Neurogenic locus Notch protein

Overview
NameNeurogenic locus Notch protein
Smed IDSMED30027457
Length (bp)3768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurogenic locus Notch protein (SMED30027457) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurogenic locus Notch protein (SMED30027457) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurogenic locus Notch protein (SMED30027457) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurogenic locus Notch protein (SMED30027457) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027457

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027457SMESG000066558.1 SmedASXL_015568SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30027457SMESG000066558.1 dd_Smed_v4_12732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30027457SMESG000066558.1 dd_Smed_v4_12732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027457SMESG000066558.1 dd_Smed_v6_12732_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30027457SMESG000066558.1 dd_Smed_v4_12732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: NOTCH1 (notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881])

HSP 1 Score: 191.045 bits (484), Expect = 3.261e-48
Identity = 236/973 (24.25%), Postives = 378/973 (38.85%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP----------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL----------------KETRKEALINIKIPKTFNEKQLII---------KKTKSPSLCDNLC-----KASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLT---------KCSTQTKLYELDLVLMTTM----------QNFTKYKSE--------------------FLQKLSSSLRMVVTVFNVTEINFNF--ATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVN--ENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGI------NLGTPCEYFVKK-TTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C + PC NG         ++CSC  G +G  CE NV+DC  NP          C N GTC+D+    ++C C   F+G  C+ + N CL+  C+  GT   ++    F C+CR G  G  C        VI   K + C N G C +  N      CKC  G+ G  C+          C S  C NGG C +    SP C C G FTG  C  P                 + T +        P  FN     I          +   P L +  C     +    N +C  QCN  AC +DGGDC     DPW+ C       C   F+DG C+ +CN+  CLFDG DC ++  + +      C + + +  CD+ CNS +C +DG DC         +   +          + S+   L EL  VL T +            F  Y  E                     L ++ +SL    +         +       ++ L ++  QCV    QCF S   ++ FL A    G+ L++P+++  V +  +      +L    +   A      +     GVLL  K  +   ++     +  S              + G   L    D        N+  +G+   +T + R       PD     ++R+   + ++      A  L   ++  T     +DA   DV    +V+    +      S   G  E  N  E  ++   I+  +  GA++  Q +    + LH    + R+  A  +   + ++      ++  + +      V +   G+      N  T  +  +   TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N +++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1187 CLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDC--NPPVDPVSRSPKCFNNGTCVDQVGG-YSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCES------VINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDART-----CGSLRCLNGGTC-ISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGS-LNIPYKIEAVQSETVEPPPPAQLHFMYV---AAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD--GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLD------AADLRMSAMAPTPPQGEVDADCMDV----NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADAN-----IQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRL---PRDIAQERMHHDIVRLLDE 2115          

HSP 2 Score: 100.523 bits (249), Expect = 1.861e-20
Identity = 72/213 (33.80%), Postives = 102/213 (47.89%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CS++PC +G   +  D  + C C  G  G  CE N++DC  +PC + GTC+DK +  + C C   + G++C    + C    C NGGTCE   NG F C+C  G+    C  +   C   P         HG C    N    C CDPG++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  607 CSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDS-GTCLDKIDG-YECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGING-FTCRCPEGYHDPTCLSEVNECNSNPCV-------HGACRDSLN-GYKCDCDPGWSGTNCDINNNE-----CESNPCVNGGTCKDMTSGY-VCTCREGFSGPNCQTNINECASNPCLN 802          

HSP 3 Score: 95.5153 bits (236), Expect = 6.032e-19
Identity = 69/220 (31.36%), Postives = 98/220 (44.55%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +++  C + PCVNG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC    C NGG C   E+   F C C  G+ G+ C V    C + P +    C N HG           C C  GY+G  C+   +      C+ + C NGG C    N +  C+C   F G  C   + E   +   N
Sbjct:  752 INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHG--------GYRCHCQAGYSGRNCETDID-----DCRPNPCHNGGSCTDGIN-TAFCDCLPGFRGTFCEEDINECASDPCRN 956          

HSP 4 Score: 89.7373 bits (221), Expect = 3.029e-17
Identity = 71/215 (33.02%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PCV+G C ++ +  ++C C  GW G  C+ N N+C  NPC NGGTC D   S + C C   F G  CQ   N C +  C N GTC     G ++C C   + G  C V    C   P      C N GEC    +   F C C  G+ G  C+      V+I  C    C +G  C+    G   C C+  ++G+NC   + + R     N
Sbjct:  720 CNSNPCVHGACRDSLN-GYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKD-MTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG-YKCNCLLPYTGATCEVVLAPCAPSP------CRNGGECRQSEDYESFSCVCPTGWQGQTCE------VDINECVLSPCRHGASCQNTHGGY-RCHCQAGYSGRNCETDIDDCRPNPCHN 918          

HSP 5 Score: 86.6557 bits (213), Expect = 2.583e-16
Identity = 68/201 (33.83%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC--IDKKN-SQFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C+NG   EA +    C C   + G  C++  N C+  PCKN GTC  +D++  + + C+C   F G LC    +N CL   C NGGTC+ L    ++C+C  G+ G+ C  Q   C   P      C N G+C  +   +  C C P + G  C +      E G K   C +GG C   + GS  C C+   TG NC  P
Sbjct:   31 CLNGGKCEAANGTEACVCGGAFVGPRCQD-PNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNP------CANGGQCLPF-EASYICHCPPSFHGPTCRQDVN---ECGQKPGLCRHGGTCHN-EVGSYRCVCRATHTGPNCERP 218          

HSP 6 Score: 85.8853 bits (211), Expect = 4.742e-16
Identity = 67/209 (32.06%), Postives = 95/209 (45.45%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  C    D    C+C  G+ G+ CEEN++DC  N CKNGG C+D  N+ + C C  ++ G  C  + + C  +   C+NGGTC +   G + C C  G+ GE C+     C          C++          + +C+C  G TG  C       +   C S+ C  G  C     NG  IC C   +TG  C+  + E
Sbjct:  222 CSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNT-YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG-YNCVCVNGWTGEDCSENIDDCASAACFHGATCHDR-------VASFYCECPHGRTGLLCH------LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDE 415          

HSP 7 Score: 81.2629 bits (199), Expect = 1.122e-14
Identity = 68/211 (32.23%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLK 949
            C++ PC +G C++  D  + C+C  G+ G  C  N+++C  NPC NGGTC D  N  FTC C   +    C  E      NPC++      G C    NG ++C C  G+ G  C + N  C   P      C N G C    +MT    C C  G++G  C           C S+ C N G C + D     C C   +TG  C + L 
Sbjct:  645 CASSPCDSGTCLDKID-GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGING-FTCRCPEGYHDPTCLSEVNECNSNPCVH------GACRDSLNG-YKCDCDPGWSGTNCDINNNECESNP------CVNGGTCK---DMTSGYVCTCREGFSGPNCQTNINE-----CASNPCLNQGTC-IDDVAGYKCNCLLPYTGATCEVVLA 831          

HSP 8 Score: 81.2629 bits (199), Expect = 1.190e-14
Identity = 63/203 (31.03%), Postives = 88/203 (43.35%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFD----PEFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC N       D     ++ CSC  G+ G  C   + N C+ NPC+NGGTC     +++ C C   + G  CQ  +PC +  C NGG C   E   + C C   F G  C      C     +K  LC + G C      +  C C   +TG  C++       + C    C NGG C+   + +  C C   FTG+NC
Sbjct:   63 CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFE-ASYICHCPPSFHGPTCRQDVNEC----GQKPGLCRHGGTCHNEVG-SYRCVCRATHTGPNCERPY-----VPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNC 254          

HSP 9 Score: 79.337 bits (194), Expect = 4.325e-14
Identity = 56/165 (33.94%), Postives = 72/165 (43.64%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLEN---GMFQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C NGG C +  N    C C   F+G  CQ  NPCL+  C+N GTC  ++      + C C  GF G  C    + AC   P      C N G CD+       C+C PG++G  C +         C S+ C NGG C   +  S IC C   F G  C   + E
Sbjct:   31 CLNGGKC-EAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNP------CRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADP------CASNPCANGGQCLPFE-ASYICHCPPSFHGPTCRQDVNE 181          

HSP 10 Score: 66.2402 bits (160), Expect = 4.577e-10
Identity = 56/183 (30.60%), Postives = 77/183 (42.08%), Query Frame = 2
Query:  395 FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            +RC C     G  CE     C  +PC+NGGTC    +    C C   F G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P      C N G C    +    C C  G+TG+ C +  +      C S  CF+G  C      S  CEC    TG  C +
Sbjct:  202 YRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNA----CQNGGTCHNT-HGGYNCVCVNGWTGEDCSENID-----DCASAACFHGATCHDR-VASFYCECPHGRTGLLCHL 372          
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: NOTCH2 (notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882])

HSP 1 Score: 154.836 bits (390), Expect = 4.969e-37
Identity = 134/441 (30.39%), Postives = 194/441 (43.99%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP-CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCD--------KKKELPV----------------EIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC-DNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSS--CKFHK-CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNV 1537
            C N+PC NG  C++  +  F+CSC  G +G  CEEN++DC + P C NGG C+D+    ++C C   F G  C+ + N CL+  C + G+  C  L N  + C CR  F G  C      CP +P      C N G C +  NM     C+C PG++G RC         +K E  V                E GC S  C +GG C       P   C+C   F+G  C +                            +  P+ C    C     +G+CD+ CN+ AC +DGGDC     +PW  C  +    C    N+  C+  CN V+CLFD  +C  +S  CK+ K C++ +++  CD+ CNS +CG+DG DC   +  +               L E  LV++  M        + LQ   S LR + T+ + 
Sbjct: 1191 CQNQPCQNGGTCIDLVN-HFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGG-YSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTND-YLCVCRSAFTGRHCETFVDVCPQMP------CLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHP-QRQPPYYSCQCAPPFSGSRCEL-----------------------YTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANC--SSPLPCWDYINN-QCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPEN---------------LAEGTLVIVVLMP-----PEQLLQDARSFLRALGTLLHT 1575          

HSP 2 Score: 109.383 bits (272), Expect = 3.303e-23
Identity = 115/427 (26.93%), Postives = 166/427 (38.88%), Query Frame = 2
Query:  170 ASCKACSFTCDIISSHNFIKIIFNHQFQSELIMIFAKGFPMNVFILGCLLVIVSSKL------CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ--FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECD-IYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP--ICECKGEFTGKNCTIPLKETR----KEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH---------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSF 1378
            A C   + +CDI +S     ++  H  Q   + I A     N     C L    S        C++ PC +G     F   +RC C  G++G  CE  V++C   PC+NGGTCID  N  F C+C     G LC+   ++     +C NGG C     G + C+C  GF GE C      C   P      C++ G  D I       C C   +TG  C+   ++     C    C NGG C V  N     IC C   F+G  C     + +    ++ +     P+ F           SP  C++ C +S              C + GG C P R+            +    C P        F G  C           ++C    C++  ++ +CDE CNS  C +DGGDC  +  N +
Sbjct: 1096 AYCDVPNVSCDIAASRR--GVLVEHLCQHSGVCINAG----NTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVN-HFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGG-YSCRCLPGFAGERCEGDINECLSNP------CSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDV-----CPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCF---------CPSPRDCESGCASS-------------PCQH-GGSCHPQRQ----------PPYYSCQCAPP-------FSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPW 1463          

HSP 3 Score: 103.219 bits (256), Expect = 2.859e-21
Identity = 84/250 (33.60%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICD 1087
            C ++PC+N          + C C  G+ G  CEE+++DC+ NPC+NGG+C+D  N+ F+C C   F G+ CQ + N CL+  C+NGGTC    N  + CKC+ GF G  C         I +     C N G C    N +  C C  G+TG  C  +        C S  C N G C V   G+  C C   +TGKNC         + L+N+        K   ++K K+ S C  LC + +    CD
Sbjct:  877 CISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNT-FSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNS-YTCKCQAGFDGVHCENN------INECTESSCFNGGTCVDGIN-SFSCLCPVGFTGSFCLHEINE-----CSSHPCLNEGTC-VDGLGTYRCSCPLGYTGKNC---------QTLVNLCSRSPCKNKGTCVQK-KAESQC--LCPSGWAGAYCD 1099          

HSP 4 Score: 94.3597 bits (233), Expect = 1.270e-18
Identity = 67/235 (28.51%), Postives = 118/235 (50.21%), Query Frame = 2
Query: 2243 DEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  YQ +SL+      +  GE  +H+AAR +      + ++A   +  ++ D  GR PL +++AADA +   Q+LI  +    +++ N                     TT LI A +L  + M++ L++  + VN +D  G+S +HW+A  NN   +E    +       D++DN++++PLFLAA EG+ ++ K LL +F    I   MD     P+ +A ++  ++I  L+ E
Sbjct: 1861 DLVYQGASLQA---QTDRTGEMALHLAARYSRADAAKRLLDAG--ADANAQDNMGRCPLHAAVAADA-QGVFQILIRNRVTDLDARMND-------------------GTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNN---VEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRL---PRDVARDRMHHDIVRLLDE 2064          

HSP 5 Score: 91.2781 bits (225), Expect = 1.121e-17
Identity = 70/201 (34.83%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC++G C       ++C C  GW G  CE + N+C+ NPC+NGGTC +  N  + C C   F G  CQ   + C +  C N GTC    +G + C C   + G+ C  Q +  P  P      C N   C   PN   + C C PG+ G RC       ++I  C S  C N G+C     GS +CEC   F+G +C
Sbjct:  724 CLSNPCIHGNCTGGLS-GYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNG-YRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISG-YTCHCVLPYTGKNC--QTVLAPCSPNP----CENAAVCKESPNFESYTCLCAPGWQGQRCT------IDIDECISKPCMNHGLCHNT-QGSYMCECPPGFSGMDC 908          

HSP 6 Score: 90.1225 bits (222), Expect = 2.838e-17
Identity = 71/219 (32.42%), Postives = 99/219 (45.21%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            V    C + PC NG   +     +RC+C  G+KG  C+ N+++C  NPC N GTC D   S +TC+C   + G  CQ    PC    CEN   C+   N   + C C  G+ G+ C +    C   P      C NHG C      +  C+C PG++G  C++  +      C ++ C NGG C    N +  C C   FTG  C   + E   E   N
Sbjct:  756 VDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDI-SGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKP------CMNHGLCHNT-QGSYMCECPPGFSGMDCEEDID-----DCLANPCQNGGSCMDGVN-TFSCLCLPGFTGDKCQTDMNECLSEPCKN 960          

HSP 7 Score: 88.5817 bits (218), Expect = 7.618e-17
Identity = 72/203 (35.47%), Postives = 100/203 (49.26%), Query Frame = 2
Query:  350 RPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQF--ENPC-LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK---KKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
             PCVN G CV   +    C C  G+ GE C+   + C +N C+NGGTC+ +    + TC C S F G  CQ+   +PC ++  C NGGTC  L    ++C C+ GF G+ C   + AC   P      C N   C    N    CKC  G+TG +C+    + ++P        +C +GG C  L  GS  C+C   FTG+ C
Sbjct:   33 EPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHR-DPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTD-ACLSHP------CANGSTCTTVANQ-FSCKCLTGFTGQKCETDVNECDIP-------GHCQHGGTCLNLP-GSYQCQCPQGFTGQYC 218          

HSP 8 Score: 88.1965 bits (217), Expect = 1.006e-16
Identity = 68/209 (32.54%), Postives = 97/209 (46.41%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCL--NVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            C+  PCVNG  C +  D  F C+C  G++G TCE N++DC  + C+NGG C+D  N+ + C C  Q+ G  C  + + CL     C+NGGTC +  NG + C C  G+ G+ C+     C          C       I    +  C C  G  G  C       ++  C S+ C  G +C     NG  IC C   + G +CT  + E
Sbjct:  225 CAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNT-YNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCAN-RNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTC-------IDRVASFSCMCPEGKAGLLCH------LDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDE 418          

HSP 9 Score: 86.6557 bits (213), Expect = 3.066e-16
Identity = 65/193 (33.68%), Postives = 88/193 (45.60%), Query Frame = 2
Query:  365 GKCV-EAFDPEFRCSCWHGWKGETCEENV-NDC-IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            G CV +A   +  C C  G+ GE C+ +  + C +  PC NGGTC       + C C   F G  CQ+ + CL+  C NG TC ++ N  F CKC  GF G+ C      C  IP      C + G C   P  +  C+C  G+TG  CD      + + C    C NGG C+   + +  C C   F G  C
Sbjct:   77 GTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVAN-QFSCKCLTGFTGQKCETDVNECD-IPGH----CQHGGTCLNLPG-SYQCQCPQGFTGQYCDS-----LYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTC 257          

HSP 10 Score: 86.2705 bits (212), Expect = 3.723e-16
Identity = 65/210 (30.95%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDN-GSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NG      +  + C C +GW G+ C EN++DC    C  G TCID+  S F+C C     G LC  ++ C++  C  G  C++   NG + C C  G+ G  C      C +        C + G+C +  +    C+C  GY G RC+      ++I  C SD C N   C  LD  G   C C   F G +C + + E +    +N
Sbjct:  309 CQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVAS-FSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAM---ANSNPCEHAGKC-VNTDGAFHCECLKGYAGPRCE------MDINECHSDPCQNDATC--LDKIGGFTCLCMPGFKGVHCELEINECQSNPCVN 505          

HSP 11 Score: 85.1149 bits (209), Expect = 9.659e-16
Identity = 69/205 (33.66%), Postives = 92/205 (44.88%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            GKCV   D  F C C  G+ G  CE ++N+C  +PC+N  TC+DK    FTC C   F G  C+ E N C +  C N G C    N  FQC C  GF G  C +    C   P      C N  +C  +PN    C+C  G+TG  C++  +      C  D C +G     +D  S  C C   + G  C+  + E      +N
Sbjct:  431 GKCVNT-DGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGG-FTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVN-RFQCLCPPGFTGPVCQIDIDDCSSTP------CLNGAKCIDHPN-GYECQCATGFTGVLCEENID-----NCDPDPCHHGQCQDGID--SYTCICNPGYMGAICSDQIDECYSSPCLN 618          

HSP 12 Score: 82.0333 bits (201), Expect = 6.669e-15
Identity = 71/216 (32.87%), Postives = 103/216 (47.69%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDN-GSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC  G  C+   +  FRC C  G    +C   VN+C+ NPC +G        S + C C + ++G  C+ + N CL+  C+NGGTC++L NG ++C C+ GF G  C V    C   P      C N G C  + +++ + C C   YTG  C       V   C  + C N  VCK   N  S  C C   + G+ CTI + E   +  +N
Sbjct:  686 CASNPCRKGATCINGVN-GFRCICPEGPHHPSCYSQVNECLSNPCIHGN--CTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNG-YRCTCKKGFKGYNCQVNIDECASNP------CLNQGTC--FDDISGYTCHCVLPYTGKNCQT-----VLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMN 884          
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 138.272 bits (347), Expect = 2.679e-32
Identity = 107/386 (27.72%), Postives = 163/386 (42.23%), Query Frame = 2
Query:  407 CWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTL--FCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC--KVLDNGSPICECKGEFTGKNCTIPLKE----TRKEALINIKIPKTFNEKQLIIK----------KTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH-KSSCKF---HKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNE-----GLTKCSTQTKLYELDLVLMTTMQ 1459
            C  G+ G+ C + ++ C   PC N GTC  K    F C C   F+G  C+ + + CL+  C   GT  C SL N  F C+C  G  G++C V+   C        + C + G C+      L   C C  G+ G  C  +        C   +C +GG+C         P C C   + G +C  P            L N    +T        +          + + P      C+    +G CD  C+    N+DGGDC     DPW+ C  +    C  +F DG C+P+C++ +CLFDG DC    +C       C + + N  C++ CN+ +CG+DGGDC     +  +         L+  +   +L+ L  VL  T++
Sbjct:    1 CAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGG-FHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLAN-AFYCQCLPGHTGQWCEVEIDPC------HSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAP-----SCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGA--KGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSH--SRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLR 369          

HSP 2 Score: 87.0409 bits (214), Expect = 1.707e-16
Identity = 86/324 (26.54%), Postives = 122/324 (37.65%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT--CIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC--DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP--ICECK---------------------------------GEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIK-----------KTKSPSLC----DNLCKASFENGICDQQCNTFACNYDGGDCDP 1138
            C ++PC N G C       F C+C  G+ G  CE +V++C+  PC   GT  C    N+ F C C     G  C+ E +PC +  C +GGTCE+       F C C  GF G  C+ +  +C          C++ G C     P     C C  GY G  C      P   G  S   +NG   +    G P   C C                                  G + G +C++ + +  K    + +    F + Q   +             ++P  C    D  C   F NG C++ CNT  C +DGGDC P
Sbjct:   17 CQSQPCHNHGTCTPKPG-GFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANA-FYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPSC------GFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDC-LTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTAECGWDGGDCRP 331          

