRVYLSFPKKDTPNTVTVVSPSNAVLFKAQEKEKAYTPDQEDPEVVQPYAAYGPAGHARGKLVYANQGKVSDYELLNRTLDLS----GTIAIVRYGGAGRGAKA---INAAPFGVVG-VLVYTDPYDI-----NDGLMSDENETYPHSWYLPPSGAERGSF--TSDFGDPLTPYLAAKKDTYRIPEENINGAPPIPIQPIGFGDAQALICELGGSAAPTDWQGSFPCTYNFGGPGFRDASTYRDSEVKLDVYNAGELRNSTNVMGVIWGSVEPDRYVMYGNHRDSWVHGAIDPSSGTAVMLEITRILGEKVKSGKWRPRRTIIFGSWGAEEFGLIGSAEYAEEYISKLSQRAVAYINVDISVFANATLRASASPIAQNVIFTASKQVNAAGSSSVSVYDNWLKYFNRTSPTYGLIPNVGYLTGAGSDYAPFIHYMGITSMDLSYTYDRSKTRARIYPAYHTAYDTFDYASKYIDPGFTSHQTVAR 517          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Cavefish
Match: tfr1a (transferrin receptor protein 1-like [Source:NCBI gene;Acc:103035460])

HSP 1 Score: 145.591 bits (366), Expect = 1.244e-35
Identity = 141/529 (26.65%), Postives = 227/529 (42.91%), Query Frame = 1
Query:  274 LQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKS-TARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGI-FETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNC-LPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVW--INSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYD---NIDMMLKYIDPQLVHH------QIVSRFVIDYMIRL 1815
             ++K+S + +   LS ++   HQAGS  +  LA  +   ++ + +   T  H  R+    ++ +N          KI F   +   +G L    SYS  G  +G  ++  YG + DL  L  L I + G   +L+ R G    A K+             ++L+YPDP D+++ +                        ++G+  +   D   P  PS     F     S + T IP Q I  + A  +   M     P  W N  L +Y    ++  + V VNN + E  I NV G+I G  D DRYV++G  RDAW  G +    GT +L ++A  + +   +  F+P R+++FA+W   E G +G+ E+   + S L  +  +Y+++D  + G  +F   A+PLM   +  + + V    +SS TLY         SA   EP    +       PF    GIPS    +    S    P + T  D   N+D+ + Y    LV        Q+  R V D++IRL
Sbjct:  111 FKDKLSTANIESSLSEFSIADHQAGSAGDEALANKLMRKFRDYNMNPWTDEHFVRVQDPPSSGSN----------KITFRDQSFSESGFL----SYSGTGSVQGTLLYAYYGQMDDLRRLQDLTIDFNGK--VLLVRAGKISFAEKVANAAAVNAS----AVLIYPDPADYSIGEGTD---------------------LYGHVHLGCGDPYTPGFPSFNNTQFPPAQSSGLPT-IPAQTIRPSTAAAIMGMMEGRDPPRGWGNGGLQKYKLGGDDDLVTVEVNNVLTEKKIHNVFGVIKGLVDADRYVVIGAQRDAWGPGYAKSTVGTSLLVEIARSISEMISKNGFKPRRSIVFASWSAGEYGAVGATEWLEGYLSSLNMKAFSYISLDGVVTGP-TFKASASPLMYDVIQSTLKEVSSPSDSSRTLYSQVAGSNWESAVM-EP----MTLSDTAYPFQAFTGIPSVSIRFT---SEKEYPFFGTMLDTKQNLDIKVSYSLSALVKTAGEIAGQMALRLVHDHLIRL 588          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Sea Lamprey
Match: si:ch211-214j8.1 (si:ch211-214j8.1 [Source:ZFIN;Acc:ZDB-GENE-060526-100])

HSP 1 Score: 120.939 bits (302), Expect = 8.340e-30
Identity = 99/348 (28.45%), Postives = 157/348 (45.11%), Query Frame = 1
Query: 1210 AWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENV----WINSSTTLYQDWLKKMPNSANKNEPRVNF------LGGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLN--------SIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +W  GA DP SG  ++ ++   LG   K G +RP R+++F +W  EE GLIGS E+  ++   L+ER + Y+N+D  +  + +   R TP M      S   V       S  ++Y  WL       N+  P +        +G GSD+ PF + LG+P     Y Y+ S +     PAYHT YD  D    +IDP    HQ V+R     ++RL+ S ++PY+    V+ LL     L             S+ +      + I  S +  L     +  E +      +N  + +R +ND L+ L R F      P + Y R+++ + +   S     F GV D++
Sbjct:    1 SWVHGAIDPSSGISVMLEITRALGSIVKEGQWRPKRSIVFCSWGAEEFGLIGSVEWAEEYYKTLMERAVGYINVDISVFANATLRVRGTPPMQRVRHSSPPQVKHPDLSGSHKSVYDVWLSHY----NRTSPSLGVIPKLLEIGDGSDYGPFIHYLGVPCIDFSYTYDSSKSKARIYPAYHTGYDTFDYASTFIDPGFTSHQAVARTAAYTLLRLADSLLLPYNGMDYVETLLAMHATLASNHGQLLDAQGISLGWYTCVARASITPSGVCRLHIGGGAIDEHVVGVPRQYNRPMKVRAINDQLMLLERAFTDPVAFPDKLYYRHVVWTPR---SSAVEAFPGVVDAV 341          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Yeast
Match: VPS70 (Protein of unknown function involved in vacuolar protein sorting; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum [Source:SGD;Acc:S000003887])

HSP 1 Score: 116.316 bits (290), Expect = 3.332e-27
Identity = 114/432 (26.39%), Postives = 197/432 (45.60%), Query Frame = 1
Query:  547 YSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFA--VDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDA--------GKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPG-FPDGDRYVILGNHRDAWATG-ASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSST--TLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTR--YDNIDMMLKYIDPQLVHHQIVSRFV 1794
            +  YS  G    R+VF NYG ISD  +L K NI     D I I R G  +   K    +K    +   S+++Y DP+D     ++N     P+  P    S+        F +     D   P  PS +   E ++       IP+ P+S  D         G+ FQ      + +      P    S +   L   +  +++E++   V   IPG F +G+  +I+G HRD+ A+  A D  SG+ IL ++A  +    K G ++P R +   +WDGE  GL+GS ++     + L  R + Y+N+D  I G+ +F+ +A PL+   + ++++    N     +L+  W K   N+       ++ L G S +  F Y LG+P+A+  +++N +  +   YH+   +D+   + K+ +     H  ++ FV
Sbjct:  231 FHQYSKNGSVTARYVFCNYGSISDYKLLLKKNIDI--EDKIHIVRSGKILPGLK----VKNAELYGASSVIIYTDPFDDGKVTEENGFLHYPYG-PARNPSYIRRDSVNYFSD--TPGDPTTPGYPSKDSDTEHMSPVGRVPRIPSVPMSARDVQPILERLNGRGFQIGPGSNIKDFGSFTGPS--SSIDKVHLHNELTYNIKEMSSVEV--SIPGIFTEGE--IIIGAHRDSLASSSAGDANSGSAILLEIARGMSKLLKHG-WKPLRPIKLISWDGERSGLLGSTDYAEAHAAILRRRALVYLNLDNAISGT-NFHCKANPLLQDVIYEAAKLTEFNGHEDWSLFDHW-KYTSNAT------ISLLDGLSSYTSFQYHLGVPAAH--FQFNANDTSGAVYHSNSVFDSPTWLEKFTNSDYKLHNTMAMFV 636          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Yeast
Match: TRE1 (Transferrin receptor-like protein; plasma membrane protein that binds Bsd2p and regulates ubiquitination and vacuolar degradation of the metal transporter Smf1p; functionally redundant with Tre2p; TRE1 has a paralog, TRE2, that arose from the whole genome duplication [Source:SGD;Acc:S000006097])