HSP 3 Score: 75.0998 bits (183), Expect = 6.894e-13
Identity = 57/215 (26.51%), Postives = 103/215 (47.91%), Query Frame = 2
Query: 2297 NGESLMHIAARMNSGANIIKQINA-INPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQ 2938
             GE+ +H+AAR +      + + A  NP+     D  GRTPL +++AADA E   QLL+  +Q   +++                       TT L+ A +L  ++++  L+   + V   D  G++ +HW+A  NN+     L      +   D +DN +++PLFLAA EGA++  + LL       ++ D     P  +A ++  +++  L++
Sbjct:  678 TGETPLHLAARFSRPTAARRLLEAGANPNQP---DRAGRTPLHAAVAADAREVC-QLLLRSRQTAVDARTED-------------------GTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAARSLLQAGADK---DAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELR-DQAGLAPADVAHQRNHWDLLTLLE 865          
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 137.887 bits (346), Expect = 6.315e-32
Identity = 115/408 (28.19%), Postives = 173/408 (42.40%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTL--FCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC--KVLDNGSPICECKGEFTGKNCTIPLKE----TRKEALINIKIPKTFNEKQLIIK----------KTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH-KSSCKF---HKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNE-----GLTKCSTQTKLYELDLVLMTTMQ 1459
            C +RPC NG    A    + C C  G+ G+ C + ++ C   PC N GTC  K    F C C   F+G  C+ + + CL+  C   GT  C SL N  F C+C  G  G++C V+   C        + C + G C+      L   C C  G+ G  C  +        C   +C +GG+C         P C C   + G +C  P            L N    +T        +          + + P      C+    +G CD  C+    N+DGGDC     DPW+ C  +    C  +F DG C+P+C++ +CLFDG DC    +C       C + + N  C++ CN+ +CG+DGGDC     +  +         L+  +   +L+ L  VL  T++
Sbjct:  934 CESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGG-FHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLAN-AFYCQCLPGHTGQWCEVEIDPC------HSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAP-----SCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGA--KGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSH--SRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLR 1324          

HSP 2 Score: 114.775 bits (286), Expect = 7.047e-25
Identity = 116/419 (27.68%), Postives = 163/419 (38.90%), Query Frame = 2
Query:  338 LCSNRPCV-NGKCVEAFDPEFRCSCWHGWKGETCEENVNDC----------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKE--------------------------LPVEIG---------CKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCT---------------------IPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKS------SCKFH-KCSELYQNKICDEECNSPQCGFDGGDCHT 1360
            LC+ +PC  N  C++   P F C C  GW G  C   ++ C          + + C NGG C+D   S F C+C   F G+LCQ   NPC +  C+NG TC +  +G + C+C  G+ G+ C+ +  AC      + + C+NHG C   P     C C PG+ G RC+   +                          LP   G         C S  CF+GG C+    GSP   IC C   F G  C+                      P    R   L     P              SP L +  C  +   G    +C+   C +      P  +C     K C+G   DG C+  C+     +DG DC          C  H +C  L+++  C  +C+S +C FDG DC T
Sbjct:  847 LCAQKPCPRNSHCLQT-GPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYF-CHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSG-YLCQCAPGYDGQNCSKELDAC------QSQPCHNHGTCTPKPG-GFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEAT-AGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCS---CPHS----SPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCET 1247          

HSP 3 Score: 88.5817 bits (218), Expect = 6.267e-17
Identity = 71/199 (35.68%), Postives = 89/199 (44.72%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            PC +G         F C C  G+ G  CE + N+C+  PC  G TC+D   + F C C     G LC+ E N C +  C N   C  L NG FQC C  GF G  C         I + +   C N G+C   P     CKC PG+ G RC  + +      C SD C  G  C  L  G+  C C   FTG+ C +PL
Sbjct:  445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLL-ATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNG-FQCICLPGFSGTRCEED------IDECRSSPCANGGQCQDQPG-AFHCKCLPGFEGPRCQTEVDE-----CLSDPCPVGASCLDLP-GAFFCLCPSGFTGQLCEVPL 628          

HSP 4 Score: 83.9593 bits (206), Expect = 1.704e-15
Identity = 53/150 (35.33%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  467 PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVN-CENGGTCESL-------------ENGMFQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            PC NGGTC+     Q TC C   F+G  CQF +PC N   C+NGG+C++L                 F C C  GF GE C  +    CP         C+  G C I  +    C C PG+TG++C  +        C ++ C NGGVC
Sbjct:   34 PCANGGTCLSLSLGQGTCQCAPGFLGETCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLEDPCPP------SFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDF------CSANPCVNGGVC 171          

HSP 5 Score: 82.8037 bits (203), Expect = 3.643e-15
Identity = 59/173 (34.10%), Postives = 77/173 (44.51%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            C NG   +     F C C  GW G +CEEN++DCI   C  G TCID+  S F+C C     G LC  E+ CL+  C     C +    G   C C+ G+ G  C      C ++ ++    C + G C   P  +  C C PGYTG RC+          C S  C  G  C
Sbjct:  326 CRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGS-FSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDEC-LMAQQGPSPCEHGGSCLNTPG-SFNCLCPPGYTGSRCEADHNE-----CLSQPCHPGSTC 490          

HSP 6 Score: 77.0258 bits (188), Expect = 2.380e-13
Identity = 57/215 (26.51%), Postives = 103/215 (47.91%), Query Frame = 2
Query: 2297 NGESLMHIAARMNSGANIIKQINA-INPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQ 2938
             GE+ +H+AAR +      + + A  NP+     D  GRTPL +++AADA E   QLL+  +Q   +++                       TT L+ A +L  ++++  L+   + V   D  G++ +HW+A  NN+     L      +   D +DN +++PLFLAA EGA++  + LL       ++ D     P  +A ++  +++  L++
Sbjct: 1633 TGETPLHLAARFSRPTAARRLLEAGANPNQP---DRAGRTPLHAAVAADAREVC-QLLLRSRQTAVDARTED-------------------GTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAARSLLQAGADK---DAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELR-DQAGLAPADVAHQRNHWDLLTLLE 1820          

HSP 7 Score: 73.559 bits (179), Expect = 2.945e-12
Identity = 68/205 (33.17%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQN--PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESL---ENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
             CS  PCVNG    A  P+ +C C  G++G  CE +VN+C Q+  PC  G +C +   S F C C     G  C+    PC    C NGGTC+ +   ++    C C  GFIG  C V    C          C N G C    + T  C C   +TG  C +  +     G    +C NGG C+    GS  C C   + G +C
Sbjct:  159 FCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGS-FQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNC------VSHQCQNGGTCQDGLD-TYTCLCPETWTGWDCSEDVDECETQG--PPHCRNGGTCQN-SAGSFHCVCVSGWGGTSC 352          

HSP 8 Score: 73.1738 bits (178), Expect = 3.924e-12
Identity = 70/227 (30.84%), Postives = 100/227 (44.05%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ------FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYP---NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCK-VLDNGSPICECKGEFTGKNCTIPLKETRKEALINIK 982
              CS R    G+C        +CSC  GW GE C+  + D C  NPC NGG C+     Q  C+C   F G+ C+      F++P     C  G +C +   G FQC C  G  G  C ++   CP  P+     C+N G C + P   +    C C PG+ G  C+   +      C S  C NGG C+  LD  +  C C   +TG +C+  + E   +   + +
Sbjct:  125 SFCSKR----GRCHIQASGRPQCSCMPGWTGEQCQ--LRDFCSANPCVNGGVCL-ATYPQIQCHCPPGFEGHACERDVNECFQDP---GPCPKGTSCHNTL-GSFQCLCPVGQEGPRCELRAGPCP--PRG----CSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPD-----NCVSHQCQNGGTCQDGLDTYT--CLCPETWTGWDCSEDVDECETQGPPHCR 327          

HSP 9 Score: 71.633 bits (174), Expect = 1.108e-11
Identity = 66/225 (29.33%), Postives = 87/225 (38.67%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIG----------NLCQFENPC------LNVNCENGG----------TCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC NG   +     F C C  G++G  C+  V++C+ +PC  G +C+D   + F C C S F G          NLCQ +  C       N  C +G           TC         C C  G+ G  C  +   C   P      C + G C  YP  + + C C  GYTG  C ++        C S  C NGG C     G   C C    TG  C
Sbjct:  555 CRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGA-FFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAP------CAHGGTC--YPQPSGYNCTCPTGYTGPTCSEEM-----TACHSGPCLNGGSCNPSPGGY-YCTCPPSHTGPQC 764          

HSP 10 Score: 70.8626 bits (172), Expect = 1.620e-11
Identity = 64/255 (25.10%), Postives = 102/255 (40.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-------FENPCLN-VNCEN--------------GGTCESL-----------------ENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+NG         + C+C     G  C+ + + C+  PC NGGTC+++  + F+C C   F G  C+        ++PC N   C++              GG+C++L                     F C C  G+ G  C +   +C      +      LC+N G C +    + FC C PG+ G  C           C+S  C NG  C    +G  +C+C   + G+NC+  L   + +   N
Sbjct:  733 CHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGT-FSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTVYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLC-VDSGPSYFCHCPPGFQGSLCQDHVNP-----CESRPCQNGATCMAQPSGY-LCQCAPGYDGQNCSKELDACQSQPCHN 979          

HSP 11 Score: 65.0846 bits (157), Expect = 1.004e-9
Identity = 62/196 (31.63%), Postives = 81/196 (41.33%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCK--------VLDNGSPIC 901
            C ++PC  G         F C C  G +G+ CE   N+C   PC N   C D  N  F C C   F G  C+ + + C +  C NGG C+  + G F CKC  GF G  C  +   C   P      C     C   P    FC C  G+TG  C    E+P+   C  + C    +CK        +  +GSP C
Sbjct:  479 CLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNG-FQCICLPGFSGTRCEEDIDECRSSPCANGGQCQD-QPGAFHCKCLPGFEGPRCQTEVDECLSDP------CPVGASCLDLPG-AFFCLCPSGFTGQLC----EVPL---CAPNLCQPKQICKDQKDKANCLCPDGSPGC 658          

HSP 12 Score: 59.3066 bits (142), Expect = 6.589e-8
Identity = 53/171 (30.99%), Postives = 69/171 (40.35%), Query Frame = 2
Query:  353 PCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP--CKNGGTC-------------IDKKNSQFTCNCTSQFIGNLCQ--FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDK 808
            PC NG  C+     +  C C  G+ GETC+    D  QN   C+NGG+C                    F C C   F G  CQ   E+PC    C   G C    +G  QC C  G+ GE C +++             C N G C   YP +   C C PG+ G  C++
Sbjct:   34 PCANGGTCLSLSLGQGTCQCAPGFLGETCQ--FPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLEDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFC-------SANPCVNGGVCLATYPQIQ--CHCPPGFEGHACER 193          
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 137.502 bits (345), Expect = 7.293e-32
Identity = 115/408 (28.19%), Postives = 173/408 (42.40%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTL--FCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC--KVLDNGSPICECKGEFTGKNCTIPLKE----TRKEALINIKIPKTFNEKQLIIK----------KTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH-KSSCKF---HKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNE-----GLTKCSTQTKLYELDLVLMTTMQ 1459
            C +RPC NG    A    + C C  G+ G+ C + ++ C   PC N GTC  K    F C C   F+G  C+ + + CL+  C   GT  C SL N  F C+C  G  G++C V+   C        + C + G C+      L   C C  G+ G  C  +        C   +C +GG+C         P C C   + G +C  P            L N    +T        +          + + P      C+    +G CD  C+    N+DGGDC     DPW+ C  +    C  +F DG C+P+C++ +CLFDG DC    +C       C + + N  C++ CN+ +CG+DGGDC     +  +         L+  +   +L+ L  VL  T++
Sbjct:  933 CESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGG-FHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLAN-AFYCQCLPGHTGQWCEVEIDPC------HSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAP-----SCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGA--KGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSH--SRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLR 1323          

HSP 2 Score: 114.775 bits (286), Expect = 7.799e-25
Identity = 116/419 (27.68%), Postives = 163/419 (38.90%), Query Frame = 2
Query:  338 LCSNRPCV-NGKCVEAFDPEFRCSCWHGWKGETCEENVNDC----------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKE--------------------------LPVEIG---------CKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCT---------------------IPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKS------SCKFH-KCSELYQNKICDEECNSPQCGFDGGDCHT 1360
            LC+ +PC  N  C++   P F C C  GW G  C   ++ C          + + C NGG C+D   S F C+C   F G+LCQ   NPC +  C+NG TC +  +G + C+C  G+ G+ C+ +  AC      + + C+NHG C   P     C C PG+ G RC+   +                          LP   G         C S  CF+GG C+    GSP   IC C   F G  C+                      P    R   L     P              SP L +  C  +   G    +C+   C +      P  +C     K C+G   DG C+  C+     +DG DC          C  H +C  L+++  C  +C+S +C FDG DC T
Sbjct:  846 LCAQKPCPRNSHCLQT-GPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYF-CHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSG-YLCQCAPGYDGQNCSKELDAC------QSQPCHNHGTCTPKPG-GFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEAT-AGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCS---CPHS----SPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCET 1246          

HSP 3 Score: 88.5817 bits (218), Expect = 6.994e-17
Identity = 71/199 (35.68%), Postives = 89/199 (44.72%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            PC +G         F C C  G+ G  CE + N+C+  PC  G TC+D   + F C C     G LC+ E N C +  C N   C  L NG FQC C  GF G  C         I + +   C N G+C   P     CKC PG+ G RC  + +      C SD C  G  C  L  G+  C C   FTG+ C +PL
Sbjct:  444 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLL-ATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNG-FQCICLPGFSGTRCEED------IDECRSSPCANGGQCQDQPG-AFHCKCLPGFEGPRCQTEVDE-----CLSDPCPVGASCLDLP-GAFFCLCPSGFTGQLCEVPL 627          

HSP 4 Score: 85.5001 bits (210), Expect = 5.682e-16
Identity = 54/150 (36.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  467 PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVN-CENGGTCESL-------------ENGMFQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            PC NGGTC+     Q TC C   F+G  CQF +PC N   C+NGG+C++L                 F C C  GF GE C  Q    CP         C+  G C I  +    C C PG+TG++C  +        C ++ C NGGVC
Sbjct:   33 PCANGGTCLSLSLGQGTCQCAPGFLGETCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPP------SFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDF------CSANPCVNGGVC 170          

HSP 5 Score: 82.8037 bits (203), Expect = 3.930e-15
Identity = 59/173 (34.10%), Postives = 77/173 (44.51%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            C NG   +     F C C  GW G +CEEN++DCI   C  G TCID+  S F+C C     G LC  E+ CL+  C     C +    G   C C+ G+ G  C      C ++ ++    C + G C   P  +  C C PGYTG RC+          C S  C  G  C
Sbjct:  325 CRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGS-FSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDEC-LMAQQGPSPCEHGGSCLNTPG-SFNCLCPPGYTGSRCEADHNE-----CLSQPCHPGSTC 489          

HSP 6 Score: 77.0258 bits (188), Expect = 2.503e-13
Identity = 57/215 (26.51%), Postives = 103/215 (47.91%), Query Frame = 2
Query: 2297 NGESLMHIAARMNSGANIIKQINA-INPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQ 2938
             GE+ +H+AAR +      + + A  NP+     D  GRTPL +++AADA E   QLL+  +Q   +++                       TT L+ A +L  ++++  L+   + V   D  G++ +HW+A  NN+     L      +   D +DN +++PLFLAA EGA++  + LL       ++ D     P  +A ++  +++  L++
Sbjct: 1632 TGETPLHLAARFSRPTAARRLLEAGANPNQP---DRAGRTPLHAAVAADAREVC-QLLLRSRQTAVDARTED-------------------GTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAARSLLQAGADK---DAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELR-DQAGLAPADVAHQRNHWDLLTLLE 1819          

HSP 7 Score: 73.1738 bits (178), Expect = 3.314e-12
Identity = 68/205 (33.17%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQN--PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESL---ENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
             CS  PCVNG    A  P+ +C C  G++G  CE +VN+C Q+  PC  G +C +   S F C C     G  C+    PC    C NGGTC+ +   ++    C C  GFIG  C V    C          C N G C    + T  C C   +TG  C +  +     G    +C NGG C+    GS  C C   + G +C
Sbjct:  158 FCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGS-FQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNC------VSHQCQNGGTCQDGLD-TYTCLCPETWTGWDCSEDVDECETQG--PPHCRNGGTCQN-SAGSFHCVCVSGWGGTSC 351          

HSP 8 Score: 72.7886 bits (177), Expect = 4.529e-12
Identity = 70/227 (30.84%), Postives = 100/227 (44.05%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ------FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYP---NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCK-VLDNGSPICECKGEFTGKNCTIPLKETRKEALINIK 982
              CS R    G+C        +CSC  GW GE C+  + D C  NPC NGG C+     Q  C+C   F G+ C+      F++P     C  G +C +   G FQC C  G  G  C ++   CP  P+     C+N G C + P   +    C C PG+ G  C+   +      C S  C NGG C+  LD  +  C C   +TG +C+  + E   +   + +
Sbjct:  124 SFCSKR----GRCHIQASGRPQCSCMPGWTGEQCQ--LRDFCSANPCVNGGVCL-ATYPQIQCHCPPGFEGHACERDVNECFQDP---GPCPKGTSCHNTL-GSFQCLCPVGQEGPRCELRAGPCP--PRG----CSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPD-----NCVSHQCQNGGTCQDGLDTYT--CLCPETWTGWDCSEDVDECETQGPPHCR 326          

HSP 9 Score: 71.2478 bits (173), Expect = 1.236e-11
Identity = 66/225 (29.33%), Postives = 87/225 (38.67%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIG----------NLCQFENPC------LNVNCENGG----------TCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC NG   +     F C C  G++G  C+  V++C+ +PC  G +C+D   + F C C S F G          NLCQ +  C       N  C +G           TC         C C  G+ G  C  +   C   P      C + G C  YP  + + C C  GYTG  C ++        C S  C NGG C     G   C C    TG  C
Sbjct:  554 CRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGA-FFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAP------CAHGGTC--YPQPSGYNCTCPTGYTGPTCSEEM-----TACHSGPCLNGGSCNPSPGGY-YCTCPPSHTGPQC 763          

HSP 10 Score: 70.8626 bits (172), Expect = 1.748e-11
Identity = 64/255 (25.10%), Postives = 102/255 (40.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-------FENPCLN-VNCEN--------------GGTCESL-----------------ENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+NG         + C+C     G  C+ + + C+  PC NGGTC+++  + F+C C   F G  C+        ++PC N   C++              GG+C++L                     F C C  G+ G  C +   +C      +      LC+N G C +    + FC C PG+ G  C           C+S  C NG  C    +G  +C+C   + G+NC+  L   + +   N
Sbjct:  732 CHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGT-FSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLC-VDSGPSYFCHCPPGFQGSLCQDHVNP-----CESRPCQNGATCMAQPSGY-LCQCAPGYDGQNCSKELDACQSQPCHN 978          

HSP 11 Score: 65.0846 bits (157), Expect = 1.101e-9
Identity = 62/196 (31.63%), Postives = 81/196 (41.33%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCK--------VLDNGSPIC 901
            C ++PC  G         F C C  G +G+ CE   N+C   PC N   C D  N  F C C   F G  C+ + + C +  C NGG C+  + G F CKC  GF G  C  +   C   P      C     C   P    FC C  G+TG  C    E+P+   C  + C    +CK        +  +GSP C
Sbjct:  478 CLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNG-FQCICLPGFSGTRCEEDIDECRSSPCANGGQCQD-QPGAFHCKCLPGFEGPRCQTEVDECLSDP------CPVGASCLDLPG-AFFCLCPSGFTGQLC----EVPL---CAPNLCQPKQICKDQKDKANCLCPDGSPGC 657          