HSP 1 Score: 60.077 bits (144), Expect = 9.575e-10
Identity = 72/312 (23.08%), Postives = 132/312 (42.31%), Query Frame = 1
Query:  970 IPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVT-IANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAY--HTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKK 1896
            IP+ PIS N   K+   +++  V   + N L  +  S N+  L+++V   ++E   + +++G I G     R +++   R++ + G   P  GT++L  +  +  +   +  ++P R + F ++ G E    G+ E   +    L  +   Y  +D    G W                 S N+ I     L   + K M  ++ K   +V+ +    D  P+    GIP A        +  + P Y    ++D I   L+      V  +I+  ++++  + L   P IP+SI   VD L    KDLQK+
Sbjct:  352 IPSIPISANQGDKILAILSDTGV--KFSNNL--FSGSLNDCRLDLLVQTAIRERHPVHDIVGKIEGSEQAGRAIVIAAPRNSASYGTMYPSFGTVVLLSLIQLYQEMVYKFDWKPLRNIYFISFGGSEFNEAGATELMEKRTEAL--KSEIYTIIDVGQIGIWD---------------DSNNLEIQCHPLLVDLFQKNM--TSRKFNVKVDNVHQFGDWTPY-LAQGIPVAIISSPGVMNREH-PIYTVEDKFDFIKDKLRDKKKGEVLSEIM-LYLVEKSLELIDDPFIPFSISNYVDFLSTTLKDLQKE 637          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Yeast
Match: TRE2 (Transferrin receptor-like protein; functions with Tre1p to regulate ubiquitination and vacuolar degradation of the metal transporter Smf1p; inviability of null mutant in systematic studies is due to proximity to CDC31; TRE2 has a paralog, TRE1, that arose from the whole genome duplication [Source:SGD;Acc:S000005782])

HSP 1 Score: 53.9138 bits (128), Expect = 7.521e-8
Identity = 38/158 (24.05%), Postives = 72/158 (45.57%), Query Frame = 1
Query:  961 QTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVT-IANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNM 1431
            QT IPT PIS     +L   +++G V     N          +  ++V +  +V+E   I N++G I G    D+ +I+   R++   G + P  GT  L  +  +  +   +  ++P R + F ++ G E    GS+E   Q  + L +   + +++
Sbjct:  364 QTHIPTIPISTRQGKELLSRLSSGGVTVDDGNSDRSNSGKMGDVLIDVDLQTNVREKHFIPNIVGKIEGREQSDKAIIIAASRNSINFGTTYPNFGTAALLSIVQLFQEVKYKFGWKPLRNIYFISFGGTEFNYAGSSELVEQRLTPLKDEIYSLIDI 521          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Nematostella
Match: EDO34973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMR7])

HSP 1 Score: 272.322 bits (695), Expect = 3.395e-80
Identity = 211/732 (28.83%), Postives = 342/732 (46.72%), Query Frame = 1
Query:   88 NYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRK----------NCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPL---------YSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSI-RAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDA---GVFGNFKMVSDLQNPELPSLEGIFET--VNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQ-----SANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVW-------INSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEY--KYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEF---INSKKN---LFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKN 2148
             Y+  N T  +       +W+ +  + + V   G +IG +  ++          N  P+ S+ +        LQ + SE  L D LS + S  H AGS+R   LA+ + + W+ +G     +  Y++  +   ++ P+ + +    ++ + +       L P          +  YS  G  +G  +++NYGL  D + L K NIS  G   I+I R  F+I  AAK   I            + +PD   +A +     + P+ T  YP   WL  DA     F  +  V D   P LP++ GI+      F      IP QPISY  A  L + +    VP+SW +              NN ++ + VN   + +T  NVIG I G  + DRYVI+GNHRD+W TGA D  SG+ +  ++A +LG   K G +RP RT+ F +W  EE GL GS E+  Q  + L+ER +AY+N+D  ++G++    RA+     PM K+    W       +NS  T+Y+ WL   P+  +  EP +  L   SD++ F   +GIPS+   Y   Y +     P YHT  D    M  + DP    H+++++ V   ++ ++ S ++PY +     +L   +    K LNS  F      +D++E+ L  L    N F +     +++K+   L ND L +R  ND ++ + + F+   GLP +PY R++  + +  N
Sbjct:    2 EYDMDNQTYTRTKTSMTRLWIVMAFVCVVVFLSGFLIGYFATKQPNESSQLAVPNGIPKASDYFYM------LQEEASEEKLADHLSHFTSVPHLAGSDREDALADYLVSQWRDFGFDHVTKEPYQVYLSAPQESRPNTITVIRDGEVEYKIEGKMKVSLDPSSGQSEDFYPFIGYSPNGTVEGDLLYVNYGLEPDFMELAKHNISAEGK--IVIARQAFTIDTAAKYGAI----------GFISFPDVPFYAPE----GTGPNET--YPSKPWLSRDAVQPSSFAKYPYVGDPLTPGLPAIRGIYRKPLSEFRKTAPAIPAQPISYGQALDLLKLLKGPNVPDSWYSIFNTNFSIGPGFHGNNTKVRLEVNTQSELMTSYNVIGTISGREEPDRYVIIGNHRDSWVTGAGDASSGSAVTFEIARVLGRLRKSG-WRPRRTIKFCSWGAEEWGLFGSTEWVEQNRNLLIERAVAYINLDIAVQGNFVLRTRAS-----PMFKNVTYHWAKRLSDPVNSDKTVYETWLAHTPSDLDPTEPMIYNLFRSSDYVAFYDYIGIPSSDYGYWFGYKRQSRMYPVYHTTDDTFYWMKMFGDPGFKAHKVMAQLVGSIVLDVAGSILLPYKLTDYAHMLNISY---NKVLNSNLFYG----TDVVETHLRFLKEAINKFFKAAIRFDAEKDRIRLSNDTLRIRVTNDQIVQVEKAFIAPVGLPGKPYDRHVAFNFRFHN 696          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Nematostella
Match: EDO33278 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSM9])

HSP 1 Score: 265.774 bits (678), Expect = 2.867e-78
Identity = 188/661 (28.44%), Postives = 323/661 (48.87%), Query Frame = 1
Query:  313 LSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVE---------------LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVL-DKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM---VSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENV--WINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLAN----MPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQ-KKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKK--NLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            L  ++S  H AGS R L+LA  +   W+  G       +Y++  +   ++ P++V L   +  +   T+ E                  L+  + +Y+ +G  +G  V++NYG + D   L D L I+  G   I I R+G   R  K+               ++Y DP  +A +   KS        YP + WLP D    G+        D   P LP++ G+       S    IP QPISY +A ++   M    VP  W+  L       P+     NN  +++ V+N ++  TI NVIG I G  + DRYV++GNHRD+W  GA D  +GT +  +++   G   K+G +RP RT++  +WD EE GLIGS+E+  +    L +R + Y+NMD  + G++      + ++ G ++     +     S  TLY   +++ P+ A  N+P  N +  GSD+ PF+Y +GIP A  ++ Y     N     P YH++YD  + M K+ DP  V H+ +++F    ++ L+ +P++P ++      + + F +L+ + L S+   KQ+   + ++  +      A  F   +   +    + +F L+R++N+ L+ + + F+   GLP RP +R++L + +L N+Y  S F G+ D+I
Sbjct:    2 LRYFSSRPHIAGSPRQLELANDLARRWREAGFDRVEMPQYQVLLSFPQKDKPNLVTLLHSNGSIAYQTSAEEQVRVLNKTQSAEKNFQTLVSPFLAYAPSGTVEGWLVYVNYGRLEDFARLRDNLGINITGK--IAIMRMGSIYRGDKVMNAAANGAI----GAILYTDPDTYAKEGQAKSD------TYPFTPWLPPDGVQLGSVYSDMDTGDPLTPGLPAIPGMHRRSYKGSGLPSIPAQPISYGEAAQILSRMGGLAVPKEWRGSLNISYNLGPEL---TNNMRVKLEVHNKLEIKTIYNVIGTIYGQEEPDRYVLMGNHRDSWVFGAIDASTGTAVTAEISRGFGKLLKKG-WRPRRTIMMCSWDAEEYGLIGSHEWVEEHHQVLRDRAVTYLNMDVAVGGNYVMQVAGSAMLKGAIMSQLRKIPEPQGSGRTLYDVMVEREPSKAEVNKPAYNGVASGSDYAPFSYFVGIPVA--DFTYAMGYENKSMFYPVYHSKYDTFEYMEKFGDPGFVAHKAIAQFGGSLLLSLADAPLLPLTVANYAIRMNQSFTNLRNRHLTSL--TKQNITLEYLQGAVSDFQSVAKGFLATVAKARWSADWGEFRLMRRINNQLMAVEKSFIYANGLPGRPLVRHVLFAPELHNTYGTSSFPGISDAI 642          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Nematostella
Match: EDO42931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S002])

HSP 1 Score: 265.003 bits (676), Expect = 4.634e-78
Identity = 204/675 (30.22%), Postives = 322/675 (47.70%), Query Frame = 1
Query:  268 NNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLL----------PLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENV--WINSSTTLYQDWLKKMPNSANKNEPRVNF-----LGGGSDHIPFAYVLGIP-SAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINS--------KKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            NNL NK     +   L+   S  H A S RNL+LAE +   WK  G  S  + KY +  +   +N  +   L  G+  V    T + N  +          P YS+YS  G   G  VF NYG   D   L    I+   ++ I I + G   R  K+    K   K    + +++ DP DF    +++        +YP+ WWLP      G+  +   D   P  P+ EG++   +       IP  PIS +DA      M+    P+ WQ  L       P +++   N+ ++V  NND     I NVI +I G  + DR V+LGNHRDAW  G +DP SGT  + +++ ILG   + G +RP R+++  +W GEE GLIGS E+       L +R IAY+N+D P++G+++F   A+PL+   + ++++ V   +N + ++Y +WLK+ P   + N+PR+ F     LG GSD+ PF      P + +  +K    +++ P YH+ +D  +   K++DP    H  ++R  +  + +L+  P++P            R  D    +N      Q  Y   ++++ + LDF   S + F N         K  + ND L LR LND L+ + + FL   GLP RP   + + +  L NSY    F G+ D++
Sbjct:    4 NNLNNKEKHFCVFRYLT---SRPHIAASARNLELAENISETWKNLGFGSVKKVKYNVLLSFPTKNKTNGAMLLDGNGDV-KFETAKQNKPVEPSEDSPDAYPPYSAYSPTGVETGELVFANYGSPDDFSYLKSKGINV--TNKIAIIKYGKVFRGDKVTNAAKAGAK----AAILFNDPKDFGPVPDDQ--------LYPNGWWLPRTGVERGSVLLGTGDPLTPRYPAKEGVYRGFSSDIPLPTIPAHPISADDAKVFLSKMSGPDAPDDWQGGLNITYRLGPGFVRPYENWTVKVETNNDHVSKDIYNVIAVIKGREEPDRLVLLGNHRDAWVFGGTDPSSGTACMLEMSRILGHMLRTG-WRPRRSIVLGSWGGEEFGLIGSTEWVEDNLHTLYQRGIAYINVDSPVRGNYTFFAWASPLLNQVLYEATKLVPDPVNQNVSVYYNWLKRSP--GDGNQPRMCFSRIYGLGSGSDYAPFYLRAWTPGNGFEIHKKFHGVSSYPTYHSLHDTFNYAKKFLDPHFYTHMTMARIWLAVVYQLAEKPLLPL-----------RLHDYLGVVNGSALALQKKYGTQLKNRNISLDFLFRSINNFGNGVKVMNSMIKNTILNDTLALRMLNDRLMGVEKTFLNFAGLPKRPLYWHSVFAPSLYNSYASVTFPGLSDAL 646          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Nematostella
Match: EDO40715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6G2])