HSP 12 Score: 58.9214 bits (141), Expect = 7.352e-8
Identity = 53/171 (30.99%), Postives = 69/171 (40.35%), Query Frame = 2
Query:  353 PCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP--CKNGGTC-------------IDKKNSQFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDK 808
            PC NG  C+     +  C C  G+ GETC+    D  QN   C+NGG+C                    F C C   F G  C  Q E+PC    C   G C    +G  QC C  G+ GE C +++             C N G C   YP +   C C PG+ G  C++
Sbjct:   33 PCANGGTCLSLSLGQGTCQCAPGFLGETCQ--FPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFC-------SANPCVNGGVCLATYPQIQ--CHCPPGFEGHACER 192          
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 149.443 bits (376), Expect = 4.974e-36
Identity = 133/474 (28.06%), Postives = 192/474 (40.51%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTS---------------------------------------------------QFIGNLCQF----------ENPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNL-CKASFENGICDQQCNTFACNYDGGDC----DPWRKC-YGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCK-----FHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTV 1528
            +S  +C N    NG CV      FRC C  G+ G+ C+E +N C    C+N GTC+   +    C C +                                                    F GN C+           EN CL+  C N  TC  ++  + + C C+ GF G+ C      C   P     +C+ H E       +  C C PG+ G+ C+++K       C    C NGGVC   +     CEC   F+G  C         E  IN+     F EK  +++     S+C+   C     +G CD  CN  AC +DGGDC    +P+ KC YGN    C   F +GVCN  CNN +CL+DG DC  +  +        C+  + N ICD ECN+  CGFDGGDC    + +  +N              + + +    + F     + L ++SS+LR+ V +
Sbjct:  370 LSENMCLN----NGTCVN-LPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRE-------SFSCDCPPGFYGNGCEQEKMFR----CLKSTCQNGGVCINEEEKGRKCECSYGFSGARC---------EEKINLT---GFTEKDSLLR-----SVCEKRKCSERANDGNCDADCNYAACKFDGGDCSGKREPFSKCRYGN---MCADFFANGVCNQACNNEECLYDGMDCLPAVVRCPVKIREHCASRFANGICDPECNTNGCGFDGGDCDNETNATIITN--------------IRITVQMDPKEFQVTGGQSLMEISSALRVTVRI 793          

HSP 2 Score: 103.219 bits (256), Expect = 7.266e-22
Identity = 127/436 (29.13%), Postives = 173/436 (39.68%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNG-------------------------------------GTCIDKKNSQ--FTCNCTSQFIGNLC-QFENPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK---------KKELPVEIGC---KSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKT-FNEKQLIIKKTKSPSLCDNLCKASFENGICDQQ---CNTFACNYDGGDCDPWRKC---------YGNDLKHCKGVF--------NDGVC-NPECNNVDCL----FDGEDCH---------------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSR 1366
            C++ PC +G C+ +F   F+C C  G+ G  C+E  ++C+ N C+ G                                     GTCID   S+  F C C   + G LC Q +N CL+ N C N GTC +L  G F+C C  GF G++C      C          C N G C    + +  C+C  G+ G RC+K         + +L +EIG    +   CFNGG C      S  C C  +FTG  C +  K  +     N+ +     N    I         C  +CK  FE  IC++    C    C+ +GG C   R+          YGN  +  K +F        N GVC N E     C     F G  C                +S C+  KCSE   +  CD +CN   C FDGGDC   R
Sbjct:  254 CASNPCSHGVCI-SFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLP-GSFRCDCARGFGGKWCDEPLNMCQDF------HCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCL-----SGFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYAC--ICKQGFEGDICERHKDLCLENPCS-NGGVCHQHRESFSCDCPPGFYGNGCEQEK-MFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCDADCNYAACKFDGGDCSGKR 672          
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 141.354 bits (355), Expect = 1.744e-33
Identity = 151/561 (26.92%), Postives = 224/561 (39.93%), Query Frame = 2
Query:  356 CVNGKCVEAFDPE--FRCSCWHGWKGETCEENVNDC-IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQ------NIACPVIPKKKR-----ELCNNHGECDIYPNMTLFCKCDPGYTGDRCD---KKKELPVEIGCK---------------SDY-----------------------CFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKET-RKEALINIKIPKTFN-------------EKQLIIKKTKSPSLCD----NLCKASFENGICDQQCNTFACNYDGGDCD----PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKS--SCKFH---KCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTV-----------------FNVTEINFN-FATALLIKLHV-NYTQCVLYGGQCFSSLEQI--SNFLKAGIEKGNVLSLPFRLARVDTRI 1726
            C +G+C+   D +  FRC C  G++GE C ++ N+C I+  C N  TC +  +  FTC C   + G  C+   + C +  C+N G C    N M  C C  GF G+ C ++       I C +  ++         C N G C     +  FC C+P Y GDRC+   K  + P    CK               S Y                       C NGG C+ + NG   C C   F+G  C I  ++   +    N  + K                E+ L+I+K+K   + D      C     NGIC+ +CN   CN+DGGDC     P+ KC       C   F +GVCN ECNN +CL+DG DC      C  H    C E   + +C+ EC+   CGFDGGDC+        S              ++ + +      F     E L ++S++LR  V +                     E+N +      ++  HV  Y Q V+ G   +  +E+I    F +    +  V  +   L + D R+
Sbjct:  201 CNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNL-HGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRC-----INGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGV-NGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTGYCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQRKCMDLASNGICNPECNLEECNFDGGDCSGGQRPFSKC--QYPARCADQFANGVCNQECNNEECLYDGLDCQSELFRCPAHIRKHCIERRGDGVCNLECSFIGCGFDGGDCNNGTEAIILS--------------DIRIKVQIDPIEFQATGGETLMQISANLRATVRIQRDELGPLVFRWDGEHEMERVEMNSSKLEDQFVLSHHVRRYRQAVVTGIVLYLEVEEICKPEFCRFSTAQSVVDLIAAGLVKSDGRM 738          

HSP 2 Score: 125.946 bits (315), Expect = 7.952e-29
Identity = 109/330 (33.03%), Postives = 146/330 (44.24%), Query Frame = 2
Query:  344 SNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVND--------CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNH-----GECDIYPNMTLFCKCDPGYTGDRC------DKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGE---FTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDP-WRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSS 1261
            SN  C N G+C+  F     C C   + G+ CE N  D        C  NPC N  TCID KNS ++C+C   F G  C+    C    C NGGTCE + NG+ +C C  GF G++C +          K R+LC+ H     G C      T +C+C  GYTG  C      +K KE  +   C+   C +     +  NG    EC  E   F G +C+                       Q    K + P+ C +     F NG+C+Q+CN   C YDG DC     +C  +  KHC     DGVCN EC+ + C FDG DC+  +
Sbjct:  332 SNGTCYNDGRCINGF-----CVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGV-NGVIRCNCPNGFSGDYCEI----------KDRQLCSRHPCKNGGVC----KNTGYCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQRKCMD-----LASNGICNPECNLEECNFDGGDCS---------------------GGQRPFSKCQYPARCAD----QFANGVCNQECNNEECLYDGLDCQSELFRCPAHIRKHCIERRGDGVCNLECSFIGCGFDGGDCNNGT 611          

HSP 3 Score: 91.6633 bits (226), Expect = 2.747e-18
Identity = 69/203 (33.99%), Postives = 96/203 (47.29%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTC--ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C + PC NG C   F   F+C C +G+ G  CEE ++ C QN C  G TC++   + + C+C     G  C+     L  N  N G C     E+  F+C C  G+ GEFC      C +      E C N+  C +++ + T  C C PGY G  C++  ++     CK   C N G C    N  PIC C+  FTG+ C I
Sbjct:  121 CDSDPCNNGLCY-PFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYY-CDCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLI-----EETCVNNSTCFNLHGDFT--CTCKPGYAGKYCEEAIDM-----CKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEI 309          
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 93.9745 bits (232), Expect = 6.036e-19
Identity = 70/204 (34.31%), Postives = 99/204 (48.53%), Query Frame = 2
Query:  338 LCSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            LC N PC N   C      ++ C+C  G+ G  CE  ++ C  +PC N  TC   +  +F C C   F G+ C+   + C+N  CENGG C  L N  ++C C   + G+ C  +   C     KK   C N+G+C I  N +  C C PG+TG+ C+   +      CK+  C NGG C V    S  C C+  + G+ C IP
Sbjct:  872 LCLNSPCKNNAICETTSSRKYTCNCTPGFYGVHCENQIDACYGSPCLNNATCKVAQAGRFNCYCNKGFEGDYCEKNIDDCVNSKCENGGKCVDLINS-YRCDCPMEYEGKHCEDKLEYC----TKKLNPCENNGKC-IPINGSYSCMCSPGFTGNNCETNID-----DCKNVECQNGGSC-VDGILSYDCLCRPGYAGQYCEIP 1063          

HSP 2 Score: 87.0409 bits (214), Expect = 6.637e-17
Identity = 65/206 (31.55%), Postives = 96/206 (46.60%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ--FENPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEI----GCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C   PC+N   C  A    F C C  G++G+ CE+N++DC+ + C+NGG C+D  NS + C+C  ++ G  C+   E     +N CEN G C  + NG + C C  GF G  C      C      K   C N G C +   ++  C C PGY G  C+    + +E      C+   C  G      ++    C+C   F+G +C
Sbjct:  912 CYGSPCLNNATCKVAQAGRFNCYCNKGFEGDYCEKNIDDCVNSKCENGGKCVDLINS-YRCDCPMEYEGKHCEDKLEYCTKKLNPCENNGKCIPI-NGSYSCMCSPGFTGNNCETNIDDC------KNVECQNGGSC-VDGILSYDCLCRPGYAGQYCEIPPMMDMEYQKTDACQQSACGQGECVASQNSSDFTCKCHEGFSGPSC 1108          

HSP 3 Score: 60.4622 bits (145), Expect = 8.440e-9
Identity = 48/142 (33.80%), Postives = 65/142 (45.77%), Query Frame = 2
Query:  509 QFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            QFTC+  S+    L    + CLN  C+N   CE+  +  + C C  GF G  C  Q  AC   P      C N+  C +       C C+ G+ GD C+K  +      C +  C NGG C  L N S  C+C  E+ GK+C
Sbjct:  855 QFTCD--SKVPTKLATKCDLCLNSPCKNNAICETTSSRKYTCNCTPGFYGVHCENQIDACYGSP------CLNNATCKVAQAGRFNCYCNKGFEGDYCEKNID-----DCVNSKCENGGKCVDLIN-SYRCDCPMEYEGKHC 982          
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 85.8853 bits (211), Expect = 1.735e-16
Identity = 62/205 (30.24%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  326 VSSKLCSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            V    C++ PC+N  +CV+     ++C C  GW G  CE++   C   PC+N G C+      F C C     G  C+   N C+   C NGG C        +C C   F G+ C  +N  C        + C N G+C         C+C PG+TG+RC+   +      C + +C +G  C V    + IC C    TG +C
Sbjct: 2359 VKQDQCADSPCLNDAQCVD-MGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYF-CVCPPGVSGKNCESAPNRCIGQPCHNGGECGDF-GSHLECACPASFTGKGCEFKNTGC--------KTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDE-----CSTAHCPSGATC-VDQVNTHICVCPFNLTGVHC 2546          

HSP 2 Score: 78.9518 bits (193), Expect = 2.264e-14
Identity = 71/213 (33.33%), Postives = 89/213 (41.78%), Query Frame = 2
Query:  311 CLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C  +  S+K+C N    N +C   F    +C C  G+ G+ CE   + C   PC NGG C ++  + + C C   F G  CQFE + C  V C NGG C  L       C CR GF G  C      C          C N   C I   +  F C+C PG+ G  CDK  +      C    C     C  L N    CEC   F+GK C I
Sbjct: 2012 CFPIDCSAKMCEN----NAEC-SVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKC-EQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDIC-----STNNPCRNGARC-IGEKLGRFKCQCVPGWEGPNCDKNID-----DCADSPCALNATCVDLINDYK-CECPTGFSGKRCHI 2206          

HSP 3 Score: 77.0258 bits (188), Expect = 9.892e-14
Identity = 64/210 (30.48%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  332 SKLCS-NRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            + +CS N PC NG +C+      F+C C  GW+G  C++N++DC  +PC    TC+D  N  + C C + F G  C   EN C +  C +G   + L +   QC C+ G+ GE C      C   P      C N  +C I       C+C  GY G  C    +      C    C N   C  +   +  C+C   F G +C + + E
Sbjct: 2130 TDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLIN-DYKCECPTGFSGKRCHIKENLCASSPCVHGLCIDKLYS--RQCLCQPGWTGENCDQNIDECAASP------CQNDAKC-IDEINGYMCECADGYEGVHCQHLVDH-----CAKQPCHNNATCTNM-GATYHCDCTLGFDGVHCEMNIDE 2323          

HSP 4 Score: 74.3294 bits (181), Expect = 6.476e-13
Identity = 62/188 (32.98%), Postives = 83/188 (44.15%), Query Frame = 2
Query:  392 EFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +F+C C  G+ G  C+   + C  +PC N   C+D   + + C C S + G  C+ +N  C    C N G C SL    F C C  G  G+ C      C   P      C+N GEC  + +  L C C   +TG  C+ K       GCK+  C NGG C     G   CEC   FTG+ C   + E
Sbjct: 2343 DFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGA-YKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYF-CVCPPGVSGKNCESAPNRCIGQP------CHNGGECGDFGSH-LECACPASFTGKGCEFKN-----TGCKT--CENGGKCAEAAGGLQKCECSPGFTGERCETNIDE 2514          
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 82.0333 bits (201), Expect = 2.746e-15
Identity = 70/231 (30.30%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVND---------------------------------CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK--RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNC 934
            C++G CV+    E  C C  GW G  C+  V D                                 C  + C+N GTC+  +N    C C   F+G+ C+  E+ C    C+NG  CE+L+ G ++CKC  GF G++C +Q+       KK+   + C+N+G+C I     L CKC PG+ G  C+ K E+  E  C++       VC +++  S    CEC   F G +C
Sbjct:   63 CLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCV-AENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLK-GSYECKCLKGFSGKYCEIQD-------KKQCTSDYCHNNGQC-ISTGSDLSCKCSPGFDGAFCELKAEVN-ECICENP----AHVCSLVNGTSRTTQCECPSGFMGADC 278          

HSP 2 Score: 76.2554 bits (186), Expect = 1.654e-13
Identity = 94/359 (26.18%), Postives = 153/359 (42.62%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENP--CLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCN----NHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTK--SPSLCD---NLCKASFENGICDQ---QCNTFACN--YDGGDCDPWRKCYGNDLKHCKG--VFNDGVCNPECNNVDCL----FDGEDCH----KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHT 1360
            +G C++  D E +C C +G+ GE CE   ++C    C NGG C+  ++ +  C C + ++G+ C       C +  C+N G C    +  F+C C  G+ GE C  +++            CN    N G C +       C+C+ GYTG  C+K         C S+ C + G C  + N + +C C   + G +C   +         N  + +T +E     +  K    + C+   +  KA   +G C Q   + +T +CN  Y+G  CD         + +CK     N   C  +     C     F+G DC     + + +F K     ++KI D EC     GF+G +C T
Sbjct: 1224 HGYCLDGID-EAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDV----------NECNHYDCNRGHC-VMTVSGPACQCEMGYTGRFCEKLLNQ-----CSSNTCSSRGACSPVWNNT-VCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACD-------KKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTT 1557          

HSP 3 Score: 73.559 bits (179), Expect = 9.037e-13
Identity = 65/215 (30.23%), Postives = 95/215 (44.19%), Query Frame = 2
Query:  314 LLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGE-FTGKNCTIPLKE 952
            LL   SS  CS+R    G C   ++    C+C + W+G  C+  ++ C+  PC N G C     + F+C C   F+G  C+ E  CL   C + G C  L      C C  G+ G+ C  +   C   P      C N   C+    +T + C C  G+ G  C    E+ ++  C  ++C NG  C+   N    C C G  F G+NCT  + E
Sbjct: 1367 LLNQCSSNTCSSR----GACSPVWNNTV-CNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVH-GECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGP------CLNGANCE--NKLTGYKCTCAVGFEGADC----EINID-ECALEFCKNGAKCRDKINDYE-CVCDGTGFEGRNCTTDINE 1561          

HSP 4 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 61/201 (30.35%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  356 CVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C+NG  CV+ ++   +C C  G+ GE CE+NVNDC    C   G C+D  + +  C C + F G  C+  ++ C  V C NGG C    +    C+C   ++G+ C V           K   C N G+C    +    C C  GY+G+ C+++     ++   + Y  N G C V+    P C+C+  +TG+ C   L +
Sbjct: 1183 CLNGATCVDIWNKR-KCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGID-EAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTT-----NCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQR-----DVNECNHYDCNRGHC-VMTVSGPACQCEMGYTGRFCEKLLNQ 1370          

HSP 5 Score: 72.0182 bits (175), Expect = 2.620e-12
Identity = 62/199 (31.16%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN--PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPL 946
            NG CV A +   +C+C  G+ G+ CE + ++C +N C+NG  C + K S + C C   F G  C+ ++   C +  C N G C S  + +  CKC  GF G FC ++      I +    +C+         + T  C+C  G+ G  C + +  P    C  + C NGG C  +D+G  +  C C   FTG  C  P+
Sbjct:  137 NGTCV-AENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGS-YECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDL-SCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNG----TSRTTQCECPSGFMGADCKELQARP----CDREPCLNGGHC--VDDGQNLFTCFCLPSFTGIYCGEPV 322          

HSP 6 Score: 70.8626 bits (172), Expect = 6.862e-12
Identity = 63/210 (30.00%), Postives = 88/210 (41.90%), Query Frame = 2
Query:  323 IVSSKLCSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCE--ENVNDCI-QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF--ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            I   K C++  C N G+C+     +  C C  G+ G  CE    VN+CI +NP  +  + ++  +    C C S F+G  C+     PC    C NGG C      +F C C   F G +C       PV        C N G+C ++      C+C  G+ G  C+          C    C NGG CK+   G P C C+  F G  C
Sbjct:  200 IQDKKQCTSDYCHNNGQCIST-GSDLSCKCSPGFDGAFCELKAEVNECICENP-AHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGE-----PVDCLVNGSDCKNGGKC-VFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFC 401          

HSP 7 Score: 70.4774 bits (171), Expect = 7.921e-12
Identity = 60/169 (35.50%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCT-SQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK-RELCNNHGEC-----DIYPNMTLF---CKCDPGYTGDRCDKK 811
            C   PC+NG   E     ++C+C  G++G  CE N+++C    CKNG  C DK N  + C C  + F G  C  + N C N N C NG    +L  G ++C CR GFIG  C+V+N     I       +   HG+C      I  N  +    C CD GYTG  C ++
Sbjct: 1485 CKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKIN-DYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTL--GNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQR 1650          

HSP 8 Score: 58.5362 bits (140), Expect = 3.838e-8
Identity = 72/264 (27.27%), Postives = 100/264 (37.88%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCE-----ENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIP-------------------KKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI---CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFEN 1075
            GKCV A      C C  G+ G  CE      +   C    C NGG+C      +  C C   F G  C+ ++ C    C+NGGTC+  + G + C C  GF G  C   +     IP                   K   E C N   C +       C CD GY G +CD+K +   ++ C S     G  C  +++   I   C C+    G+ C              +    TF+ K L I ++   S    L  +SFEN
Sbjct:  335 GKCVFAL-AATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPKSGCTINPCQNGGTCQDAD-GQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNC-LDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPS-----GQTCSQVNDNVNITAQCGCEIGHFGQQC-------------EMVTSATFSAKSLYIHQSSKFS----LGTSSFEN 573          

HSP 9 Score: 58.151 bits (139), Expect = 4.986e-8
Identity = 59/196 (30.10%), Postives = 81/196 (41.33%), Query Frame = 2
Query:  455 CIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQF--ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC--------------------------AVQNIACPV-IPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C +N C NGGTC ++ +   F C C   F G LCQ      CL+ NC  G        G   C+C  G++G  C                          A  +  C    P      C N+G C +  N  + C C PG+ GD C+  ++      CK ++C NG  C+ L  GS  C+C   F+GK C I  K+
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTF------GEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTC-VAENGNVKCACPPGFVGDHCETDEDE-----CKENFCQNGADCENL-KGSYECKCLKGFSGKYCEIQDKK 204          