HSP 1 Score: 262.307 bits (669), Expect = 2.855e-77
Identity = 194/661 (29.35%), Postives = 304/661 (45.99%), Query Frame = 1
Query:  301 LLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNG--------LLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNF---KMVSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENV--WINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLA-NMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNL---------FNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +LD    +    H  G E++ KL   + + W  +G       +Y +  ++ +++ P+ V      KI+ N T   L          +LP + +YS  G   G  +++NYG + D    + L  S  G   I I R G   R  K+K   + CG      ++++ DP D A +  +K+        +P +WWL G     G+        D   P LPS EGI+      +   P IP QP+ YNDA +  + M     P+SWQ  L       P +     N    +IVNN+       NVIG I G  + DR V+ GNHRDAW  G  D  SG+ ++ +++  LG   K   +RP RT++  +W  EE GLIGS E+ N+    L +R +AY+N+D  + G++SFN    PL+       +  V  +   S ++Y  W    P S +   P    LG GSD+  F   +GIPS    Y +  S A   P YH+ +D   +  K+ DP    H  +++     +  ++ SP++P+S     D L + ++ LQK            + D + +Q + LD+       F ++  N            DF+ LR LND +  L R F+   GLP RP  R++L + +  N Y  ++F G+YD++
Sbjct:    2 ILDSSRNFTKRPHIGGGEQSQKLGCYIRDKWLSYGFDKVEMPRYDVLLSLPSRDKPNAV------KIIDNSTGEVLTDEPSENDPLVLPPFLAYSPPGDVMGELIYVNYGTVEDFKKFEDLKQSCKGK--IAIMRYGRIFRGDKVKHAAE-CGAI---GVILFSDPIDVAPEGMDKT--------FPKTWWLSGTGAQRGSILKNNYYGDPLTPLLPSTEGIYRNSRNDTNALPTIPAQPLPYNDALEFLKRMKGPEAPDSWQGGLQIKYKLGPGFTDP--NTTTRLIVNNEFVTRPGYNVIGTITGQEEPDRIVLYGNHRDAWVFGGVDSSSGSAVMMELSRGLGYLLKNKKWRPRRTIMLCSWAVEEYGLIGSAEWVNENEKMLTDRAVAYINIDSGVAGNYSFNAAGNPLLQEMAFNETRLVRDYNTRSMSVYDKWSMSYP-SDDHAIPAFKTLGSGSDYTTFVQSVGIPSLDMSYTFKDSRAWPYPVYHSVHDTFYLQKKFNDPYFKSHLTMAKISGKLLTAVADSPLLPFSTRSYKDSLAKGYRQLQK-----------TFQDRLSAQNITLDYIGKEIENFADASDNFESAKATLDNTTDFMKLRLLNDQMAKLERAFIWPYGLPGRPDTRHVLYAPQRHNLYGSAVFPGIYDAM 628          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Nematostella
Match: EDO43050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU1])

HSP 1 Score: 259.996 bits (663), Expect = 2.436e-76
Identity = 188/655 (28.70%), Postives = 315/655 (48.09%), Query Frame = 1
Query:  343 AGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKI----------VFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVS-DLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQN-------CL--PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWI-----------NSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNL--------FNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            AG+  + +LA   E  +K +G  +    KY +   ++  N P  V L + +            V + +    + + P +++YS +G  KG+ V++NYG   D   L   NI+  G   I+I R G   R  K +   +R  K     L++Y DP D    +            YPD   L  D    GN  M   D   P  P+ +GI+           IP +PIS+ DA  L ++  +    +  ++       C+   ++     +  + V V+N +++ ++ NVI  I G  + DRYVILG+HRDAW  G  DP +G  +L + A ++G   K  ++RP RT++FA+WD EE G++GS E+  +    L  R +AY+N+D  + G +   G+    +I   +    N++I           NS+  LY++W + +P++ N++ P V  +G GSD++ F   +GIPS    +  N   ++ P YHT +D    + K++DP +  H  V++  +  +++L+ S ++P  + RL     R      K LN         YSD +  Q + L +   + SEF ++ ++          ND + + + ND L+ L R F+  EGLP RP +R++L +  + N Y GS F G+ DSI
Sbjct:    8 AGTNGSYQLALYQEKEFKSYGFDNVELKKYEV--LLSYPNKPGFVALLYANHTEQHRSAEQERVLDASENHTDRVSP-FNAYSPSGDVKGKLVYVNYGREEDFKYLKDNNINVTGK--IVIARYGKLFRGGKAQNAERRGAK----GLILYSDPADTGGQEK----------TYPDGMALSPDGVQRGNLWMEKGDPLTPGYPATDGIYRRPEAEVPFPKIPVKPISWEDAEPLLRYRADASKSDRQKDEQTGRRICVGGDEWTDRQKDGNVRVFVDNKLEKRSVHNVIATINGDEEPDRYVILGSHRDAWVFGGVDPSTGQTVLMETARLVGHLRKE-SWRPRRTIIFASWDAEEYGILGSAEWVEENEKILSSRAVAYINIDSAVTGQY---GQKRSRIIYIYIYIYINMFIFTKVLSVNGIGNSTDNLYEEWKRNVPDAKNEH-PSVETIGSGSDYLFFIQRIGIPSIDFRFVGNSVRSSYPVYHTLHDTYHYVTKFLDPDMRLHAAVTKVALRMLMKLADSRVVPLDVRRLA----RAIDSYGKTLN-------ETYSDDLAKQSITLKYVFEAISEFKDAAEDFSKYLEKLDTNDAVKVMRANDRLIQLDRAFINTEGLPNRPAIRHLLYAPSVFNLYAGSNFAGITDSI 627          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Medaka
Match: naalad2 (folate hydrolase 1B [Source:NCBI gene;Acc:101170696])