HSP 10 Score: 54.6842 bits (130), Expect = 5.813e-7
Identity = 68/241 (28.22%), Postives = 100/241 (41.49%), Query Frame = 2
Query:  299 FILGCLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCR-YGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGC---KSDYCFNGG----VCKVLDNGSPI---CECKGEFTGKNCTIPLKETRKEALINIK 982
            F +G    I  S  C    CV+G+C++       CSC  G++G+ C++ ++ C   PC NG  C + K + + C C   F G  C+   + C    C+NG  C    N  ++C C   GF G  C      C          C N GEC +   N    C C  G+ G RC  +     +I      S  C +G     V ++  N       C C   +TG  C+  +KE+   A+ NI 
Sbjct: 1435 FFMGTRCEIEGS--CLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANC-ENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKIND-YECVCDGTGFEGRNCTTDINECA-----NPNNCIN-GECTNTLGNYK--CACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKES---AMSNIS 1660          
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 121.709 bits (304), Expect = 3.068e-27
Identity = 124/470 (26.38%), Postives = 200/470 (42.55%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEAL-------------INIKIPK-TFNEK-QLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKC--------------YGNDLKH---------CKGVFNDGVCNPECNNVDCLFDGEDCHK-----SSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSR------------------------SNSFFSNEGLTKCSTQTK---LYE--LDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTV 1528
            C ++PC NG         + C C  G++G+ CE N++DC  NPC+NGGTC D+    F+C+C    +G +C+  ++ C    C N G+C     G F+C C+ GF+G  C      C   P      C+N G  D    +  + C C PG+ G  C+ K +      C    C NGG C +  +G   C C   F GKNC +  ++                      + P+ T  E  ++      SP+ C     A+ E+ + D +C   +  + G  CD +                 Y  DL+          C     +G+C+ +CN   C FDG DC       ++C  ++C   ++N  C+EECN+  C +DG DC                            +N+  S +GL  C  +T+   L E  + +V++  ++ F + +++FL+ +S  LR  V +
Sbjct: 1187 CQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRV-MNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGG-FECVCQPGFVGARCEGDINECLSNP------CSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDF-----CAQSPCQNGGNCNIRQSGH-HCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQ--GAACEDLLGDYECLCPS-KWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDCNTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDCERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGL-DCENKTQSPVLAEGAMSVVMLMNVEAFREIQAQFLRNMSHMLRTTVRL 1638          

HSP 2 Score: 115.161 bits (287), Expect = 2.970e-25
Identity = 112/375 (29.87%), Postives = 166/375 (44.27%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE----------TRKEALINIKI---PKTFNEKQLIIKKTKSPSLCDN-------------LCKASFENGICD---QQCNTFACNYDGG-DCDPWRKCY------GNDLKHCKGVF---------NDGVCNPE-------CNNV----DCLFDGEDCHKSSCKFHKC 1279
            C+   C+NG  C++  +  + CSC  G+ G  C+  +N C  NPC NG TC  ++N+++TC+C S F G  C ++ + C    CENG TC  +++  F CKC  G+ G+ C VQ I+C     +K    R+LCNN G C  Y N +  C C  GY G  C K+ +      C+S  C NGG C+ L  G+  C+C+  F G+NC + + +          T  + ++N      P T      I K    P  C N             +C+  F    C+    +C +  C+  G  DC      Y      G+  +HC+            N G CN         CNN     +C   G+DC  + C+   C
Sbjct: 1026 CTESSCLNGGSCIDGIN-GYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC-HEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKH-QFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNN-GTCKDYGN-SHVCYCSQGYAGSYCQKEIDE-----CQSQPCQNGGTCRDLI-GAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNC 1389          

HSP 3 Score: 94.3597 bits (233), Expect = 5.736e-19
Identity = 71/203 (34.98%), Postives = 102/203 (50.25%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PCVN G+C +  + EF C C  G+ G+ CE ++++C  NPC++GGTC DK N+ F+C C   + G  C+   + C+   C NGGTC    NG ++C C+  F G  C  +   C          C N  +C    N   F C C  GYTG  CD+     ++    S  C NG  C  +  GS  C C   + G++C I
Sbjct:  757 CASNPCVNEGRCEDGIN-EFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNA-FSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNG-YKCVCKVPFTGRDCESKMDPC------ASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDED----IDECSLSSPCRNGASCLNVP-GSYRCLCTKGYEGRDCAI 945          

HSP 4 Score: 92.8189 bits (229), Expect = 1.762e-18
Identity = 73/200 (36.50%), Postives = 95/200 (47.50%), Query Frame = 2
Query:  341 CSNRPC-VNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC  +G C +     + C C  G  G+ CE NVN+C  NPC NG TCID  NS + C C   F G  C+   + C++  C N G C    NG ++C+C  GF    C      C   P      C N G C+   N    C C PGYTG RC    EL ++  C S+ C +GG C    N    C+C   +TG+ C
Sbjct:  643 CESNPCQFDGHCQDRVG-SYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINS-YKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNG-YKCECPRGFYDAHCLSDVDECASNP------CVNEGRCEDGIN-EFICHCPPGYTGKRC----ELDIDE-CSSNPCQHGGTCYDKLNAFS-CQCMPGYTGQKC 826          

HSP 5 Score: 92.4337 bits (228), Expect = 2.388e-18
Identity = 59/173 (34.10%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  455 CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCE-SLENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKREL-CNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI-CECKGEFTGKNCTIPLKETR 958
            C    C+NGGTC+ + N +  C C S ++G+ C+  NPC ++ C+NGGTC+ +  NG     CKC  GF    C +       +P     + C N G C +       C C  GYTG+RC+ K        C S  C NG  C  L   S   C C   FTG  C+  ++E +
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEI------AVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNL------CASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQ 222          

HSP 6 Score: 89.3521 bits (220), Expect = 2.124e-17
Identity = 68/196 (34.69%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            PC NG         +RC C  G++G  C  N +DC   PC+NGGTC+D     ++C C   F G  C+ + N CL+  C+NG TC    N  + C C  GF G  C   +  C          C N G C I       C C  GY+G  C  K        C S+ C NG  C   +N    C C   FTGK C+
Sbjct:  916 PCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGI-GDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVN-SYTCTCPLGFSGINCQTNDEDC------TESSCLNGGSC-IDGINGYNCSCLAGYSGANCQYKLNK-----CDSNPCLNGATCHEQNN-EYTCHCPSGFTGKQCS 1096          

HSP 7 Score: 87.8113 bits (216), Expect = 6.467e-17
Identity = 105/375 (28.00%), Postives = 149/375 (39.73%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI---PLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDN--------------------------LCKASFENGIC---DQQCNTFACNYDGGDCDPWRKCY------GNDLKHCKGVFNDGVCNPECNN---------------------VDCLFDGEDCHKSSC 1264
            V+   C + PC NG  C++  +  ++C C  G+ G+ CE+NV++CI +PC N G CID+ N  + C C   F    C  + + C +  C N G CE   N  F C C  G+ G+ C +    C   P      C + G C  Y  +  F C+C PGYTG +C+   +      C ++ C NGG C    NG   C CK  FTG++C     P    R +          F +     K   +   CD                           LC   +E   C      C +F C  +GG C      Y      G D KHC+   N+ +  P C N                     ++C  + EDC +SSC
Sbjct:  676 VNVNECHSNPCNNGATCIDGIN-SYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNG-YKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGIN-EFICHCPPGYTGKRCELDIDECSSNP------CQHGGTC--YDKLNAFSCQCMPGYTGQKCETNID-----DCVTNPCGNGGTCIDKVNGYK-CVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQ-NGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQP-CQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSC 1031          

HSP 8 Score: 87.0409 bits (214), Expect = 1.158e-16
Identity = 73/224 (32.59%), Postives = 105/224 (46.88%), Query Frame = 2
Query:  329 SSKLCSNRPCVNGKCVEAF--DPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCD------KKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEA 967
            +  LC++ PC NG    A      F CSC  G+ G+TC  ++ +C  NPCK GGTC++   S + C C + + G  C  +  PC    C+NGG C S  NG+ ++CKC  GF G+ C      C         LC N G C D   + T  C+C P +TG  C        +++ PV        C NG  C    +GS  C C   + G +C+    + ++ A
Sbjct:  177 TKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGS-YQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRS--NGLSYECKCPKGFEGKNCEQNYDDC------LGHLCQNGGTCIDGISDYT--CRCPPNFTGRFCQDDVDECAQRDHPV--------CQNGATCTNT-HGSYSCICVNGWAGLDCSNNTDDCKQAA 380          

HSP 9 Score: 85.1149 bits (209), Expect = 3.803e-16
Identity = 68/186 (36.56%), Postives = 85/186 (45.70%), Query Frame = 2
Query:  389 PEFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNG-SPICECKGEFTGKNC 934
            P   C C  G+    CE  V N C    C NGGTC  K   ++TC C + + G  C+ +N C +  C NG TC +L  +  F C C  GF G+ C+     C   P K    C N HG        +  C C  GYTG  CD K +      C    C NGG+C+   NG S  C+C   F GKNC
Sbjct:  120 PGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHG--------SYQCMCPTGYTGKDCDTKYKP-----CSPSPCQNGGICR--SNGLSYECKCPKGFEGKNC 290          

HSP 10 Score: 84.3445 bits (207), Expect = 6.806e-16
Identity = 62/228 (27.19%), Postives = 112/228 (49.12%), Query Frame = 2
Query: 2276 LGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQETLRK 2953
            L   +++ GE+ +H+AAR        + ++A   +  +  D  GRTPL +++AADA      + + +  LR  +     R                  TT LI A +L  + M+  L+   + +N  D+ G++ +HW+A  NN+   E ++ + +     D +D++D++PLFLAA EG+ ++ K LL  F    I   MD     P+ +A E+  ++I  L+ E + +
Sbjct: 1943 LNATMDKTGETSLHLAARFARADAAKRLLDA--GADANCQDNTGRTPLHAAVAADA------MGVFQILLRNRATNLNAR--------------MHDGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALHWAAAVNNT---EAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMD---RLPRDVASERLHHDIVRLLDEHVPR 2142          

HSP 11 Score: 84.3445 bits (207), Expect = 6.921e-16
Identity = 67/211 (31.75%), Postives = 99/211 (46.92%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN---CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            K CS  PC NG    +    + C C  G++G+ CE+N +DC+ + C+NGGTCID   S +TC C   F G  CQ + + C   +   C+NG TC +  +G + C C  G+ G  C+     C      K+  C     C I    + +C+C  G TG  C       ++  C S+ C    +C     NGS  C C   + G +C+  + E
Sbjct:  257 KPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGI-SDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNT-HGSYSCICVNGWAGLDCSNNTDDC------KQAACFYGATC-IDGVGSFYCQCTKGKTGLLCH------LDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDE 452          

HSP 12 Score: 83.9593 bits (206), Expect = 9.699e-16
Identity = 74/225 (32.89%), Postives = 103/225 (45.78%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC-IDKKNSQ--FTCNCTSQFIGNLCQFE--NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKT 994
            C++  C NG  CV   + +  C+C   + G+ CE   N C    C+NGGTC +  +N +   +C C   F  +LC+    N C +V C NGGTC+      + C C  G+ GE C  +N+ C   P      C N   C      + F C C PG+TGD C    E      C+S+ C  GG C V  +GS  C C   +TGK+C    K        N  I ++
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHR-NPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNL-CASSP------CRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEE-----CQSNPCKYGGTC-VNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRS 272          

HSP 13 Score: 70.8626 bits (172), Expect = 9.514e-12
Identity = 74/251 (29.48%), Postives = 102/251 (40.64%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT-------------------------------------CIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+N G C +  +  F+CSC  G+ G  C+ N++DC   PC+N G                                      CID  NS F C C   + G +CQ + N C +  C+  G C+    G + C+C+ G  G+ C V    C   P      CNN   C I    +  C+C PG+TG  C+K  +      C S  C N GVC    NG   CEC   F   +C   + E      +N
Sbjct:  530 CQSNPCLNDGTCHDKIN-GFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNS-FKCLCDPGYTGYICQKQINECESNPCQFDGHCQD-RVGSYYCQCQAGTSGKNCEVNVNECHSNP------CNNGATC-IDGINSYKCQCVPGFTGQHCEKNVDE-----CISSPCANNGVCIDQVNGYK-CECPRGFYDAHCLSDVDECASNPCVN 764          
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 121.709 bits (304), Expect = 3.068e-27
Identity = 124/470 (26.38%), Postives = 200/470 (42.55%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEAL-------------INIKIPK-TFNEK-QLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKC--------------YGNDLKH---------CKGVFNDGVCNPECNNVDCLFDGEDCHK-----SSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSR------------------------SNSFFSNEGLTKCSTQTK---LYE--LDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTV 1528
            C ++PC NG         + C C  G++G+ CE N++DC  NPC+NGGTC D+    F+C+C    +G +C+  ++ C    C N G+C     G F+C C+ GF+G  C      C   P      C+N G  D    +  + C C PG+ G  C+ K +      C    C NGG C +  +G   C C   F GKNC +  ++                      + P+ T  E  ++      SP+ C     A+ E+ + D +C   +  + G  CD +                 Y  DL+          C     +G+C+ +CN   C FDG DC       ++C  ++C   ++N  C+EECN+  C +DG DC                            +N+  S +GL  C  +T+   L E  + +V++  ++ F + +++FL+ +S  LR  V +
Sbjct: 1187 CQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRV-MNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGG-FECVCQPGFVGARCEGDINECLSNP------CSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDF-----CAQSPCQNGGNCNIRQSGH-HCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQ--GAACEDLLGDYECLCPS-KWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDCNTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDCERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGL-DCENKTQSPVLAEGAMSVVMLMNVEAFREIQAQFLRNMSHMLRTTVRL 1638          

HSP 2 Score: 115.161 bits (287), Expect = 2.970e-25
Identity = 112/375 (29.87%), Postives = 166/375 (44.27%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE----------TRKEALINIKI---PKTFNEKQLIIKKTKSPSLCDN-------------LCKASFENGICD---QQCNTFACNYDGG-DCDPWRKCY------GNDLKHCKGVF---------NDGVCNPE-------CNNV----DCLFDGEDCHKSSCKFHKC 1279
            C+   C+NG  C++  +  + CSC  G+ G  C+  +N C  NPC NG TC  ++N+++TC+C S F G  C ++ + C    CENG TC  +++  F CKC  G+ G+ C VQ I+C     +K    R+LCNN G C  Y N +  C C  GY G  C K+ +      C+S  C NGG C+ L  G+  C+C+  F G+NC + + +          T  + ++N      P T      I K    P  C N             +C+  F    C+    +C +  C+  G  DC      Y      G+  +HC+            N G CN         CNN     +C   G+DC  + C+   C
Sbjct: 1026 CTESSCLNGGSCIDGIN-GYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC-HEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKH-QFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNN-GTCKDYGN-SHVCYCSQGYAGSYCQKEIDE-----CQSQPCQNGGTCRDLI-GAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNC 1389          

HSP 3 Score: 94.3597 bits (233), Expect = 5.736e-19
Identity = 71/203 (34.98%), Postives = 102/203 (50.25%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PCVN G+C +  + EF C C  G+ G+ CE ++++C  NPC++GGTC DK N+ F+C C   + G  C+   + C+   C NGGTC    NG ++C C+  F G  C  +   C          C N  +C    N   F C C  GYTG  CD+     ++    S  C NG  C  +  GS  C C   + G++C I
Sbjct:  757 CASNPCVNEGRCEDGIN-EFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNA-FSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNG-YKCVCKVPFTGRDCESKMDPC------ASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDED----IDECSLSSPCRNGASCLNVP-GSYRCLCTKGYEGRDCAI 945          

HSP 4 Score: 92.8189 bits (229), Expect = 1.762e-18
Identity = 73/200 (36.50%), Postives = 95/200 (47.50%), Query Frame = 2
Query:  341 CSNRPC-VNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC  +G C +     + C C  G  G+ CE NVN+C  NPC NG TCID  NS + C C   F G  C+   + C++  C N G C    NG ++C+C  GF    C      C   P      C N G C+   N    C C PGYTG RC    EL ++  C S+ C +GG C    N    C+C   +TG+ C
Sbjct:  643 CESNPCQFDGHCQDRVG-SYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINS-YKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNG-YKCECPRGFYDAHCLSDVDECASNP------CVNEGRCEDGIN-EFICHCPPGYTGKRC----ELDIDE-CSSNPCQHGGTCYDKLNAFS-CQCMPGYTGQKC 826          

HSP 5 Score: 92.4337 bits (228), Expect = 2.388e-18
Identity = 59/173 (34.10%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  455 CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCE-SLENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKREL-CNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI-CECKGEFTGKNCTIPLKETR 958
            C    C+NGGTC+ + N +  C C S ++G+ C+  NPC ++ C+NGGTC+ +  NG     CKC  GF    C +       +P     + C N G C +       C C  GYTG+RC+ K        C S  C NG  C  L   S   C C   FTG  C+  ++E +
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEI------AVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNL------CASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQ 222          

HSP 6 Score: 89.3521 bits (220), Expect = 2.124e-17
Identity = 68/196 (34.69%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            PC NG         +RC C  G++G  C  N +DC   PC+NGGTC+D     ++C C   F G  C+ + N CL+  C+NG TC    N  + C C  GF G  C   +  C          C N G C I       C C  GY+G  C  K        C S+ C NG  C   +N    C C   FTGK C+
Sbjct:  916 PCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGI-GDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVN-SYTCTCPLGFSGINCQTNDEDC------TESSCLNGGSC-IDGINGYNCSCLAGYSGANCQYKLNK-----CDSNPCLNGATCHEQNN-EYTCHCPSGFTGKQCS 1096          

HSP 7 Score: 87.8113 bits (216), Expect = 6.467e-17
Identity = 105/375 (28.00%), Postives = 149/375 (39.73%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI---PLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDN--------------------------LCKASFENGIC---DQQCNTFACNYDGGDCDPWRKCY------GNDLKHCKGVFNDGVCNPECNN---------------------VDCLFDGEDCHKSSC 1264
            V+   C + PC NG  C++  +  ++C C  G+ G+ CE+NV++CI +PC N G CID+ N  + C C   F    C  + + C +  C N G CE   N  F C C  G+ G+ C +    C   P      C + G C  Y  +  F C+C PGYTG +C+   +      C ++ C NGG C    NG   C CK  FTG++C     P    R +          F +     K   +   CD                           LC   +E   C      C +F C  +GG C      Y      G D KHC+   N+ +  P C N                     ++C  + EDC +SSC
Sbjct:  676 VNVNECHSNPCNNGATCIDGIN-SYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNG-YKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGIN-EFICHCPPGYTGKRCELDIDECSSNP------CQHGGTC--YDKLNAFSCQCMPGYTGQKCETNID-----DCVTNPCGNGGTCIDKVNGYK-CVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQ-NGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQP-CQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSC 1031          

HSP 8 Score: 87.0409 bits (214), Expect = 1.158e-16
Identity = 73/224 (32.59%), Postives = 105/224 (46.88%), Query Frame = 2
Query:  329 SSKLCSNRPCVNGKCVEAF--DPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCD------KKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEA 967
            +  LC++ PC NG    A      F CSC  G+ G+TC  ++ +C  NPCK GGTC++   S + C C + + G  C  +  PC    C+NGG C S  NG+ ++CKC  GF G+ C      C         LC N G C D   + T  C+C P +TG  C        +++ PV        C NG  C    +GS  C C   + G +C+    + ++ A
Sbjct:  177 TKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGS-YQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRS--NGLSYECKCPKGFEGKNCEQNYDDC------LGHLCQNGGTCIDGISDYT--CRCPPNFTGRFCQDDVDECAQRDHPV--------CQNGATCTNT-HGSYSCICVNGWAGLDCSNNTDDCKQAA 380          

HSP 9 Score: 85.1149 bits (209), Expect = 3.803e-16
Identity = 68/186 (36.56%), Postives = 85/186 (45.70%), Query Frame = 2
Query:  389 PEFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNG-SPICECKGEFTGKNC 934
            P   C C  G+    CE  V N C    C NGGTC  K   ++TC C + + G  C+ +N C +  C NG TC +L  +  F C C  GF G+ C+     C   P K    C N HG        +  C C  GYTG  CD K +      C    C NGG+C+   NG S  C+C   F GKNC
Sbjct:  120 PGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHG--------SYQCMCPTGYTGKDCDTKYKP-----CSPSPCQNGGICR--SNGLSYECKCPKGFEGKNC 290          

HSP 10 Score: 84.3445 bits (207), Expect = 6.806e-16
Identity = 62/228 (27.19%), Postives = 112/228 (49.12%), Query Frame = 2
Query: 2276 LGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQETLRK 2953
            L   +++ GE+ +H+AAR        + ++A   +  +  D  GRTPL +++AADA      + + +  LR  +     R                  TT LI A +L  + M+  L+   + +N  D+ G++ +HW+A  NN+   E ++ + +     D +D++D++PLFLAA EG+ ++ K LL  F    I   MD     P+ +A E+  ++I  L+ E + +
Sbjct: 1943 LNATMDKTGETSLHLAARFARADAAKRLLDA--GADANCQDNTGRTPLHAAVAADA------MGVFQILLRNRATNLNAR--------------MHDGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALHWAAAVNNT---EAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMD---RLPRDVASERLHHDIVRLLDEHVPR 2142          

HSP 11 Score: 84.3445 bits (207), Expect = 6.921e-16
Identity = 67/211 (31.75%), Postives = 99/211 (46.92%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN---CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            K CS  PC NG    +    + C C  G++G+ CE+N +DC+ + C+NGGTCID   S +TC C   F G  CQ + + C   +   C+NG TC +  +G + C C  G+ G  C+     C      K+  C     C I    + +C+C  G TG  C       ++  C S+ C    +C     NGS  C C   + G +C+  + E
Sbjct:  257 KPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGI-SDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNT-HGSYSCICVNGWAGLDCSNNTDDC------KQAACFYGATC-IDGVGSFYCQCTKGKTGLLCH------LDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDE 452          