HSP 1 Score: 248.825 bits (634), Expect = 2.880e-71
Identity = 196/718 (27.30%), Postives = 334/718 (46.52%), Query Frame = 1
Query:  142 IWLKILIISIFVLAVGIIIGIYIPRKNCFPEN---SNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNP---SIVRLWFGDKIVFNLTT------VELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDK-LNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQT----PIPTQPISYNDAGKLFQFMTNGPVPNSWQNCL-------PQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLM------IGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYN---QSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIP--FIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSI 2190
            +W  +L+ ++F+L  G IIG +    +   E+   SN Y    +     +++ E      L  +    H AG+E+NLK AE ++  W+ +GL S     Y +  +  N++ P   SIV     +  V +L         ++  ++P +S++S  G  +G  V++NYG   D + L + + I+  G   I+I R G   R  K+K  +    K     ++++ DP D+                YPD W LPG     GN   ++   +P  P       T  FS  +      IP  PI +NDA  L + M     PN+W+  L       P +     + ++ + + ++ Q   I NVIG I G  + DRYVILG HRDAW  G  DP+SG  ++ +     G    +G +RP R+++FA+WD EE GL+GS E+       L +R +AY+N D  I+G ++     TP +      +   + S E        +LY+ W K+   + +++ PR++ LG GSD   +   LGI +    Y  +   +  ++ P YH+ Y+  +++ ++ DP     + V++      + L+ S ++P   +   D L +  + + +     P   +K     D + S +      A  F E + +     +D L +R +ND L+ L R F+   GLP RP+ R+++ +    N Y G  F G+YD++
Sbjct:   11 VWWILLVTALFLL--GFIIGWFAKPSHTNKEDHKASNEYLREFLDEMQADRIRE-----HLRKFTRLPHLAGTEQNLKYAEQIKEEWQEFGLDSVEMVPYDVLLSYPNKSQPNYISIVDQLGTEVFVTSLAEPVPQGYEDVTDIVPPFSAFSAKGQPEGDLVYVNYGRTEDFVQLQREMGINVTGK--IVIVRYGKIFRGNKVKNAMLAGAK----GVIMFSDPADYWAT---------GVQPYPDGWNLPGGGAQRGNVLNLNGAGDPLTPGYPAKEYTYRFSMEEGVGLPDIPVHPIGFNDAIHLLKNMGGQIPPNNWKGALNVSYRIGPGFTDDIKSQKVRMNIYSNNQITRIYNVIGKIRGALEPDRYVILGGHRDAWVFGGIDPMSGAAVIHEAVRSAGLLLGKG-WRPRRSIIFASWDAEEFGLLGSTEWAEDNARLLQQRAVAYINADSAIEGMYTLRVDCTPSLHTLVYDLTKQIASPEEG--EEGISLYESWHKRDNWTNDRDAPRISKLGSGSDFEAYFIRLGIAAGRARYTKDMKTERYSSYPVYHSVYETFEIVEQFYDPSFRRLRAVAQVRGGLTVLLANSQLLPLDANEYADALGKYAQSIAQLAAKNPDEMVKYEVSFDSLFSAVQNFTVAARDFHERLKTLNR--DDPLQVRLVNDQLMYLERAFIDPLGLPGRPFYRHVIFAPSSHNKYAGESFPGIYDAL 701          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Medaka
Match: si:ch211-214j8.1 (N-acetylated alpha-linked acidic dipeptidase like 1 [Source:NCBI gene;Acc:101166965])

HSP 1 Score: 232.646 bits (592), Expect = 2.727e-65
Identity = 167/533 (31.33%), Postives = 265/533 (49.72%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWK--IWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELN-----------GLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQ---NCL-----PQYLQSA--NNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWI--NSSTTLYQDWLKKMPNSANKNE--PRVNFL-GGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIP 1836
            H A S  + +  + M   WK    GL    R +Y +  +  +   P+ V +   D     L TV               ++  Y++Y+ AGH +G+ V+ + G  +D  +L+K  +   G+  I ITR G + RAAK    I      + G +LVY DP D      N       +  YP SW+LP      G++ +   D+  P L + +  +     +  + P IP QPI + DA KL   +     P+ WQ   NC      P +   +  NN ++++ + N       +NV+G+I G  + DRYVI GNHRD+W  GA DP SGT ++ ++  +LG   K+G +RP R+++F +W  EE GLIGS E+T  + + L ER ++Y+N+D     + +      P +   + ++S+ V    + S ++Y +W+K    ++  +   PR+ +L G GSD+  F + LGI S    Y Y+++  N    PAYHT YD  D   KYIDP  V HQ V+R   + +IRL+ S ++P
Sbjct:   74 HMATSPGDEQTVQFMLKRWKDPSSGLDDAWRQEYAVYLSFPDPEKPNKVTVV--DPSDAELYTVREKEKPYYDDQRHPDVVQPYAAYAPAGHPRGKLVYAHQGKAADYELLNK-TVDLRGT--IAITRYGGAGRAAKA---INGAPYGVVG-VLVYTDPLDI-----NDGVMSDTSETYPHSWYLPPSGVERGSYSIPFGDMLTPYLAAKDDTYRIPRENVTEIPPIPVQPIGFEDAYKLICELGGDAAPSDWQGGFNCTYNNGGPGFNTDSVFNNSDVKLDIYNHETVKNSSNVMGIIRGSVEPDRYVIYGNHRDSWVHGAIDPSSGTSVMLEITRVLGSMVKQGKWRPRRSIIFGSWGAEEFGLIGSAEYTEDYFTKLSERTVSYINVDIATFANATLRASGVPSVQNVIFQASQQVSAPGHDSLSVYDNWIKYSNRTSPTHGLIPRMGYLTGAGSDYAAFVHYLGIASMDISYTYDRTKTNARIYPAYHTAYDTFDYASKYIDPGFVSHQAVARTAGNILIRLADSLLLP 592          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Medaka
Match: si:ch211-214j8.1 (N-acetylated alpha-linked acidic dipeptidase like 1 [Source:NCBI gene;Acc:101166965])

HSP 1 Score: 232.261 bits (591), Expect = 4.002e-65
Identity = 167/533 (31.33%), Postives = 265/533 (49.72%), Query Frame = 1
Query:  337 HQAGSERNLKLAEIMENNWK--IWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELN-----------GLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFSSMQTP-IPTQPISYNDAGKLFQFMTNGPVPNSWQ---NCL-----PQYLQSA--NNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWI--NSSTTLYQDWLKKMPNSANKNE--PRVNFL-GGGSDHIPFAYVLGIPSAYPEYKYNQSLANM---PAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIP 1836
            H A S  + +  + M   WK    GL    R +Y +  +  +   P+ V +   D     L TV               ++  Y++Y+ AGH +G+ V+ + G  +D  +L+K  +   G+  I ITR G + RAAK    I      + G +LVY DP D      N       +  YP SW+LP      G++ +   D+  P L + +  +     +  + P IP QPI + DA KL   +     P+ WQ   NC      P +   +  NN ++++ + N       +NV+G+I G  + DRYVI GNHRD+W  GA DP SGT ++ ++  +LG   K+G +RP R+++F +W  EE GLIGS E+T  + + L ER ++Y+N+D     + +      P +   + ++S+ V    + S ++Y +W+K    ++  +   PR+ +L G GSD+  F + LGI S    Y Y+++  N    PAYHT YD  D   KYIDP  V HQ V+R   + +IRL+ S ++P
Sbjct:   77 HMATSPGDEQTVQFMLKRWKDPSSGLDDAWRQEYAVYLSFPDPEKPNKVTVV--DPSDAELYTVREKEKPYYDDQRHPDVVQPYAAYAPAGHPRGKLVYAHQGKAADYELLNK-TVDLRGT--IAITRYGGAGRAAKA---INGAPYGVVG-VLVYTDPLDI-----NDGVMSDTSETYPHSWYLPPSGVERGSYSIPFGDMLTPYLAAKDDTYRIPRENVTEIPPIPVQPIGFEDAYKLICELGGDAAPSDWQGGFNCTYNNGGPGFNTDSVFNNSDVKLDIYNHETVKNSSNVMGIIRGSVEPDRYVIYGNHRDSWVHGAIDPSSGTSVMLEITRVLGSMVKQGKWRPRRSIIFGSWGAEEFGLIGSAEYTEDYFTKLSERTVSYINVDIATFANATLRASGVPSVQNVIFQASQQVSAPGHDSLSVYDNWIKYSNRTSPTHGLIPRMGYLTGAGSDYAAFVHYLGIASMDISYTYDRTKTNARIYPAYHTAYDTFDYASKYIDPGFVSHQAVARTAGNILIRLADSLLLP 595          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Medaka
Match: tfr1a (transferrin receptor [Source:NCBI gene;Acc:101171362])