HSP 12 Score: 83.9593 bits (206), Expect = 9.699e-16
Identity = 74/225 (32.89%), Postives = 103/225 (45.78%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC-IDKKNSQ--FTCNCTSQFIGNLCQFE--NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKT 994
            C++  C NG  CV   + +  C+C   + G+ CE   N C    C+NGGTC +  +N +   +C C   F  +LC+    N C +V C NGGTC+      + C C  G+ GE C  +N+ C   P      C N   C      + F C C PG+TGD C    E      C+S+ C  GG C V  +GS  C C   +TGK+C    K        N  I ++
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHR-NPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNL-CASSP------CRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEE-----CQSNPCKYGGTC-VNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRS 272          

HSP 13 Score: 70.8626 bits (172), Expect = 9.514e-12
Identity = 74/251 (29.48%), Postives = 102/251 (40.64%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT-------------------------------------CIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+N G C +  +  F+CSC  G+ G  C+ N++DC   PC+N G                                      CID  NS F C C   + G +CQ + N C +  C+  G C+    G + C+C+ G  G+ C V    C   P      CNN   C I    +  C+C PG+TG  C+K  +      C S  C N GVC    NG   CEC   F   +C   + E      +N
Sbjct:  530 CQSNPCLNDGTCHDKIN-GFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNS-FKCLCDPGYTGYICQKQINECESNPCQFDGHCQD-RVGSYYCQCQAGTSGKNCEVNVNECHSNP------CNNGATC-IDGINSYKCQCVPGFTGQHCEKNVDE-----CISSPCANNGVCIDQVNGYK-CECPRGFYDAHCLSDVDECASNPCVN 764          
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Match: eys (gene:FBgn0031414 transcript:FBtr0344662)

HSP 1 Score: 120.168 bits (300), Expect = 7.508e-27
Identity = 67/200 (33.50%), Postives = 99/200 (49.50%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PCV G C++  +  + C C  G+ G  C+ N ++C  +PC+NGGTC+D   + + C C   F G+ C+   + C++  C+NGG C    NG + C C+ G++G  C +    C      +   C + GEC   P +   C C  G+ G  C +      EI  C S  C NGGVC V    +  C C   +TG NC
Sbjct:  148 CLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQNGGTCVDGV-AYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNG-YICTCQPGYLGSHCELDVAVCETGTGAR---CQHGGECIEGPGLEFTCDCPAGWHGRICQE------EINECASSPCQNGGVC-VDKLAAYACACPMGYTGINC 335          

HSP 2 Score: 90.8929 bits (224), Expect = 6.466e-18
Identity = 53/148 (35.81%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD 805
            G+C+E    EF C C  GW G  C+E +N+C  +PC+NGG C+DK  + + C C   + G  C+ E   C +  C+N   C  +E G+  C C   + GE C  Q   C + P+     C N G C I    T  C C P  TG  C+
Sbjct:  274 GECIEGPGLEFTCDCPAGWHGRICQEEINECASSPCQNGGVCVDKL-AAYACACPMGYTGINCEEEILICADNPCQNNALC-LMEEGVPTCYCVPDYHGEKCEFQYDECQLGPR-----CMNGGVC-IDGVDTFSCSCPPLLTGMLCE 413          
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Match: eys (gene:FBgn0031414 transcript:FBtr0344663)

HSP 1 Score: 120.168 bits (300), Expect = 7.508e-27
Identity = 67/200 (33.50%), Postives = 99/200 (49.50%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PCV G C++  +  + C C  G+ G  C+ N ++C  +PC+NGGTC+D   + + C C   F G+ C+   + C++  C+NGG C    NG + C C+ G++G  C +    C      +   C + GEC   P +   C C  G+ G  C +      EI  C S  C NGGVC V    +  C C   +TG NC
Sbjct:  148 CLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQNGGTCVDGV-AYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNG-YICTCQPGYLGSHCELDVAVCETGTGAR---CQHGGECIEGPGLEFTCDCPAGWHGRICQE------EINECASSPCQNGGVC-VDKLAAYACACPMGYTGINC 335          

HSP 2 Score: 90.8929 bits (224), Expect = 6.466e-18
Identity = 53/148 (35.81%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD 805
            G+C+E    EF C C  GW G  C+E +N+C  +PC+NGG C+DK  + + C C   + G  C+ E   C +  C+N   C  +E G+  C C   + GE C  Q   C + P+     C N G C I    T  C C P  TG  C+
Sbjct:  274 GECIEGPGLEFTCDCPAGWHGRICQEEINECASSPCQNGGVCVDKL-AAYACACPMGYTGINCEEEILICADNPCQNNALC-LMEEGVPTCYCVPDYHGEKCEFQYDECQLGPR-----CMNGGVC-IDGVDTFSCSCPPLLTGMLCE 413          
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Match: LRP1 (gene:FBgn0053087 transcript:FBtr0344894)

HSP 1 Score: 97.8265 bits (242), Expect = 5.538e-20
Identity = 70/219 (31.96%), Postives = 96/219 (43.84%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALI--NIKIP 988
            +CS  P + G       P  +C+C  GW G  CE ++  C Q+ C NGG+C+  +     C+C   F G  C+    C N+ CENGG C     G  QC+C  GF G+ C +   A         + C N G C I       CKC  GY G+ C+          C+ D+C NGG C     G   C C   + G++C   L +T        N K+P
Sbjct: 4285 VCSVAPALPGS---QEPPPLKCTCTAGWSGARCETSMPAC-QSRCHNGGSCLISETEGMKCSCPKMFTGEQCEH---CRNLTCENGGICRETLTGTPQCECPDGFTGKRCEIDECA---------DFCKNGGSCVISTKGQRQCKCPSGYFGEHCESNS-------CR-DFCRNGGTCSER-GGRLSCTCPPRYIGESCESDLCKTSSPPHFCDNTKVP 4478          

HSP 2 Score: 62.3882 bits (150), Expect = 3.223e-9
Identity = 47/148 (31.76%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  518 CNCTSQFIGNLCQFENPCLNVNCENGGTCE-------SLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C C  QF G LC+      +  C+N G C        S E    +C C  G+ G  C     AC       +  C+N G C I     + C C   +TG++C+          C++  C NGG+C+    G+P CEC   FTGK C I
Sbjct: 4260 CICQPQFEGELCEHYR--CSGYCQNYGVCSVAPALPGSQEPPPLKCTCTAGWSGARCETSMPAC-------QSRCHNGGSCLISETEGMKCSCPKMFTGEQCEH---------CRNLTCENGGICRETLTGTPQCECPDGFTGKRCEI 4389          
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Match: notch1b (notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415-183])

HSP 1 Score: 210.69 bits (535), Expect = 2.153e-54
Identity = 244/990 (24.65%), Postives = 399/990 (40.30%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCI--------QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP---------------LKETRKEALINIKIPKTFN--------------EKQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS---------------------RSNSFFSNEGLTKCSTQTKLYELDLV-------------------LMTTMQNFTKYKSEFLQKLSSSLRMVVTVFN--VTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKL----------------RSKIKTAGVWXXXXXXXXXXXXXXXGYN-FGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPI------DAGL--GDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLA--DLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C ++PC NG  C++  +  ++CSC  G +G  CE N++DC         +  C N G C+D+    + C C   ++G  C+ + N CL+  C    +C  L+N  ++C+CR G+ G+ C        V    K + C N G C +  N      CKC PG+TG  C+          C S  C NGG C V  + SP C C   FTG  C  P                +   +E   +   P  FN                Q I    K    C+   CK    N ICD  CN +AC++DGGDC     DPW+ C       C   FN+G C+ +C+N  CL+DG DC +   + +      C + + +  CD+ CN+ +C +DG DC                        R+NSF     L++      ++  D                     +  ++  +    S+ L  + +S+  +V        E+        ++ L ++  QC     +CF S    + FL A    G+ L +P+ +  V + I   S  +  P+Y ++    LL F     +     R + G+L                R  +    V        +  S ++   N +G  +    K F+ E Q    ++  + QP   Q    H D       SI     + E  N          +  +    DG  P+        GL  G+         ++  D  YQ ++L       +  GE+ +H+AAR        + + A   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A      +    + M + +  A  D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+++  ++I  LI E
Sbjct: 1167 CLSQPCQNGGTCIDLIN-TYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGG-YHCICPPGYVGERCEGDVNECLSNPCGTH-SCIQLKNN-YRCECRTGYTGQHCD------KVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAH-----ACGSLQCKNGGTC-VSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHILDWSFPGGTGQDITPAPKVSVSCEIEQCKVKKGNKICDSACNNYACDWDGGDCSLNFNDPWKNCSA--ALQCWRYFNNGKCDEQCHNTGCLYDGFDCQRVEAQCNPLYDQYCKDHFADGYCDQGCNNAECEWDGLDCANDTPEKLAAGLLVVVVHIHPDQLRNNSFGFLRELSRVLHTNVVFRRDSKGQEMIYPYYGNEQELKKHNIKRSLDGWNDASSDVLSSMKNSIYNIVVEGGRKRRELEKIQVKGSVVYLEIDNRQCYQQTSECFQSANDAAAFLGALASSGS-LKMPYVIEAVTSEIDGPSPVELYPVYVVLAGLALLAFVAIGMVASRKRRREHGQLWFPEGFKTSEPSKKKRREPVGEDSVGLRPLKNCSDISLMDDNQNEWGEEEQSDSKRFRSEEQ---AMLDLDDQPDHRQWTQQHLDAADLRIPSIAPTPPQGEIEN--------DCMDVNARGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLH---NQTDRTGETALHLAARYARSDAAKRLLEASADANIQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMH-------------------DGTTPLILAARLAVEGMVEELINCHADVNAIDDFGKSALHWAAA-----VNNVDAAMVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMD---RLPRDIAQDRMHHDIVRLIDE 2093          

HSP 2 Score: 93.5893 bits (231), Expect = 1.521e-18
Identity = 122/474 (25.74%), Postives = 160/474 (33.76%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGW------------------------------------------------KGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVI--PKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK------------------KKELPVEI--------------GCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQ----QCNTFACNYDGGDC-----DPWRKCY---------------------GND------------LKHCKGVFNDGVCNPECNNVDCLFDGEDCH-------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCH 1357
            C   PC NG         + C C  GW                                                 G  CEE V++CI NPC+NG TC D     ++C C   + G  C  E N CL+  C+NGGTC  L N  ++C C  G  G  C +    C     P      C N G C +       C C PGY G+RC+                   K     E               GCK   C NGG C V  N +P   IC+C   FTG  C     E    A  +++           +   KSP     LC  +F    C       C T  C Y+GG C     +P+  C                      G D            ++ CK    + +C+  CNN  C +DG DC        K+     +C   + N  CDE+C++  C +DG DC 
Sbjct: 1043 CKPSPCKNGGICRQSGTRYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGG-YSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLIN-TYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRC-VDRVGGYHCICPPGYVGERCEGDVNECLSNPCGTHSCIQLKNNYRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASN-TPHGFICKCPPGFTGSTC-----EYDAHACGSLQC----KNGGTCVSGHKSPKC---LCTPAFTGPECQDPSGGHCTTNPC-YNGGTCEYITEEPYYHCICPTNFNGLFCHILDWSFPGGTGQDITPAPKVSVSCEIEQCKVKKGNKICDSACNNYACDWDGGDCSLNFNDPWKNCSAALQCWRYFNNGKCDEQCHNTGCLYDGFDCQ 1499          

HSP 3 Score: 92.8189 bits (229), Expect = 2.151e-18
Identity = 107/374 (28.61%), Postives = 150/374 (40.11%), Query Frame = 2
Query:  317 LVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN--------------IKIPKTFNEKQLIIKK-TKSP----SLCDNL-------CKASF------------------ENGICDQQCNTFAC----NYDGGDCDP-WRKCYGNDLKH---CKGVFNDGVCN--PECNNVDCLFDGEDCHKSSC 1264
            L  ++   C ++PC NG   +  +  + C C  G  G  CE N++DC  NPC + G CIDK N  + C C   + G +C    + C    C NGGTC    NG F C CR G+    C  Q   C   P I          HG C+   N    C CD G++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N                +P T    ++ I +  K+P    ++C N        CKA +                    G C    N FAC     + GG C+    +C  N  K+   C    N   C   P  + + C  +  DC +SSC
Sbjct:  619 LCEININECLSQPCQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPC-DFGRCIDKING-YECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNG-FTCLCREGYHDTTCQSQLNECLSNPCI----------HGHCEDKVN-GYNCICDSGWSGVNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCTCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGQTCEVDINECVKNPCRNDAICQNSIGSYKCSCKAGYTGRNCETDIDDCKPNPCSNGGFCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSC 972          

HSP 4 Score: 92.4337 bits (228), Expect = 3.630e-18
Identity = 79/253 (31.23%), Postives = 105/253 (41.50%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF------ENPC------------------------LNVN--------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C +     F C C  G+ G  CE N+N+C+  PC+NGGTC D++N+ + C C     G  C+        NPC                         N+N        C NGGTC    NG F C CR G+    C  Q   C   P I          HG C+   N    C CD G++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  590 CLSNPCHYGTCKDGL-ASFTCVCRAGFMGRLCEININECLSQPCQNGGTCQDRENA-YLCVCPKGTAGANCEINLDDCQSNPCDFGRCIDKINGYECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNG-FTCLCREGYHDTTCQSQLNECLSNPCI----------HGHCEDKVN-GYNCICDSGWSGVNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCTCRAGFSGPNCQTNINECASNPCLN 822          

HSP 5 Score: 86.2705 bits (212), Expect = 2.576e-16
Identity = 74/225 (32.89%), Postives = 102/225 (45.33%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL-----CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC--IDKKNS-QFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            M++F +  ++VI  + L     CS +    G C    D    C C   + G  C+   N C Q+PC+NGG C  I   N   F CNC+  +   LC     N CL   C NGGTCE      ++CKC  G+ G+ C  Q   C   P      C N G+C  + +    C C P ++G  C +      +I      C NGGVC+    G+  C C  E+TGK+C
Sbjct:    1 MHLFFVKLIVVISLNTLTQGLECSEKCQNGGTCEPTADGRGECKCLDLYAGPACQFR-NPCFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQ-QADPCASNP------CANGGQCSPF-DSDFLCHCTPYFSGQTCKQDVNECAQI---PSPCKNGGVCEN-GVGTYHCNCPAEYTGKHC 212          

HSP 6 Score: 80.8777 bits (198), Expect = 1.020e-14
Identity = 74/273 (27.11%), Postives = 105/273 (38.46%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAV-QNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACN----YDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSC 1264
            C+NGGTC    + +  C C   + G  CQF NPC    C NGG C  + +     F C C  G+    C    N  C   P      C N G C++       CKC PG++G  C +         C S+ C NGG C   D+   +C C   F+G+ C                       KQ + +  + PS C N        G+C+    T+ CN    Y G              KHC+ ++     +P  +   C+  GE  ++ SC
Sbjct:   27 CQNGGTCEPTADGRGECKCLDLYAGPACQFRNPCFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAP------CRNGGTCELTSIHNYRCKCPPGWSGKTCQQADP------CASNPCANGGQCSPFDSDF-LCHCTPYFSGQTC-----------------------KQDVNECAQIPSPCKN-------GGVCENGVGTYHCNCPAEYTG--------------KHCESLYQPCNPSPCLHGGTCVQKGETSYECSC 242          

HSP 7 Score: 77.0258 bits (188), Expect = 1.707e-13
Identity = 65/207 (31.40%), Postives = 99/207 (47.83%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ--NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C++ PC NG     FD +F C C   + G+TC+++VN+C Q  +PCKNGG C +   + + CNC +++ G  C+    PC    C +GGTC       ++C C  G   EF  +            R+  N+      Y  M +F     G++G  C++  +      C    C NGG C V    +  C+CK E+TG+ CT  + E
Sbjct:  141 CASNPCANGGQCSPFDSDFLCHCTPYFSGQTCKQDVNECAQIPSPCKNGGVCENGVGT-YHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCLPGRQ-EFVLIM-----------RKCLND------YFLMLVF----IGFSGQNCEENID-----DCPDHRCLNGGTC-VDGVNTYNCQCKPEWTGQFCTEDVNE 318          

HSP 8 Score: 76.2554 bits (186), Expect = 2.928e-13
Identity = 65/232 (28.02%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSD----------YC-----FNGGVCKV----------LDNGSPI-------CECKGEFTGKNCTIPLKE 952
            C NG         + C C +GW G+ C EN++DC    C  G TC D+  S F C C     G LC  ++ C++  C+ G  C++   NG   C C  G++G  C      C +        C + G+C I    +  CKC  GY G RC+      +   C++D          +C     + G  C++          L+NG  I       CEC   F+G  C   + E
Sbjct:  326 CQNGGTCLNTQGGYNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVAS-FLCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSL----GANPCEHAGKC-INTKGSFQCKCLQGYVGARCELDINECLSTPCQNDATCLDQIGGFHCICMPGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDE 551          

HSP 9 Score: 71.633 bits (174), Expect = 7.465e-12
Identity = 70/263 (26.62%), Postives = 109/263 (41.44%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSC-----------------------WHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCA-----VQNIACPV--------------IPKKKREL------------CNNHGECDIYP-NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C+  PC++G  CV+  +  + CSC                       + G+ G+ CEEN++DC  + C NGGTC+D  N+ + C C  ++ G  C  + N C  +  +C+NGGTC + + G + C C  G+ G+ C+       + AC                 P  +  L            C     CD  P N    C C  GY G  CD+  +   E    ++ C + G C +   GS  C+C   + G  C + + E
Sbjct:  219 CNPSPCLHGGTCVQKGETSYECSCLPGRQEFVLIMRKCLNDYFLMLVFIGFSGQNCEENIDDCPDHRCLNGGTCVDGVNT-YNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGG-YNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVASFLCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVD---ECSLGANPCEHAGKC-INTKGSFQCKCLQGYVGARCELDINE 475          

HSP 10 Score: 68.9366 bits (167), Expect = 3.964e-11
Identity = 60/194 (30.93%), Postives = 77/194 (39.69%), Query Frame = 2
Query:  341 CSNRPCVNGKC----VEAFDPEFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICEC 907
            C   PC NG        A   +F C+C  G+    C    N+ C+  PC+NGGTC       + C C   + G  CQ  +PC +  C NGG C   ++  F C C   F G+ C      C  IP      C N G C+     T  C C   YTG  C+   +      C    C +GG C      S  C C
Sbjct:   60 CFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQQADPCASNPCANGGQCSPFDSD-FLCHCTPYFSGQTCKQDVNECAQIPSP----CKNGGVCENGVG-TYHCNCPAEYTGKHCESLYQP-----CNPSPCLHGGTCVQKGETSYECSC 242          
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Match: notch1b (notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415-183])

HSP 1 Score: 209.92 bits (533), Expect = 2.962e-54
Identity = 244/990 (24.65%), Postives = 399/990 (40.30%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCI--------QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP---------------LKETRKEALINIKIPKTFN--------------EKQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS---------------------RSNSFFSNEGLTKCSTQTKLYELDLV-------------------LMTTMQNFTKYKSEFLQKLSSSLRMVVTVFN--VTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKL----------------RSKIKTAGVWXXXXXXXXXXXXXXXGYN-FGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPI------DAGL--GDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLA--DLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C ++PC NG  C++  +  ++CSC  G +G  CE N++DC         +  C N G C+D+    + C C   ++G  C+ + N CL+  C    +C  L+N  ++C+CR G+ G+ C        V    K + C N G C +  N      CKC PG+TG  C+          C S  C NGG C V  + SP C C   FTG  C  P                +   +E   +   P  FN                Q I    K    C+   CK    N ICD  CN +AC++DGGDC     DPW+ C       C   FN+G C+ +C+N  CL+DG DC +   + +      C + + +  CD+ CN+ +C +DG DC                        R+NSF     L++      ++  D                     +  ++  +    S+ L  + +S+  +V        E+        ++ L ++  QC     +CF S    + FL A    G+ L +P+ +  V + I   S  +  P+Y ++    LL F     +     R + G+L                R  +    V        +  S ++   N +G  +    K F+ E Q    ++  + QP   Q    H D       SI     + E  N          +  +    DG  P+        GL  G+         ++  D  YQ ++L       +  GE+ +H+AAR        + + A   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A      +    + M + +  A  D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+++  ++I  LI E
Sbjct: 1138 CLSQPCQNGGTCIDLIN-TYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGG-YHCICPPGYVGERCEGDVNECLSNPCGTH-SCIQLKNN-YRCECRTGYTGQHCDK------VFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAH-----ACGSLQCKNGGTC-VSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHILDWSFPGGTGQDITPAPKVSVSCEIEQCKVKKGNKICDSACNNYACDWDGGDCSLNFNDPWKNCSA--ALQCWRYFNNGKCDEQCHNTGCLYDGFDCQRVEAQCNPLYDQYCKDHFADGYCDQGCNNAECEWDGLDCANDTPEKLAAGLLVVVVHIHPDQLRNNSFGFLRELSRVLHTNVVFRRDSKGQEMIYPYYGNEQELKKHNIKRSLDGWNDASSDVLSSMKNSIYNIVVEGGRKRRELEKIQVKGSVVYLEIDNRQCYQQTSECFQSANDAAAFLGALASSGS-LKMPYVIEAVTSEIDGPSPVELYPVYVVLAGLALLAFVAIGMVASRKRRREHGQLWFPEGFKTSEPSKKKRREPVGEDSVGLRPLKNCSDISLMDDNQNEWGEEEQSDSKRFRSEEQ---AMLDLDDQPDHRQWTQQHLDAADLRIPSIAPTPPQGEIEN--------DCMDVNARGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLH---NQTDRTGETALHLAARYARSDAAKRLLEASADANIQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMH-------------------DGTTPLILAARLAVEGMVEELINCHADVNAIDDFGKSALHWAAA-----VNNVDAAMVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMD---RLPRDIAQDRMHHDIVRLIDE 2064          