HSP 1 Score: 132.109 bits (331), Expect = 2.313e-31
Identity = 130/495 (26.26%), Postives = 216/495 (43.64%), Query Frame = 1
Query:   76 MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKN-----CFPENSN---SYQFSKMSNNLQN----------KVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKS-TARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDL-LVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKM-VSDLQNPELPSLEGIFETVNFSSMQTP----IPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLM 1485
            +NH    K  I+ K     +N  +    +  IF+  +G +IG  + +K      C    S    +Y     +  L +          K++ + L    S ++ E H+AGS  + +L   + + + ++G+ + T  H  +++   A+  N    R+ F D      T     G L    SYS  G   G  ++ +YG  S+  L+LDK NI+  G   +L+ R G    A K    +    K    ++L+YPD  D ++D+N +                     ++G+  +   D   P  PS    F    F  +Q+     I  Q I+   A K+   +    +P  W     + L    +  + V VNN + E  I NV G+I GF D DRYV++G  RDAW  G +    GT +L ++A  + D  K   F+P R+++FA+W   E G +G+ E+   + S L  +  +Y+N+D  + G   F   A+PLM
Sbjct:   56 LNHAASSKPYISQKLGRTPKNLCFTAAAVFLIFI--IGFLIGYAVSQKKEQAPVCAASVSTADTTYTHETGAAPLMDWDDVKRLFVQKLTPAKLEKTFSDFSKEDHRAGSPGDEELGNKVMDYFNLFGMTTWTDEHFIKVHDPPASGFN----RILFKDG-----TEERPKGFL----SYSATGSVTGGALYAHYGQESEFRLLLDK-NINISGR--VLLIRTGKISFAEK----VANAAKMNASAVLIYPDSADTSIDENTE---------------------LYGHVHLGTGDPYTPGFPS----FNHTQFPPVQSSGLPSILAQTITRAMATKILGKLGGQNLPQGW--GASKKLGDEGD-SITVQVNNVLAEKKIHNVFGVIKGFVDSDRYVVIGAQRDAWGPGFAASTVGTSVLVELARSISDMVKNDGFKPRRSIVFASWSAGEYGSVGATEWQEGYLSSLSMKAFSYINLDGIVAGRNGFKVAASPLM 500          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Medaka
Match: tfr1b (transferrin receptor protein 1 [Source:NCBI gene;Acc:101172614])

HSP 1 Score: 128.642 bits (322), Expect = 2.695e-30
Identity = 126/491 (25.66%), Postives = 213/491 (43.38%), Query Frame = 1
Query:  493 DKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLN-ISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVS-DLQNPELPSLEGIFETVNFSSMQTP----IPTQPISYNDAGKLFQFMTNGPVPNSWQN------CLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWIN-SSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYH-TRYDNIDMMLKYIDPQLVHH-----QIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSI 1908
            ++I F     + +G L    +YS  G  +GR V+ NYG  +DL +++K+  +  C    +L+ R G    A +++   +R       ++L+YPD  +F   Q N+                  D  ++G+  + S D   P  PS    F    F+  Q+     I  Q I+   A  LF+    GP   +          +   L  A N  +EV  NN +    I N+ G++ GF D DR+V+LG  RDAW  G +    GT +L ++A       ++  FRP R+++FA+W   E G IG+ E+   + S + ++   Y+++D  + G  S    A+PL++  M  + + V     S TLY+     M   A   E  +  +       PF    GIPS    + +  S A    Y+ T  DN D    +++ Q   H        +RF     +RL +  ++   + R   +L R    + K++ ++
Sbjct:  185 NQIEFGSEVFKPSGFL----AYSATGRVQGRLVYANYGRQTDLDLVEKITKLEGC----VLLIRAGNLSFAEQVENGARRGAS----AVLIYPDVEEF---QQNE------------------DIELYGHVHLGSGDPYTPGFPS----FNHTQFAPTQSSGLPKILAQTITAKTAKSLFR-QIGGPEAEASSGFKGNLASVTYSLGGAKNISVEV--NNQLVSTEIHNIFGVVKGFSDPDRFVVLGAQRDAWGPGYAKATVGTSVLLELAKAFHAMVEKQGFRPRRSIVFASWSAGEYGSIGATEWLEGYMSSIDKKVFTYISLDGMVMGRGSLIASASPLLLSLMESTMKEVEAPLGSGTLYE-----MMGGAGWEEKVMRPMAMDDPAYPFMAFSGIPSV--SFHFITSNAEYYTYYGTLLDNSD----HLNYQTNQHTAEITATAARFAGLMALRLVHDHLLSLDVSRYGRVLTRDVSRVYKRVQAL 624          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Planmine SMEST
Match: SMESG000060624.1 (SMESG000060624.1)

HSP 1 Score: 1464.9 bits (3791), Expect = 0.000e+0
Identity = 738/745 (99.06%), Postives = 740/745 (99.33%), Query Frame = 1
Query:   76 MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFNDFXXXXXXXXXXXXXPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSIDLYNGRKVGLTVVLRQXXXXXXXXRTAIDLLNGGLAGRID 2310
            MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVD NNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQ CLPQYLQSAN+YELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDW KKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLL+RFKDLQKKLNSIPFIKQSNYSDIIESQLVLLD TANSFSEFINSKKNLFNDFLLLRKLNDILLNLPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSIDLYN RKVGLTVVLRQLSLLSNSLRTAIDLLNGGLAGRID
Sbjct:    1 MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDPNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQKCLPQYLQSANSYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWHKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLQRFKDLQKKLNSIPFIKQSNYSDIIESQLVLLDSTANSFSEFINSKKNLFNDFLLLRKLNDILLNLPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTGVYDSIDLYNERKVGLTVVLRQLSLLSNSLRTAIDLLNGGLAGRID 745          
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Planmine SMEST
Match: SMESG000060624.1 (SMESG000060624.1)

HSP 1 Score: 1127.08 bits (2914), Expect = 0.000e+0
Identity = 546/556 (98.20%), Postives = 548/556 (98.56%), Query Frame = 1
Query:   76 MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYDNIDMML 1743
            MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVD NNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQ CLPQYLQSAN+YELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDW KKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTR+  I   L
Sbjct:    1 MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNCFPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAEIMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVELNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILITRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDPNNKSSNPHNTPVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIPTQPISYNDAGKLFQFMTNGPVPNSWQKCLPQYLQSANSYELEVIVNNDVQEVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASILGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYVNMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWHKKMPNSANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRWCTIRSYL 556          
The following BLAST results are available for this feature:
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOLH11.836e-7529.83folate hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:37... [more]
FOLH12.938e-7529.53folate hydrolase 1 [Source:HGNC Symbol;Acc:HGNC:37... [more]
NAALAD21.093e-7429.04N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
NAALAD21.093e-7429.04N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
NAALAD21.485e-6928.53N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcp-2.22.646e-6126.65Glutamate CarboxyPeptidase 2 homolog [Source:UniP... [more]
gcp-2.18.109e-6027.43Glutamate carboxypeptidase 2 homolog [Source:UniP... [more]
gcp-2.11.084e-5927.43Glutamate carboxypeptidase 2 homolog [Source:UniP... [more]
gcp-2.12.079e-5429.18Glutamate carboxypeptidase 2 homolog [Source:UniP... [more]
gcp-2.39.606e-3825.94Glutamate CarboxyPeptidase 2 homolog [Source:UniP... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naalad22.298e-7128.35N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
si:ch211-214j8.12.963e-6230.43si:ch211-214j8.1 [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
tfr1a1.411e-3224.23transferrin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
tfr1a1.411e-3224.23transferrin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
tfr1b2.051e-3222.53transferrin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naalad24.947e-7727.63N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
naalad25.094e-7728.94N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
naalad25.339e-7728.94N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
naalad27.647e-7728.94N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
naalad21.322e-7628.94N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naalad28.517e-7729.77N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
Naalad21.031e-7629.77N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
Naalad21.031e-7629.77N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
Naaladl12.400e-7431.42N-acetylated alpha-linked acidic dipeptidase-like ... [more]
Folh12.012e-7227.03folate hydrolase 1 [Source:MGI Symbol;Acc:MGI:1858... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CZR2|NALD2_MOUSE5.957e-7629.77N-acetylated-alpha-linked acidic dipeptidase 2 OS=... [more]
sp|Q04609|FOLH1_HUMAN1.411e-7429.53Glutamate carboxypeptidase 2 OS=Homo sapiens OX=96... [more]
sp|O54697|NALDL_RAT1.514e-7431.10Aminopeptidase NAALADL1 OS=Rattus norvegicus OX=10... [more]
sp|Q9Y3Q0|NALD2_HUMAN5.248e-7429.04N-acetylated-alpha-linked acidic dipeptidase 2 OS=... [more]
sp|Q7M758|NALDL_MOUSE1.679e-7331.42Aminopeptidase NAALADL1 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183P8F38.741e-11134.15Peptidase_M28 domain-containing protein OS=Schisto... [more]
A0A095BTG22.200e-11034.55N-acetylated-alpha-linked acidic dipeptidase 2 OS=... [more]
A0A430QMF82.796e-10935.32N-acetylated-alpha-linked acidic dipeptidase OS=Sc... [more]
G4VIQ51.790e-10633.59NAALADASE L peptidase (M28 family) OS=Schistosoma ... [more]
A0A5K4ENR64.729e-10633.59NAALADASE L peptidase (M28 family) OS=Schistosoma ... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naalad22.089e-7328.82N-acetylated alpha-linked acidic dipeptidase 2 [So... [more]
si:ch211-214j8.11.432e-7031.47N-acetylated alpha-linked acidic dipeptidase like ... [more]
si:ch211-214j8.19.787e-6930.65N-acetylated alpha-linked acidic dipeptidase like ... [more]
si:ch211-214j8.12.319e-6832.43N-acetylated alpha-linked acidic dipeptidase like ... [more]
tfr1a1.244e-3526.65transferrin receptor protein 1-like [Source:NCBI g... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-214j8.18.340e-3028.45si:ch211-214j8.1 [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS703.332e-2726.39Protein of unknown function involved in vacuolar p... [more]
TRE19.575e-1023.08Transferrin receptor-like protein; plasma membrane... [more]
TRE27.521e-824.05Transferrin receptor-like protein; functions with ... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349733.395e-8028.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332782.867e-7828.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429314.634e-7830.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407152.855e-7729.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430502.436e-7628.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naalad22.880e-7127.30folate hydrolase 1B [Source:NCBI gene;Acc:10117069... [more]
si:ch211-214j8.12.727e-6531.33N-acetylated alpha-linked acidic dipeptidase like ... [more]
si:ch211-214j8.14.002e-6531.33N-acetylated alpha-linked acidic dipeptidase like ... [more]
tfr1a2.313e-3126.26transferrin receptor [Source:NCBI gene;Acc:1011713... [more]
tfr1b2.695e-3025.66transferrin receptor protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of N-acetylated-alpha-linked acidic dipeptidase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060624.10.000e+099.06SMESG000060624.1[more]
SMESG000060624.10.000e+098.20SMESG000060624.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027481 ID=SMED30027481|Name=N-acetylated-alpha-linked acidic dipeptidase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2370bp
AACTATTAAAATTTTTATATGAAACTCATCTTCAACTAGGTTGAAATATA
TTAAATTTGTAATTTTTTTCACAAAATGAATCATCCGAATTATGAAAAAA
TTAACATAACATCTAAAAAATGTTGCAATTTCCAAAATAGTATATGGCTG
AAAATATTAATTATATCTATTTTTGTACTCGCCGTTGGCATTATTATTGG
AATATATATTCCCAGAAAGAATTGTTTTCCTGAAAATTCTAATAGTTATC
AGTTCTCAAAAATGTCGAACAATTTGCAAAATAAAGTTTCTGAAAGCTTT
TTGCTCGACCAATTGTCAATTTATGCATCAGAAATTCATCAGGCCGGTTC
CGAAAGGAATCTGAAATTAGCTGAAATCATGGAAAACAATTGGAAAATCT
GGGGATTAAAATCTACAGCTAGACATAAATATAGAATTAATAAAACTGTT
GCCAATCAGAATAATCCCAGTATCGTCCGATTATGGTTTGGGGATAAAAT
TGTTTTCAATCTCACTACAGTTGAGTTGAACGGCTTGCTTCCCCTTTATA
GTAGCTACTCAATCGCAGGACACGCTAAAGGAAGATTTGTCTTCATCAAT
TATGGTTTAATTTCTGACTTACTAGTTCTCGATAAACTCAACATATCTTA
TTGTGGATCGGATGTCATCCTGATCACTCGTTTAGGATTTTCTATACGAG
CGGCAAAGATGAAAACCATAATAAAAAGGTGTGGGAAGCATTTACCTGGA
AGTTTATTGGTTTATCCTGATCCGTGGGATTTTGCAGTTGATCAAAACAA
CAAATCATCGAATCCTCATAATACACCTGTCTATCCCGATAGTTGGTGGT
TACCAGGTGATGCTGGTGTATTTGGCAATTTCAAAATGGTTTCTGACCTG
CAGAACCCAGAGTTACCTAGTCTCGAAGGAATTTTTGAAACTGTAAATTT
TAGCTCAATGCAAACTCCTATTCCTACTCAACCGATTTCCTATAATGATG
CTGGAAAATTGTTTCAGTTCATGACAAACGGACCAGTGCCGAATTCATGG
CAAAATTGTTTGCCACAATATTTACAATCTGCAAATAATTATGAATTAGA
AGTTATCGTTAATAACGATGTTCAAGAAGTCACAATTGCAAACGTGATTG
GTATGATTCCTGGGTTTCCCGATGGAGATCGGTATGTTATTCTTGGAAAT
CACAGAGACGCGTGGGCTACTGGTGCCAGTGATCCGGTTTCTGGAACGAT
TATTTTGCAACAAGTAGCTTCTATATTAGGTGATGCCTACAAAAGAGGAA
CTTTTCGACCTTTTCGAACTCTTTTATTTGCAAATTGGGATGGGGAAGAA
GAAGGGTTGATTGGTAGTAATGAATTTACAAATCAATTCGGTTCCGATTT
GCTGGAGCGCTGTATTGCTTATGTTAACATGGATTGCCCAATAAAGGGTA
GTTGGTCATTTAATGGTAGAGCAACTCCATTAATGATTGGACCAATGTTG
AAATCGAGTGAAAATGTATGGATAAATTCGTCAACCACTCTTTATCAAGA
TTGGCTTAAGAAAATGCCAAATTCTGCAAATAAAAATGAACCTCGGGTCA
ATTTTCTTGGAGGTGGTAGCGATCACATACCATTTGCTTACGTTCTCGGA
ATTCCGTCGGCATATCCTGAATATAAATACAATCAATCATTGGCTAACAT
GCCTGCATATCATACACGGTATGACAATATTGATATGATGCTGAAATATA
TTGATCCTCAGTTGGTGCACCATCAGATCGTATCTCGATTTGTGATCGAT
TACATGATCCGATTATCATATTCCCCAATTATTCCATATAGTATCGATCG
TTTAGTCGATCTTTTGCTTCGGAGATTCAAAGATTTACAGAAGAAATTGA
ATTCTATCCCTTTTATTAAGCAATCAAACTATTCAGATATCATCGAATCA
CAATTGGTTCTCCTTGATTTCACAGCCAATTCTTTCAGTGAATTTATTAA
TTCAAAAAAGAATCTGTTCAATGACTTTTTGCTTTTGAGGAAATTAAACG
ATATTTTGTTGAATTTACCAAGAATGTTCTTGACGAGGGAAGGGTTACCG
ATGAGACCTTATCTGAGGAATATTCTGTTATCAACGAAATTGAAAAATAG
CTACCAGGGCTCCATTTTTACTGGAGTTTATGATTCAATCGATTTATATA
ATGGAAGAAAGGTCGGTTTAACTGTCGTGTTGCGGCAGTTGTCATTACTG
TCCAATTCGTTGCGAACAGCGATAGATTTGCTCAATGGCGGATTAGCTGG
GAGAATTGATTGACTATTTGTCAGTAATTAACATTTTTTAAATAATTTTA
ATTTTGTTTGAAAAAAAAAG
back to top