HSP 2 Score: 94.3597 bits (233), Expect = 7.791e-19
Identity = 70/219 (31.96%), Postives = 98/219 (44.75%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +++  C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC +  C+NGG C ES +   F C C  G+ G+ C V    C   P +   +C N          +  C C  GYTG  C+   +      CK + C NGG CK   N    C C   F G  C   + E       N
Sbjct:  703 INNNECESNPCMNGGTCKDMTSGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGENCETLLAPCGSKPCKNGGVCKESEDYESFSCVCPAGWQGQTCEVDINECVKNPCRNDAICQNS-------IGSYKCSCKAGYTGRNCETDID-----DCKPNPCSNGGFCKDAVNAF-ACTCLPGFRGGRCEEDINECESNPCKN 907          

HSP 3 Score: 92.8189 bits (229), Expect = 2.296e-18
Identity = 122/474 (25.74%), Postives = 160/474 (33.76%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGW------------------------------------------------KGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVI--PKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK------------------KKELPVEI--------------GCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQ----QCNTFACNYDGGDC-----DPWRKCY---------------------GND------------LKHCKGVFNDGVCNPECNNVDCLFDGEDCH-------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCH 1357
            C   PC NG         + C C  GW                                                 G  CEE V++CI NPC+NG TC D     ++C C   + G  C  E N CL+  C+NGGTC  L N  ++C C  G  G  C +    C     P      C N G C +       C C PGY G+RC+                   K     E               GCK   C NGG C V  N +P   IC+C   FTG  C     E    A  +++           +   KSP     LC  +F    C       C T  C Y+GG C     +P+  C                      G D            ++ CK    + +C+  CNN  C +DG DC        K+     +C   + N  CDE+C++  C +DG DC 
Sbjct: 1014 CKPSPCKNGGICRQSGTRYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGG-YSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLIN-TYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRC-VDRVGGYHCICPPGYVGERCEGDVNECLSNPCGTHSCIQLKNNYRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASN-TPHGFICKCPPGFTGSTC-----EYDAHACGSLQC----KNGGTCVSGHKSPKC---LCTPAFTGPECQDPSGGHCTTNPC-YNGGTCEYITEEPYYHCICPTNFNGLFCHILDWSFPGGTGQDITPAPKVSVSCEIEQCKVKKGNKICDSACNNYACDWDGGDCSLNFNDPWKNCSAALQCWRYFNNGKCDEQCHNTGCLYDGFDCQ 1470          

HSP 4 Score: 92.0485 bits (227), Expect = 4.705e-18
Identity = 79/253 (31.23%), Postives = 105/253 (41.50%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF------ENPC------------------------LNVN--------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C +     F C C  G+ G  CE N+N+C+  PC+NGGTC D++N+ + C C     G  C+        NPC                         N+N        C NGGTC    NG F C CR G+    C  Q   C   P I          HG C+   N    C CD G++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  521 CLSNPCHYGTCKDGL-ASFTCVCRAGFMGRLCEININECLSQPCQNGGTCQDRENA-YLCVCPKGTAGANCEINLDDCQSNPCDFGRCIDKINGYECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNG-FTCLCREGYHDTTCQSQLNECLSNPCI----------HGHCEDKVN-GYNCICDSGWSGVNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCTCRAGFSGPNCQTNINECASNPCLN 753          

HSP 5 Score: 84.7297 bits (208), Expect = 6.726e-16
Identity = 83/314 (26.43%), Postives = 124/314 (39.49%), Query Frame = 2
Query:  314 LLVIVSSKLCSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN------------------------------------SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCD---NLCKAS--FENGICDQQCNTFACNYDGG 1126
            +   +++  C++ PC+N GKC++  +  ++C C  G+ G  C+ ++++C   PCKNG  C+D  N                                    + FTC C + F+G LC+   N CL+  C+NGGTC+  EN  + C C  G  G  C +    C   P        + G C I       C C+PGYTG  C+   +      C  + C NGG C    NG   C C+  +    C   L E      I+       N    I     S   CD   N C+++     G C    + + C    G
Sbjct:  436 VFCQINTDECASMPCLNNGKCIDKIN-NYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGPNMYTCQCTEGYTGQHCETDVDECLSNPCHYGTCKDGLASFTCVCRAGFMGRLCEININECLSQPCQNGGTCQDREN-AYLCVCPKGTAGANCEINLDDCQSNPC-------DFGRC-IDKINGYECACEPGYTGKMCNINIDE-----CAINPCHNGGTCVDGVNGF-TCLCREGYHDTTCQSQLNECLSNPCIHGHCEDKVNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDMTSGYVCTCRAG 733          

HSP 6 Score: 83.5741 bits (205), Expect = 1.538e-15
Identity = 70/240 (29.17%), Postives = 108/240 (45.00%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCA-----VQNIACPV--------------IPKKKREL------------CNNHGECDIYP-NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C+  PC++G  CV+  +  + CSC  G+ G+ CEEN++DC  + C NGGTC+D  N+ + C C  ++ G  C  + N C  +  +C+NGGTC + + G + C C  G+ G+ C+       + AC                 P  +  L            C     CD  P N    C C  GY G  CD+  +   E    ++ C + G C +   GS  C+C   + G  C + + E
Sbjct:  173 CNPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNT-YNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGG-YNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVASFLCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVD---ECSLGANPCEHAGKC-INTKGSFQCKCLQGYVGARCELDINE 406          

HSP 7 Score: 77.0258 bits (188), Expect = 1.747e-13
Identity = 60/167 (35.93%), Postives = 79/167 (47.31%), Query Frame = 2
Query:  449 NDCIQNPCKNGGTC--IDKKNS-QFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            N C Q+PC+NGG C  I   N   F CNC+  +   LC     N CL   C NGGTCE      ++CKC  G+ G+ C  Q   C   P      C N G+C  + +    C C P ++G  C +      +I      C NGGVC+    G+  C C  E+TGK+C
Sbjct:   12 NPCFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQ-QADPCASNP------CANGGQCSPF-DSDFLCHCTPYFSGQTCKQDVNECAQI---PSPCKNGGVCEN-GVGTYHCNCPAEYTGKHC 166          

HSP 8 Score: 76.2554 bits (186), Expect = 2.407e-13
Identity = 64/203 (31.53%), Postives = 83/203 (40.89%), Query Frame = 2
Query:  341 CSNRPCVNGKC----VEAFDPEFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C   PC NG        A   +F C+C  G+    C    N+ C+  PC+NGGTC       + C C   + G  CQ  +PC +  C NGG C   ++  F C C   F G+ C      C  IP      C N G C+     T  C C   YTG  C+   +      C    C +GG C      S  C C   F+G+NC
Sbjct:   14 CFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQQADPCASNPCANGGQCSPFDSD-FLCHCTPYFSGQTCKQDVNECAQIPSP----CKNGGVCENGVG-TYHCNCPAEYTGKHCESLYQP-----CNPSPCLHGGTCVQKGETSYECSCLPGFSGQNC 205          

HSP 9 Score: 75.0998 bits (183), Expect = 6.037e-13
Identity = 68/241 (28.22%), Postives = 98/241 (40.66%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ--NPCKNGG--------------------------------------TCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC NG     FD +F C C   + G+TC+++VN+C Q  +PCKNGG                                      TC+ K  + + C+C   F G  C+   + C +  C NGGTC    N  + C+C+  + G+FC      C ++P      C N G C +       C C  G+TGD C +  +      C    C  G  C      S +CEC    TG  C +
Sbjct:   95 CASNPCANGGQCSPFDSDFLCHCTPYFSGQTCKQDVNECAQIPSPCKNGGVCENGVGTYHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNS----CQNGGTC-LNTQGGYNCVCVNGWTGDDCSENID-----DCADAACHTGATCHDR-VASFLCECPHGRTGLLCHL 323          

HSP 10 Score: 70.4774 bits (171), Expect = 1.463e-11
Identity = 72/262 (27.48%), Postives = 103/262 (39.31%), Query Frame = 2
Query:  533 QFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAV-QNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACN----YDGGDCDP-WRKCYGNDLKHCKGVFNDGVCNPECNNVDCL--FDGEDCHKS--SCKFHKC 1279
            Q+ G  CQF NPC    C NGG C  + +     F C C  G+    C    N  C   P      C N G C++       CKC PG++G  C +         C S+ C NGG C   D+   +C C   F+G+ C                       KQ + +  + PS C N        G+C+    T+ CN    Y G  C+  ++ C  +   H       G  + EC+   CL  F G++C ++   C  H+C
Sbjct:    2 QYAGPACQFRNPCFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAP------CRNGGTCELTSIHNYRCKCPPGWSGKTCQQADP------CASNPCANGGQCSPFDSDF-LCHCTPYFSGQTC-----------------------KQDVNECAQIPSPCKN-------GGVCENGVGTYHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECS---CLPGFSGQNCEENIDDCPDHRC 217          
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Match: notch1a (notch receptor 1a [Source:NCBI gene;Acc:30718])

HSP 1 Score: 157.532 bits (397), Expect = 3.501e-38
Identity = 145/599 (24.21%), Postives = 222/599 (37.06%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL---------------KETRKEALINIKIPKTFN--------------EKQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGL---------TKCSTQTKLYELDLVLMTTM-------------------QNFTKYK-------SEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIY 1762
            C   PC NG     +   + C C  G+ G  C + +N+C+  PC+NGGTCID  N+                                              + C C + F+G  C+ + N CL+  C+  G+  C  L N  F+C+CR G+ G+ C      C   P      C N G C +  N      CKC PGY+G  C+   +      C S  C NG  C V  + SP C C   F+G  C   +               +            P  FN              + + I    +    C+   C+    N ICD QCN  AC +DGGDC     DPW+ C       C   FNDG C+ +C    CL+DG DC +   + +      C + Y +  CD+ CN+ +C +DG DC             +          +  + + L EL  +L T +                      +K+K        + +Q+   SL   +      E++       ++ L ++  QC     +CF S   ++ FL A    GN L++P+ +  V +        +  P++
Sbjct:  365 CQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPAGFVGERCEGDVNECLSDPCDPSGSYNCVQLIND-FRCECRTGYTGKRCETVFNGCKDTP------CKNGGTCAVASNTKHGYICKCQPGYSGSSCEYDSQ-----SCGSLRCRNGATC-VSGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHILDYSFSGGQGRDIAPPVEVEIRCEIAQCEGRGGNAICDTQCNNHACGWDGGDCSLNFDDPWQNCSA--ALQCWRYFNDGKCDEQCATAGCLYDGFDCQRLEGQCNPLYDQYCRDHYADGHCDQGCNNAECEWDGLDCADDVPQKLAVGSLVLVVHIPPDELRNRSSSFLRELSSLLHTNVVFRRDANGEALIFPYYGSEHELSKHKRSDWTDPGQLMQRARRSLTSFLKPRTRRELDHMEVKGSIVYLEIDNRQCFQQSDECFQSATDVAAFLGALASSGN-LNVPYIIEAVTSEGGPPKTGEMYPMF 947          

HSP 2 Score: 110.153 bits (274), Expect = 1.135e-23
Identity = 80/207 (38.65%), Postives = 100/207 (48.31%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFD-PEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            CS RPC NG  C E+ D   F C+C  GW+G+TCE ++N+C++NPC NGG C + +   F C C   F G LC+ + + C    C NGG C+   NG F C C  GF GE CA     C   P      C N G C    N +  C C  G++G  C+          C    CFNGG C V    S  C C   FTG  C   + E
Sbjct:   49 CSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGG-FQCRCNPGFTGALCENDIDDCEPNPCSNGGVCQDRVNG-FVCVCLAGFRGERCAEDIDECVSAP------CRNGGNCTDCVN-SYTCSCPAGFSGINCEINTP-----DCTESSCFNGGTC-VDGISSFSCVCLPGFTGNYCQHDVNE 240          

HSP 3 Score: 107.071 bits (266), Expect = 1.026e-22
Identity = 76/215 (35.35%), Postives = 105/215 (48.84%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQ-FTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC+N G C++     F+C+C   + GE CE  +  C   PCKNGG C + ++ Q F+CNC + + G  C+ + N C+   C NGG CE+L  G FQC+C  GF G  C      C   P      C+N G C    N    C C  G+ G+RC +  +      C S  C NGG C    N S  C C   F+G NC I   +  + +  N
Sbjct:   11 CASNPCLNQGSCIDDV-AGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGG-FQCRCNPGFTGALCENDIDDCEPNP------CSNGGVCQDRVN-GFVCVCLAGFRGERCAEDIDE-----CVSAPCRNGGNCTDCVN-SYTCSCPAGFSGINCEINTPDCTESSCFN 210          

HSP 4 Score: 97.8265 bits (242), Expect = 5.865e-20
Identity = 69/199 (34.67%), Postives = 89/199 (44.72%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C   PC NG   E     F+C C  G+ G  CE +++DC  NPC NGG C D+ N  F C C + F G  C  + + C++  C NGG C    N  + C C  GF G  C +        P      C N G C +    +  C C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:   89 CVRNPCTNGGVCENLRGGFQCRCNPGFTGALCENDIDDCEPNPCSNGGVCQDRVNG-FVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNS-YTCSCPAGFSGINCEIN------TPDCTESSCFNGGTC-VDGISSFSCVCLPGFTGNYCQHDVNE-----CDSRPCQNGGSCQD-GYGTYKCTCPHGYTGLNC 272          

HSP 5 Score: 90.8929 bits (224), Expect = 7.998e-18
Identity = 63/178 (35.39%), Postives = 88/178 (49.44%), Query Frame = 2
Query:  425 GETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            G  C+ N+N+C  NPC N G+CID   + F CNC   + G +C+    PC    C+NGG C ES +   F C C  G+ G+ C V       I +  R  C N G C+        C+C+PG+TG  C+   +      C+ + C NGGVC+   NG  +C C   F G+ C   + E
Sbjct:    1 GPNCQMNINECASNPCLNQGSCIDDV-AGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVD------INECVRNPCTNGGVCENL-RGGFQCRCNPGFTGALCENDID-----DCEPNPCSNGGVCQDRVNGF-VCVCLAGFRGERCAEDIDE 164          

HSP 6 Score: 89.3521 bits (220), Expect = 2.658e-17
Identity = 70/238 (29.41%), Postives = 100/238 (42.02%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-----------ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIK 1021
            C +RPC NG   +     ++C+C HG+ G  C+  V  C  +PCKNGG+C  ++ + FTC C S + G  C             +   + V C + G C    N    C+C+ G+ G +C  Q   C   P      C N   C  Y      C+C PGY G  C K+        C S  C NGG C  L N +  C C     G +C I + +           P+ FN  + + +
Sbjct:  241 CDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCW-QQGASFTCQCASGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHL-CRCQAGYTGSYCQEQVDECQPNP------CQNGATCTDYLG-GYSCECVPGYHGMNCSKEINE-----CLSQPCQNGGTCIDLVN-TYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDR 463          

HSP 7 Score: 77.411 bits (189), Expect = 1.090e-13
Identity = 61/222 (27.48%), Postives = 107/222 (48.20%), Query Frame = 2
Query: 2276 LGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            L    +  GE+ +H+AAR        + + +   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L  + M+  L++  +  N +D  G+S +HW+A  NN      L      +   DL++N++++PLFLAA EG+ ++ K LL +     I  D     P+ IA E+  ++I  L++E
Sbjct: 1126 LHNQTDRTGETALHLAARYARSDAAKRLLESCADANVQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMHD-------------------GTTPLILATRLAVEGMVEELINCHADPNAVDDSGKSALHWAAAVNNVDAAVVLLKNGANK---DLQNNKEETPLFLAAREGSYETAKVLLDHLANRDIA-DHLDQLPRDIAHERMHHDIVRLLEE 1321          
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Match: notch3 (notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-5])

HSP 1 Score: 155.221 bits (391), Expect = 2.270e-37
Identity = 143/552 (25.91%), Postives = 224/552 (40.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVN-------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP--ICECKGEFTGKN-----------------CTIPLKETRKEALINIKIP------------KTFNEKQLIIKKTKSPSL---CDNL------------------------CKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDC---HKSSCKFHK--CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNV-------------------TEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARV 1714
            C  +PC+NG    ++   F C C  G++G  CE  VN+C  +PC+NGGTCID     + C+C    +G LC+  E+ C   +       C+N GTC     G ++C C  GF GE C      C   P       +N  +C   PN    C C PG+TG  C  +  +     C+S  C NGGVC +  +  P   C C+  + G N                 CT+  +  R   +     P            K  +   L  ++T  P     C N                         C +   +G+CD++CN+  C +DGGDC    +PW +C       C  +FN+  C+  CNN +CLFD  DC    K     ++  C++ Y + +CD+ CN+ +CG+DG DC          +              L +V++   +   + ++ FLQKLS+ LR  +  F +                    E+N       ++ L ++   C      CF + +  + +L A +    +L  P+ +  V
Sbjct: 1054 CEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDLV-GHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGG-YRCNCPPGFTGERCEGDINECLSNPCNP----SNSLDCIQLPN-DYQCVCKPGFTGRGCQSRFSV-----CESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMNCKELPCYNGGSCTLTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLPSPCPIADCFSKANDGVCDKECNSLDCRWDGGDCSLAVNPWARCAD---PRCWRLFNNSQCDEFCNNAECLFDNFDCINKEKVCNPIYEAYCTDHYADGLCDQGCNTEECGWDGLDCARKIPEDLAED-------------MLVIVVLLPPEELLRTQTAFLQKLSAILRTTLR-FRLDRNGDYMIRPYTGRETRIKRELNPQEVIGSIVYLEIDNRLCSQGSDDCFRNADSAAEYLGA-LSAREMLRFPYPIKEV 1575          

HSP 2 Score: 118.627 bits (296), Expect = 2.911e-26
Identity = 80/199 (40.20%), Postives = 104/199 (52.26%), Query Frame = 2
Query:  353 PCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENP-CLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            PC+NG  C +  +  FRCSC  G+ G  C   +N+C   PCKNGGTC D  NS +TC C   F G LC+   P C   +C NGGTC    NG F+C CR GF G++C  +   C   P     +C +  E       +  C C  GYTG RC    + PV+    S+ C NGG C+  D  S  C+C G ++G+ C IP
Sbjct:  819 PCLNGGSCTDGVN-SFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNS-YTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGING-FKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAME-------SYRCSCPKGYTGPRC----QYPVDWCRPSNPCKNGGRCRQKD-ASFTCDCLGGWSGRYCDIP 1002          

HSP 3 Score: 101.679 bits (252), Expect = 4.468e-21
Identity = 74/202 (36.63%), Postives = 103/202 (50.99%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C + PC N   C++    EF C C  G++G+ CE ++++C  NPC N G C D  N  FTC C   F G +CQ + + C +  C+NG  C    NG ++C+C  GF G  C         I   K + C +HG C +    +  C C+PGYTG RC+ +        C S+ C NGG C  L N   IC+C+   +G NC I
Sbjct:  411 CLSMPCQNDATCLDRIG-EFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNG-FTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNG-YECRCAEGFEGRLCESN------IDNCKPDPC-HHGTC-VDGIASYTCNCEPGYTGYRCENQLNE-----CHSNPCQNGGKCVDLVNKY-ICQCQHGTSGTNCEI 595          