protein sequence of SMED30027481-orf-1

>SMED30027481-orf-1 ID=SMED30027481-orf-1|Name=SMED30027481-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=746bp
MNHPNYEKINITSKKCCNFQNSIWLKILIISIFVLAVGIIIGIYIPRKNC
FPENSNSYQFSKMSNNLQNKVSESFLLDQLSIYASEIHQAGSERNLKLAE
IMENNWKIWGLKSTARHKYRINKTVANQNNPSIVRLWFGDKIVFNLTTVE
LNGLLPLYSSYSIAGHAKGRFVFINYGLISDLLVLDKLNISYCGSDVILI
TRLGFSIRAAKMKTIIKRCGKHLPGSLLVYPDPWDFAVDQNNKSSNPHNT
PVYPDSWWLPGDAGVFGNFKMVSDLQNPELPSLEGIFETVNFSSMQTPIP
TQPISYNDAGKLFQFMTNGPVPNSWQNCLPQYLQSANNYELEVIVNNDVQ
EVTIANVIGMIPGFPDGDRYVILGNHRDAWATGASDPVSGTIILQQVASI
LGDAYKRGTFRPFRTLLFANWDGEEEGLIGSNEFTNQFGSDLLERCIAYV
NMDCPIKGSWSFNGRATPLMIGPMLKSSENVWINSSTTLYQDWLKKMPNS
ANKNEPRVNFLGGGSDHIPFAYVLGIPSAYPEYKYNQSLANMPAYHTRYD
NIDMMLKYIDPQLVHHQIVSRFVIDYMIRLSYSPIIPYSIDRLVDLLLRR
FKDLQKKLNSIPFIKQSNYSDIIESQLVLLDFTANSFSEFINSKKNLFND
FLLLRKLNDILLNLPRMFLTREGLPMRPYLRNILLSTKLKNSYQGSIFTG
VYDSIDLYNGRKVGLTVVLRQLSLLSNSLRTAIDLLNGGLAGRID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036757TFR-like_dimer_dom_sf
IPR039373Peptidase_M28B
IPR007484Peptidase_M28
IPR007365TFR-like_dimer_dom
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004180carboxypeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0016805dipeptidase activity
GO:0046872metal ion binding
GO:0050129N-formylglutamate deformylase activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0008152metabolic process
GO:0042135neurotransmitter catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036757Transferrin receptor-like, dimerisation domain superfamilyGENE3DG3DSA:1.20.930.40coord: 594..738
e-value: 4.3E-17
score: 64.2
IPR036757Transferrin receptor-like, dimerisation domain superfamilySUPERFAMILYSSF47672Transferrin receptor-like dimerisation domaincoord: 587..738
IPR007484Peptidase M28PFAMPF04389Peptidase_M28coord: 356..554
e-value: 1.7E-17
score: 63.8
IPR007365Transferrin receptor-like, dimerisation domainPFAMPF04253TFR_dimercoord: 624..736
e-value: 9.9E-14
score: 51.5
NoneNo IPR availableGENE3DG3DSA:3.50.30.30coord: 127..345
e-value: 5.8E-116
score: 390.2
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 79..587
e-value: 5.8E-116
score: 390.2
NoneNo IPR availableCDDcd08022M28_PSMA_likecoord: 67..119
e-value: 0.00331706
score: 37.9801
NoneNo IPR availableCDDcd08022M28_PSMA_likecoord: 329..588
e-value: 6.04688E-69
score: 226.343
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 67..585
NoneNo IPR availableSUPERFAMILYSSF52025PA domaincoord: 133..358
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
IPR039373Glutamate carboxypeptidase 2-likePANTHERPTHR10404N-ACETYLATED-ALPHA-LINKED ACIDIC DIPEPTIDASEcoord: 26..737