HSP 4 Score: 99.3673 bits (246), Expect = 2.205e-20
Identity = 78/279 (27.96%), Postives = 114/279 (40.86%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN----------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +N F   CL     ++       C + PC NG     +   + C+C  G+ G  CE NV DC ++ C NGGTC D  N  F C C + F G+ CQ+E       PCLN                                    C+NGG C   ++  F C C  G+ G +C +  ++C V  +++     ELC + G C +    T +CKC   YTG  C+ + +      C+   C NG  C+    G   C+C   + G NC   + E +     N
Sbjct:  830 VNSFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGING-FKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCRQ-KDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHC-VNTGNTHYCKCPADYTGSYCESQFDH-----CEEKPCLNGATCRSYMGGF-TCDCMPGYEGNNCEREVNECQSHPCQN 1099          

HSP 5 Score: 96.2857 bits (238), Expect = 2.015e-19
Identity = 82/244 (33.61%), Postives = 105/244 (43.03%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ------FENPCLN--------------VNCE--------NGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKI 985
            C   PC N G C +  +  F C C  G++G  C+ N+N+C  +PC N GTC+D   S FTC C   + G  C         NPC N               NC+        NGG+C    N  F+C C  GF G  CA +   C  +P      C N G C  Y N +  C C PG+TG  C+    +P    C    CFNGG C    NG   C C+  FTG  C   + E   +  +N  I
Sbjct:  712 CLPSPCQNAGTCFDQLN-GFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVAS-FTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQDPCLNGGSCTDGVNS-FRCSCLPGFTGARCATELNECQSVP------CKNGGTCTDYVN-SYTCTCKPGFTGLLCETN--VP---DCTESSCFNGGTCTDGINGF-KCTCRTGFTGDYCQYEVNECDSQPCLNGGI 939          

HSP 6 Score: 88.1965 bits (217), Expect = 5.811e-17
Identity = 69/235 (29.36%), Postives = 118/235 (50.21%), Query Frame = 2
Query: 2243 DEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIK--MDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  YQ +SL       +  GE+ +H+AAR        + ++A   +  ++ D  GR+PL +++AADA +   Q+LI  +    +++                       +TALI A +L  + M+  L+   + VN +D  G+S +HW+A  NN   +E    +       D++D ++++PLFLAA EG+ ++VK LLA+F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1775 DLIYQGASLAA---QTDRTGETALHLAARYARADAAKRLLDAG--ADANAQDNTGRSPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MYDGSTALILAARLAVEGMVEELITCHADVNAVDEIGKSALHWAAAVNN---VEATIALLKNGANKDMQDLKEETPLFLAAREGSCEAVKVLLAHFANREITDHMDRL---PRDIAQERMHHDIVQLLDE 1978          

HSP 7 Score: 83.1889 bits (204), Expect = 2.098e-15
Identity = 64/214 (29.91%), Postives = 95/214 (44.39%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+  PC NG     ++  + CSC  G++G+ C  ++++C +   C NGG C++   S F C C + + G  C+    PC    C NGGTC    +  ++C C  GF G  C      CP         C N+G C    N T  C+C P +TG  C +      E   + + C NGG C     G   C C   +TG +C+  + +       N
Sbjct:  100 CATSPCANGARCTNWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGS-FRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCP------GHKCMNNGICVDGVN-TYNCQCPPEWTGQYCAEDVN---ECLMQPNACHNGGTCFNTIGGH-TCVCVNGWTGDDCSENIDDCATAVCFN 301          

HSP 8 Score: 77.0258 bits (188), Expect = 1.687e-13
Identity = 56/176 (31.82%), Postives = 81/176 (46.02%), Query Frame = 2
Query:  458 IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCES-LENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
               PC+NGG CID +     C C   +IG+LCQ  +PC    C N   C+S + N +  + C C+ GF G+ C++ + AC   P      C N        N    C C PGY G  C       ++   K   C NGG+C +  +GS  CEC   ++G+ C +P +       +N
Sbjct:   27 THRPCENGGMCIDSR-----CLCRPGYIGSLCQHLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSLVD-ACATSPCANGARCTNW-------NNHYNCSCPPGYQGKNCRND----IDECRKPGKCLNGGIC-MNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLN 184          

HSP 9 Score: 73.9442 bits (180), Expect = 1.299e-12
Identity = 63/210 (30.00%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  341 CSNRPCVNGKC----VEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C   PC+N       V    P++ C C  G++G+ C   V+ C  +PC NG  C +  N+ + C+C   + G  C+ + + C     C NGG C +  +G F+C+C  G+ G  C V     P  P +    C N G C    + T  C C PG+ G  C+   +      C    C N G+C V    +  C+C  E+TG+ C   + E
Sbjct:   59 CHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSL-VDACATSPCANGARCTN-WNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNT-HGSFRCECLTGYSGRTCEVPTQ--PCAPSQ----CLNGGTCHQTGDHTYECACLPGFRGHNCEDNVD-----DCPGHKCMNNGIC-VDGVNTYNCQCPPEWTGQYCAEDVNE 253          

HSP 10 Score: 70.0922 bits (170), Expect = 1.774e-11
Identity = 76/268 (28.36%), Postives = 106/268 (39.55%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLI-IKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKC 1150
            C+NG         FRC C  G+ G TCE     C  + C NGGTC    +  + C C   F G+ C+   + C    C N G C    N  + C+C   + G++CA     C + P      C+N G C +     T  C C  G+TGD C +  +      C +  CFNG  C      S  CEC    TG  C           L +  +    NE  +         ++C   C A F  G C+Q  +   C+     C+ + KC
Sbjct:  144 CLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVN-TYNCQCPPEWTGQYCAEDVNECLMQPNA----CHNGGTCFNTIGGHT--CVCVNGWTGDDCSENID-----DCATAVCFNGATCHDR-VASFFCECPVGKTGLLC----------HLDDACVSNPCNEGAVCDTNPLNGRAIC--TCPAGFVGGACNQ--DMDECSIGANPCEHFGKC 384          
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Match: notch3 (notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-5])

HSP 1 Score: 154.836 bits (390), Expect = 2.878e-37
Identity = 143/552 (25.91%), Postives = 224/552 (40.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVN-------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP--ICECKGEFTGKN-----------------CTIPLKETRKEALINIKIP------------KTFNEKQLIIKKTKSPSL---CDNL------------------------CKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDC---HKSSCKFHK--CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNV-------------------TEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARV 1714
            C  +PC+NG    ++   F C C  G++G  CE  VN+C  +PC+NGGTCID     + C+C    +G LC+  E+ C   +       C+N GTC     G ++C C  GF GE C      C   P       +N  +C   PN    C C PG+TG  C  +  +     C+S  C NGGVC +  +  P   C C+  + G N                 CT+  +  R   +     P            K  +   L  ++T  P     C N                         C +   +G+CD++CN+  C +DGGDC    +PW +C       C  +FN+  C+  CNN +CLFD  DC    K     ++  C++ Y + +CD+ CN+ +CG+DG DC          +              L +V++   +   + ++ FLQKLS+ LR  +  F +                    E+N       ++ L ++   C      CF + +  + +L A +    +L  P+ +  V
Sbjct: 1105 CEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDLV-GHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGG-YRCNCPPGFTGERCEGDINECLSNPCNP----SNSLDCIQLPN-DYQCVCKPGFTGRGCQSRFSV-----CESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMNCKELPCYNGGSCTLTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLPSPCPIADCFSKANDGVCDKECNSLDCRWDGGDCSLAVNPWARCAD---PRCWRLFNNSQCDEFCNNAECLFDNFDCINKEKVCNPIYEAYCTDHYADGLCDQGCNTEECGWDGLDCARKIPEDLAED-------------MLVIVVLLPPEELLRTQTAFLQKLSAILRTTLR-FRLDRNGDYMIRPYTGRETRIKRELNPQEVIGSIVYLEIDNRLCSQGSDDCFRNADSAAEYLGA-LSAREMLRFPYPIKEV 1626          

HSP 2 Score: 121.324 bits (303), Expect = 4.594e-27
Identity = 82/203 (40.39%), Postives = 106/203 (52.22%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENP-CLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            CS  PC+NG  C +  +  FRCSC  G+ G  C   +N+C   PCKNGGTC D  NS +TC C   F G LC+   P C   +C NGGTC    NG F+C CR GF G++C  +   C   P     +C +  E       +  C C  GYTG RC    + PV+    S+ C NGG C+  D  S  C+C G ++G+ C IP
Sbjct:  866 CSPNPCLNGGSCTDGVN-SFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNS-YTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGING-FKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAME-------SYRCSCPKGYTGPRC----QYPVDWCRPSNPCKNGGRCRQKD-ASFTCDCLGGWSGRYCDIP 1053          

HSP 3 Score: 106.686 bits (265), Expect = 1.314e-22
Identity = 78/218 (35.78%), Postives = 104/218 (47.71%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFD-PEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKI 985
            CS  PC N   CV   D   ++C+C  GW+G  C  ++N+C  NPCKN GTC +     + C+C + + G  C+ + N C    C NGG+C    N  F+C C  GF G  CA +   C  +P      C N G C  Y N +  C C PG+TG  C+    +P    C    CFNGG C    NG   C C+  FTG  C   + E   +  +N  I
Sbjct:  788 CSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGG-YVCSCRAGYTGPNCETDINDCSPNPCLNGGSCTDGVNS-FRCSCLPGFTGARCATELNECQSVP------CKNGGTCTDYVN-SYTCTCKPGFTGLLCETN--VP---DCTESSCFNGGTCTDGINGF-KCTCRTGFTGDYCQYEVNECDSQPCLNGGI 990          

HSP 4 Score: 106.301 bits (264), Expect = 1.971e-22
Identity = 77/208 (37.02%), Postives = 96/208 (46.15%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETR 958
            C++ PC N G C       + CSC  G+ G  CE ++NDC  NPC NGG+C D  NS F C+C   F G  C  E N C +V C+NGGTC    N  + C C+ GF G  C         +P      C N G C    N    C C  G+TGD C  +        C S  C NGG+C+     S  C C   +TG  C  P+   R
Sbjct:  828 CTSNPCKNRGTCTNTLG-GYVCSCRAGYTGPNCETDINDCSPNPCLNGGSCTDGVNS-FRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNS-YTCTCKPGFTGLLCETN------VPDCTESSCFNGGTCTDGIN-GFKCTCRTGFTGDYCQYEVNE-----CDSQPCLNGGICQDAME-SYRCSCPKGYTGPRCQYPVDWCR 1019          

HSP 5 Score: 101.293 bits (251), Expect = 5.686e-21
Identity = 74/202 (36.63%), Postives = 103/202 (50.99%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C + PC N   C++    EF C C  G++G+ CE ++++C  NPC N G C D  N  FTC C   F G +CQ + + C +  C+NG  C    NG ++C+C  GF G  C         I   K + C +HG C +    +  C C+PGYTG RC+ +        C S+ C NGG C  L N   IC+C+   +G NC I
Sbjct:  411 CLSMPCQNDATCLDRIG-EFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNG-FTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNG-YECRCAEGFEGRLCESN------IDNCKPDPC-HHGTC-VDGIASYTCNCEPGYTGYRCENQLNE-----CHSNPCQNGGKCVDLVNKY-ICQCQHGTSGTNCEI 595          

HSP 6 Score: 88.5817 bits (218), Expect = 4.845e-17
Identity = 69/235 (29.36%), Postives = 118/235 (50.21%), Query Frame = 2
Query: 2243 DEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIK--MDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  YQ +SL       +  GE+ +H+AAR        + ++A   +  ++ D  GR+PL +++AADA +   Q+LI  +    +++                       +TALI A +L  + M+  L+   + VN +D  G+S +HW+A  NN   +E    +       D++D ++++PLFLAA EG+ ++VK LLA+F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1826 DLIYQGASLAA---QTDRTGETALHLAARYARADAAKRLLDAG--ADANAQDNTGRSPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MYDGSTALILAARLAVEGMVEELITCHADVNAVDEIGKSALHWAAAVNN---VEATIALLKNGANKDMQDLKEETPLFLAAREGSCEAVKVLLAHFANREITDHMDRL---PRDIAQERMHHDIVQLLDE 2029          

HSP 7 Score: 84.7297 bits (208), Expect = 6.741e-16
Identity = 71/213 (33.33%), Postives = 91/213 (42.72%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTL---FCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRK 961
            C   PC N G C +  +  F C C  G++G  C+ N+N+C  +PC N GTC+D   S FTC C   + G  C +   PC    C N  +C    + + +QC C+ G+ G  C      C   P K R  C N          TL    C C  GYTG  C+          C  + C NGG C    N S  C C   FTG  C   L E + 
Sbjct:  712 CLPSPCQNAGTCFDQLN-GFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVAS-FTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECTSNPCKNRGTCTN----------TLGGYVCSCRAGYTGPNCETDIN-----DCSPNPCLNGGSCTDGVN-SFRCSCLPGFTGARCATELNECQS 906          

HSP 8 Score: 82.8037 bits (203), Expect = 2.622e-15
Identity = 64/214 (29.91%), Postives = 95/214 (44.39%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+  PC NG     ++  + CSC  G++G+ C  ++++C +   C NGG C++   S F C C + + G  C+    PC    C NGGTC    +  ++C C  GF G  C      CP         C N+G C    N T  C+C P +TG  C +      E   + + C NGG C     G   C C   +TG +C+  + +       N
Sbjct:  100 CATSPCANGARCTNWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGS-FRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCP------GHKCMNNGICVDGVN-TYNCQCPPEWTGQYCAEDVN---ECLMQPNACHNGGTCFNTIGGH-TCVCVNGWTGDDCSENIDDCATAVCFN 301          

HSP 9 Score: 79.337 bits (194), Expect = 2.783e-14
Identity = 71/213 (33.33%), Postives = 94/213 (44.13%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDC-IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVN-----------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C ++PC+NG   +     +RCSC  G+ G  C+  V+ C   NPCKNGG C  +K++ FTC+C   + G  C        V            C +GG C +  N  + CKC   + G +C  Q   C   P      C N   C  Y  M  F C C PGY G+ C+++        C+S  C NGG C  L  G  IC C     G  C I
Sbjct:  980 CDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRC-RQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHY-CKCPADYTGSYCESQFDHCEEKP------CLNGATCRSY--MGGFTCDCMPGYEGNNCEREVNE-----CQSHPCQNGGTCIDL-VGHYICSCPPGTLGVLCEI 1176          

HSP 10 Score: 76.6406 bits (187), Expect = 2.004e-13
Identity = 56/176 (31.82%), Postives = 81/176 (46.02%), Query Frame = 2
Query:  458 IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCES-LENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
               PC+NGG CID +     C C   +IG+LCQ  +PC    C N   C+S + N +  + C C+ GF G+ C++ + AC   P      C N        N    C C PGY G  C       ++   K   C NGG+C +  +GS  CEC   ++G+ C +P +       +N
Sbjct:   27 THRPCENGGMCIDSR-----CLCRPGYIGSLCQHLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSLVD-ACATSPCANGARCTNW-------NNHYNCSCPPGYQGKNCRND----IDECRKPGKCLNGGIC-MNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLN 184          

HSP 11 Score: 73.559 bits (179), Expect = 1.664e-12
Identity = 63/210 (30.00%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  341 CSNRPCVNGKC----VEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C   PC+N       V    P++ C C  G++G+ C   V+ C  +PC NG  C +  N+ + C+C   + G  C+ + + C     C NGG C +  +G F+C+C  G+ G  C V     P  P +    C N G C    + T  C C PG+ G  C+   +      C    C N G+C V    +  C+C  E+TG+ C   + E
Sbjct:   59 CHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSL-VDACATSPCANGARCTN-WNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNT-HGSFRCECLTGYSGRTCEVPTQ--PCAPSQ----CLNGGTCHQTGDHTYECACLPGFRGHNCEDNVD-----DCPGHKCMNNGIC-VDGVNTYNCQCPPEWTGQYCAEDVNE 253          

HSP 12 Score: 70.0922 bits (170), Expect = 2.197e-11
Identity = 76/268 (28.36%), Postives = 106/268 (39.55%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLI-IKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKC 1150
            C+NG         FRC C  G+ G TCE     C  + C NGGTC    +  + C C   F G+ C+   + C    C N G C    N  + C+C   + G++CA     C + P      C+N G C +     T  C C  G+TGD C +  +      C +  CFNG  C      S  CEC    TG  C           L +  +    NE  +         ++C   C A F  G C+Q  +   C+     C+ + KC
Sbjct:  144 CLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVN-TYNCQCPPEWTGQYCAEDVNECLMQPNA----CHNGGTCFNTIGGHT--CVCVNGWTGDDCSENID-----DCATAVCFNGATCHDR-VASFFCECPVGKTGLLC----------HLDDACVSNPCNEGAVCDTNPLNGRAIC--TCPAGFVGGACNQ--DMDECSIGANPCEHFGKC 384          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 166.777 bits (421), Expect = 7.553e-41
Identity = 156/546 (28.57%), Postives = 231/546 (42.31%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDC--------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC-KVLDNGSPICECKGEFTGKNCTIPL---------------KETRKEALINIKIPKTFN-------EKQLI------IKKTKSPSLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTM--QNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNF------ATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQEL--------PIYTM 1768
            C + PC NG  C++  +  ++CSC  G +G  CE NV+DC        ++  C N G CID+    + C C   F+G  C+ + N CL+  C+  GT  C  L N  ++C+CR GF G  C      C  +P      C N G C +  N      CKC PG+ G  C+          C +  C NGG C  VL   S  C C   +TG  C  P+               + + +E       P  FN       +   I      I    +  +C+N  C    +N IC+  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CNN  CL+DG DC K   + +      C + +Q+  CD+ CN+ +C +DG DC     N                L E  L+++  M  +        FL++LS  L   V     ++  +            ++ L ++  QC     QCF+S   ++ FL A    GN L++P+++  V ++  S     E+        P+Y M
Sbjct:  876 CLSHPCHNGGTCIDLIN-TYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGG-YNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVND-YRCECRQGFTGRRCDSVVDGCKGLP------CRNGGTCAVASNTERGFICKCPPGFDGATCEYDART-----CGNLRCQNGGTCISVLK--SSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYGFIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDCDNMPEN----------------LAEGTLLIVVLMPPEKLKNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEESIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGN-LNIPYKIEAVKSKSHSVPSAGEIVETAKPPPPLYAM 1386          

HSP 2 Score: 101.679 bits (252), Expect = 7.575e-21
Identity = 72/199 (36.18%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C NRPC NG   +  +  ++C+C  G+ G  CE +++DC  NPC NGG+C D  N  F CNC + F G  C+ + N C +  C+NG  C    N  + C C+ GF G  C          P      C N G C I    T  C+C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  562 CVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGIN-MFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNS-YTCTCQPGFSGIHCENN------TPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHDINE-----CDSKPCLNGGTCQD-SYGAYKCTCPQGYTGLNC 745          

HSP 3 Score: 95.9005 bits (237), Expect = 3.601e-19
Identity = 81/270 (30.00%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-IKIPKTFNEKQLIIKKTKSPSLCDN---LCKAS--FENGICDQQCNTFAC 1111
            V++  C + PC+NG   +     + C+C  G++   C+ N+N+C  NPC N GTCID   + + CNC   + G +C+    PC    C+NGG C ES +   F C+C  G+ G+ C +    C   P +   +C N        N +  C C PGY G  C+   +      C+ + C NGG C    N    C C   F G  C   + E       N        N      +   S   C+N    C  S  F  G C    NTF+C
Sbjct:  442 VNNNECESNPCMNGGTCKDMTGAYICTCRAGFR-PNCQTNINECASNPCLNRGTCIDDV-AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNT-------NGSYKCNCKPGYAGRHCETDID-----DCQPNPCHNGGSCSDGINMF-FCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSC 696          

HSP 4 Score: 90.5077 bits (223), Expect = 1.724e-17
Identity = 66/213 (30.99%), Postives = 96/213 (45.07%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC++G C +  +  ++C C  GW G  C+ N N+C  NPC NGGTC D   + + C C + F  N     N C +  C N GTC     G ++C C   + G  C      C   P      C N G C    +   F C+C PG+ G  C+          C +  C NG +C+   NGS  C CK  + G++C   + + +     N
Sbjct:  410 CNSNPCIHGTCHDGIN-GYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGA-YICTCRAGFRPNCQTNINECASNPCLNRGTCIDDVAG-YKCNCMLPYTGAICEAVLAPCSGSP------CKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNE-----CVNRPCRNGAMCQNT-NGSYKCNCKPGYAGRHCETDIDDCQPNPCHN 607          

HSP 5 Score: 77.0258 bits (188), Expect = 2.458e-13
Identity = 55/184 (29.89%), Postives = 93/184 (50.54%), Query Frame = 2
Query: 2396 DEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  GRTPL +++AADA +   Q+LI  +    +++                       TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL ++    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1576 DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MCDGTTPLILAARLAVEGMVEELINAHADVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANK---DMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMD---RLPRDIAQERMHHDIVHLLDE 1733          

HSP 6 Score: 76.6406 bits (187), Expect = 2.564e-13
Identity = 56/208 (26.92%), Postives = 87/208 (41.83%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C ++PC+NG   +     ++C+C  G+ G  C+  V  C  +PCKNGG C    N                                        ++C+C+ G+ G +C V +++C V  K++      LC N G C +    T FC+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E
Sbjct:  714 CDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNN---------------------------------------FYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMC-VDTGNTHFCRCQAGYTGSYCEEQVDE-----CSPNPCQNGATCTDYLGGY-SCECVAGYHGVNCSEEINE 875          

HSP 7 Score: 73.9442 bits (180), Expect = 1.712e-12
Identity = 84/296 (28.38%), Postives = 113/296 (38.18%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCT---------------------------SQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCD---NLCKAS--FENGICDQQCNTFACNYDGG 1126
            C + PC N   C++    EF+C C  G++G  CE N+++C  NPC + G C+DK N +F C C                            S F GNLCQ + + C +  C+NG  C    N  + C+C  GF G  C      C  IP         +G C      T  C C PGYTG  CD      +      + C NGG CK   NG   C C   +    C   + E      I+       N  +       S S CD   N C+++     G C      + C    G
Sbjct:  193 CLSNPCQNDATCLDQIG-EFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKIN-EFHCECPTGKGAARHPRPGAVFGYAQFQARCRHRSCFNGNLCQHDVDECASTPCKNGAKCLDGPNS-YTCQCTEGFTGRHCEQDINEC--IPDPCH-----YGTCKDGI-ATFTCLCRPGYTGRLCDND----INECLSHNPCRNGGTCKDKINGF-TCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAG 472          

HSP 8 Score: 71.633 bits (174), Expect = 9.415e-12
Identity = 78/267 (29.21%), Postives = 102/267 (38.20%), Query Frame = 2
Query:  215 HNFIKIIFNHQFQSELIMIFAKGFPMNVFILGCLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDN-GSPICECKGEFTGKNCTIPLKE-TRKEALINIKIPKTFNE 1003
            H  I II NH   S L                C   +   +L  N  C NG         + C C +GW GE C EN++DC    C +G TC D+  S F C C     G LC  +N C++  C  G  C++   NG   C C  G+ G  C      C +        C + G C      +  C C  GY G RC+      +++  C S+ C N   C  LD  G   C C   + G  C   + E      L N K     NE
Sbjct:   10 HYIIYIILNHPQPSPLGQY-------------CTEDVDECQLMPNA-CQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVAS-FFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSL----GANPCEHGGRCTNTLG-SFQCNCPQGYAGPRCE------IDVNECLSNPCQNDATC--LDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINE 248          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 166.007 bits (419), Expect = 1.560e-40
Identity = 159/551 (28.86%), Postives = 233/551 (42.29%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDC--------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC-KVLDNGSPICECKGEFTGKNCTIPL---------------KETRKEALINIKIPKTFN-------EKQLI------IKKTKSPSLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTM--QNFTKYKSEFLQKLSSSLRMVVTVF-------------------NVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTM 1768
            C + PC NG  C++  +  ++CSC  G +G  CE NV+DC        ++  C N G CID+    + C C   F+G  C+ + N CL+  C+  GT  C  L N  ++C+CR GF G  C      C  +P      C N G C +  N      CKC PG+ G  C+          C +  C NGG C  VL   S  C C   +TG  C  P+               + + +E       P  FN       +   I      I    +  +C+N  C    +N IC+  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CNN  CL+DG DC K   + +      C + +Q+  CD+ CN+ +C +DG DC     N                L E  L+++  M  +        FL++LS  L   V VF                      E++       ++ L ++  QC     QCF+S   ++ FL A    GN L++P+++  V + I+  +K    P+Y M
Sbjct: 1113 CLSHPCHNGGTCIDLIN-TYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGG-YNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVND-YRCECRQGFTGRRCDSVVDGCKGLP------CRNGGTCAVASNTERGFICKCPPGFDGATCEYDART-----CGNLRCQNGGTCISVLK--SSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYGFIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDCDNMPEN----------------LAEGTLLIVVLMPPEKLKNNSVNFLRELSRVLHTNV-VFKKDSKGEYKIYPYYGNEEERRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGN-LNIPYKIEAVKSEIVETAKPPP-PLYAM 1626          

HSP 2 Score: 100.138 bits (248), Expect = 1.842e-20
Identity = 72/199 (36.18%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C NRPC NG   +  +  ++C+C  G+ G  CE +++DC  NPC NGG+C D  N  F CNC + F G  C+ + N C +  C+NG  C    N  + C C+ GF G  C          P      C N G C I    T  C+C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  797 CVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGIN-MFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNS-YTCTCQPGFSGIHCENN------TPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHDINE-----CDSKPCLNGGTCQD-SYGAYKCTCPQGYTGLNC 980          

HSP 3 Score: 94.7449 bits (234), Expect = 8.808e-19
Identity = 81/270 (30.00%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-IKIPKTFNEKQLIIKKTKSPSLCDN---LCKAS--FENGICDQQCNTFAC 1111
            V++  C + PC+NG   +     + C+C  G++   C+ N+N+C  NPC N GTCID   + + CNC   + G +C+    PC    C+NGG C ES +   F C+C  G+ G+ C +    C   P +   +C N        N +  C C PGY G  C+   +      C+ + C NGG C    N    C C   F G  C   + E       N        N      +   S   C+N    C  S  F  G C    NTF+C
Sbjct:  677 VNNNECESNPCMNGGTCKDMTGAYICTCRAGFR-PNCQTNINECASNPCLNRGTCIDDV-AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNT-------NGSYKCNCKPGYAGRHCETDID-----DCQPNPCHNGGSCSDGINMF-FCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSC 931          

HSP 4 Score: 82.8037 bits (203), Expect = 4.045e-15
Identity = 71/211 (33.65%), Postives = 97/211 (45.97%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            C++ PC  GKC++  D  + C+C  G+ G+ C  N+++C  NPC+NGGTC DK N  FTC C   +  ++C  E      NPC++      GTC    NG ++C C  G+ G  C V N  C   P      C N G C    +MT    C C  G+       +      I  C S+ C N G C + D     C C   +TG  C   L
Sbjct:  570 CASNPCDYGKCIDKID-GYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKING-FTCVCPDGYHDHMCLSEVNECNSNPCIH------GTCHDGING-YKCDCDAGWSGSNCDVNNNECESNP------CMNGGTCK---DMTGAYICTCRAGF-------RPNCQTNINECASNPCLNRGTC-IDDVAGYKCNCMLPYTGAICEAVL 754          

HSP 5 Score: 82.4185 bits (202), Expect = 5.669e-15
Identity = 71/236 (30.08%), Postives = 106/236 (44.92%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCK----------CRYGFI--GEFCAVQNIACPV--------------IPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEA 967
            C++ PC NG     F+ ++ C C  G+ G TC++++N+C QNPC+NGG C+++  S + CNC ++F G  C+    PC    C NGGTC   ++  ++C           C + FI  G  C      C V              I       C N G C    N T  C+C P +TG  C +  +   E     + C NGG C     G   C C   +TG++C+  + +    A
Sbjct:   77 CASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGS-YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTSYCVPRTFLLCIFVFIHMGGRCHSTLPTCLVLFPTGFSGQNCEENIDDCPSNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVD---ECQLMPNACQNGGTCHNTYGGY-NCVCVNGWTGEDCSENIDDCANAA 306          

HSP 6 Score: 79.337 bits (194), Expect = 4.442e-14
Identity = 104/369 (28.18%), Postives = 146/369 (39.57%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDC--IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYP-NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCK------FHKCSELYQNKICD---EECNSPQCGFDGGDCHTSRSNSFFSN--EGLTKCSTQTKL 1423
            G CV+  +  + C C   W G+ C E+V++C  + N C+NGGTC +     + C C + + G  C    + C N  C +G TC       F C+C +G  G  C + N AC   P      CN    CD  P N    C C PGYTG  C+   +   E    ++ C +GG C     GS  C C   + G  C I + E       N         E Q I      P    NLC+   +       C   A   DG +    +   G   +HC+   N+ + +P             CH  +CK         C   Y  ++CD    EC S  C  +GG C T R N +     +G T  + +T L
Sbjct:  233 GTCVDGVN-TYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGG-YNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFF-CECPHGRTGLLCHLDN-ACISNP------CNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVD---ECSLGANPCEHGGRCTNTL-GSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICM----PGFNGNLCQHDVDE-CASTPCKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDP-------------CHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQ-NGGQC-TDRENGYICTCPKGTTGVNCETNL 567          

HSP 7 Score: 79.337 bits (194), Expect = 4.634e-14
Identity = 85/306 (27.78%), Postives = 116/306 (37.91%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE--------------------------------------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCD---NLCKAS--FENGICDQQCNTFACNYDGG 1126
            C + PC N   C++    EF+C C  G+ G  C+ +V++C   PCKNG  C+D  NS +TC CT  F G  C+ +                                      N CL+  C+NGG C   ENG + C C  G  G  C      C   P        ++G+C I       C C+PGYTG  C+   +      C S+ C NGG CK   NG   C C   +    C   + E      I+       N  +       S S CD   N C+++     G C      + C    G
Sbjct:  419 CLSNPCQNDATCLDQIG-EFQCICMPGFNGNLCQHDVDECASTPCKNGAKCLDGPNS-YTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENG-YICTCPKGTTGVNCETNLDDCASNPC-------DYGKC-IDKIDGYECTCEPGYTGKMCNINIDE-----CASNPCRNGGTCKDKINGF-TCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAG 707          

HSP 8 Score: 77.0258 bits (188), Expect = 2.225e-13
Identity = 55/184 (29.89%), Postives = 93/184 (50.54%), Query Frame = 2
Query: 2396 DEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  GRTPL +++AADA +   Q+LI  +    +++                       TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL ++    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1829 DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MCDGTTPLILAARLAVEGMVEELINAHADVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANK---DMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMD---RLPRDIAQERMHHDIVHLLDE 1986          

HSP 9 Score: 75.0998 bits (183), Expect = 7.690e-13
Identity = 56/169 (33.14%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  392 EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGS 892
            +F C C  G+  + C   V N C+ NPC+NGGTC +    S + C C   + G+ CQ  +PC +  C NGG C   E   + CKC  GF G  C      C   P      C N G+C +    +  C C   +TG  C++       + C    C NGG C+  D+ S
Sbjct:   16 DFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNP------CRNGGQC-LNEFGSYRCNCQNRFTGRNCEEPY-----VPCNPSPCLNGGTCRQTDDTS 171          

HSP 10 Score: 74.7146 bits (182), Expect = 1.007e-12
Identity = 56/210 (26.67%), Postives = 87/210 (41.43%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK------RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C ++PC+NG   +     ++C+C  G+ G  C+  V  C  +PCKNGG C    N                                        ++C+C+ G+ G +C V +++C V  K++        LC N G C +    T FC+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E
Sbjct:  949 CDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNN---------------------------------------FYRCECKSGWTGVYCDVPSVSCEVAAKQQGKGVDIAHLCRNSGMC-VDTGNTHFCRCQAGYTGSYCEEQVDE-----CSPNPCQNGATCTDYLGGY-SCECVAGYHGVNCSEEINE 1112          

HSP 11 Score: 72.4034 bits (176), Expect = 6.175e-12
Identity = 103/380 (27.11%), Postives = 144/380 (37.89%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYC---------------FNGGVC----------------KVLDN-GSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICD---QQCNTFACNYDGGDCDPWRKCY------GNDLKHCKGVFNDGVCNPECNNVDCL--FDGEDCHKSSCKFHKCSELYQNKICD---EECNSPQCGFDGGDC 1354
            C NG         + C C +GW GE C EN++DC    C +G TC D+  S F C C     G LC  +N C++  C  G  C++   NG   C C  G+ G  C      C +        C + G C      +  C C  GY G RC+      +   C++D                 FNG +C                K LD   S  C+C   FTG++C         E  IN  IP   +      K   +   C  LC+  +   +CD    +C +  C  +GG C      Y      G    +C+   +D   NP C+   C+   DG +C         C   Y  K+C+   +EC S  C  +GG C
Sbjct:  269 CQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVAS-FFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSL----GANPCEHGGRCTNTLG-SFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCTEGFTGRHC---------EQDINECIPDPCHYG--TCKDGIATFTC--LCRPGYTGRLCDNDINECLSQPCQ-NGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNP-CDYGKCIDKIDGYEC--------TCEPGYTGKMCNINIDECASNPC-RNGGTC 618          

HSP 12 Score: 63.5438 bits (153), Expect = 2.744e-9
Identity = 52/158 (32.91%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  512 FTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            FTC+C   F   +C    +N C+N  C NGGTCE L +   ++C+C  G+ G+ C  Q   C   P      C N G+C  +      CKC  G+ G  C +         C  + C NGG C + + GS  C C+  FTG+NC  P         +N
Sbjct:   17 FTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQ-QADPCASNP------CANGGKCLPF-ETQYICKCPSGFHGATCKQDINE-----CSQNPCRNGGQC-LNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLN 160          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 160.614 bits (405), Expect = 6.779e-39
Identity = 161/568 (28.35%), Postives = 239/568 (42.08%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDC--------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC-KVLDNGSPICECKGEFTGKNCTIPL---------------KETRKEALINIKIPKTFN-------EKQLI------IKKTKSPSLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSN---------SFFSNEGLTKCSTQTKLYELDLVLMTTM----------------QNFTKYKSEFLQKLSSS--LRMVVTVFNVT-----------EINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTM 1768
            C + PC NG  C++  +  ++CSC  G +G  CE NV+DC        ++  C N G CID+    + C C   F+G  C+ + N CL+  C+  GT  C  L N  ++C+CR GF G  C      C  +P      C N G C +  N      CKC PG+ G  C+          C +  C NGG C  VL   S  C C   +TG  C  P+               + + +E       P  FN       +   I      I    +  +C+N  C    +N IC+  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CNN  CL+DG DC K   + +      C + +Q+  CD+ CN+ +C +DG DC     N              E L K ++   L EL  VL T +                 N  + K   ++K S++        +F+             E++       ++ L ++  QC     QCF+S   ++ FL A    GN L++P+++  V + I+  +K    P+Y M
Sbjct: 1110 CLSHPCHNGGTCIDLIN-TYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGG-YNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVND-YRCECRQGFTGRRCDSVVDGCKGLP------CRNGGTCAVASNTERGFICKCPPGFDGATCEYDART-----CGNLRCQNGGTCISVLK--SSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYGFIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDCDNMPENLAEGTLLIVVLMPPEKL-KNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGN-LNIPYKIEAVKSEIVETAKPPP-PLYAM 1656          

HSP 2 Score: 102.834 bits (255), Expect = 3.248e-21
Identity = 82/271 (30.26%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN---------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +N+F   C       K       C++ PC NG  C +  +  + C+C  G+ G  CE N  DC ++ C NGGTCID  N+ F+C C   F GN CQ +       PCLN                                   C+NGG C    N  ++C+C+ G+ G +C V +++C V  K++      LC N G C +    T FC+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E
Sbjct:  849 INMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN-SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINT-FSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNN-FYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMC-VDTGNTHFCRCQAGYTGSYCEEQVDE-----CSPNPCQNGATCTDYLGGY-SCECVAGYHGVNCSEEINE 1109          

HSP 3 Score: 100.523 bits (249), Expect = 1.485e-20
Identity = 69/200 (34.50%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            C++ PC NG     F+ ++ C C  G+ G TC++++N+C QNPC+NGG C+++  S + CNC ++F G  C+    PC    C NGGTC   ++  ++C C  GF G+ C      CP         C N G C    N T  C+C P +TG  C +  +   E     + C NGG C     G   C C   +TG++C+
Sbjct:  145 CASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGS-YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCP------SNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVD---ECQLMPNACQNGGTCHNTYGGY-NCVCVNGWTGEDCS 332          

HSP 4 Score: 100.523 bits (249), Expect = 1.549e-20
Identity = 82/270 (30.37%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-IKIPKTFNEKQLIIKKTKSPSLCDN---LCKAS--FENGICDQQCNTFAC 1111
            V++  C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G +C+    PC    C+NGG C ES +   F C+C  G+ G+ C +    C   P +   +C N        N +  C C PGY G  C+   +      C+ + C NGG C    N    C C   F G  C   + E       N        N      +   S   C+N    C  S  F  G C    NTF+C
Sbjct:  675 VNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV-AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNT-------NGSYKCNCKPGYAGRHCETDID-----DCQPNPCHNGGSCSDGINMF-FCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSC 930          

HSP 5 Score: 100.138 bits (248), Expect = 1.914e-20
Identity = 72/199 (36.18%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C NRPC NG   +  +  ++C+C  G+ G  CE +++DC  NPC NGG+C D  N  F CNC + F G  C+ + N C +  C+NG  C    N  + C C+ GF G  C          P      C N G C I    T  C+C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  796 CVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGIN-MFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNS-YTCTCQPGFSGIHCENN------TPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHDINE-----CDSKPCLNGGTCQD-SYGAYKCTCPQGYTGLNC 979          

HSP 6 Score: 92.8189 bits (229), Expect = 3.386e-18
Identity = 72/216 (33.33%), Postives = 99/216 (45.83%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C ++PC NG      +  + C+C  G  G  CE N++DC  NPC + G CIDK +  + C C   + G +C    + C +  C NGGTC+   NG F C C  G+    C  +   C   P I          HG C    N    C CD G++G  CD          C+S+ C NGG CK +  G+ IC C+  F+G NC   + E      +N
Sbjct:  530 CLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPC-DYGKCIDKIDG-YECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKING-FTCVCPDGYHDHMCLSEVNECNSNPCI----------HGTCHDGIN-GYKCDCDAGWSGSNCDVNNNE-----CESNPCMNGGTCKDM-TGAYICTCRAGFSGPNCQTNINECASNPCLN 725          

HSP 7 Score: 88.9669 bits (219), Expect = 4.918e-17
Identity = 72/210 (34.29%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            C++ PC  GKC++  D  + C+C  G+ G+ C  N+++C  NPC+NGGTC DK N  FTC C   +  ++C  E      NPC++      GTC    NG ++C C  G+ G  C V N  C   P      C N G C    +MT    C C  G++G  C           C S+ C N G C + D     C C   +TG  C   L
Sbjct:  568 CASNPCDYGKCIDKID-GYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKING-FTCVCPDGYHDHMCLSEVNECNSNPCIH------GTCHDGING-YKCDCDAGWSGSNCDVNNNECESNP------CMNGGTCK---DMTGAYICTCRAGFSGPNCQTNINE-----CASNPCLNRGTC-IDDVAGYKCNCMLPYTGAICEAVL 753          

HSP 8 Score: 85.5001 bits (210), Expect = 6.451e-16
Identity = 62/183 (33.88%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  392 EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            +F C C  G+  + C   V N C+ NPC+NGGTC +    S + C C   + G+ CQ  +PC +  C NGG C   E   + CKC  GF G  C      C   P      C N G+C +    +  C C   +TG  C++       + C    C NGG C+  D+ S  C C   F+G+NC
Sbjct:   84 DFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNP------CRNGGQC-LNEFGSYRCNCQNRFTGRNCEEPY-----VPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNC 253          

HSP 9 Score: 77.0258 bits (188), Expect = 2.491e-13
Identity = 55/184 (29.89%), Postives = 93/184 (50.54%), Query Frame = 2
Query: 2396 DEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  GRTPL +++AADA +   Q+LI  +    +++                       TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL ++    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1880 DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MCDGTTPLILAARLAVEGMVEELINAHADVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANK---DMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMD---RLPRDIAQERMHHDIVHLLDE 2037          

HSP 10 Score: 75.8702 bits (185), Expect = 5.367e-13
Identity = 58/174 (33.33%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPC-LNVNCENGGTCES--LENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NGG C         C C+S + G  CQ+ NPC L   C N GTCE   L N + F C C  GF  + C       PV        C N G C++  +++ + C+C PG+TGD C +         C S+ C NGG C   +    IC+C   F G  C   + E  +    N
Sbjct:   29 CLNGGRCEMTPGGTGVCLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLT-----PVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADP------CASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNPCRN 190          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 160.229 bits (404), Expect = 9.236e-39
Identity = 161/568 (28.35%), Postives = 239/568 (42.08%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDC--------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC-KVLDNGSPICECKGEFTGKNCTIPL---------------KETRKEALINIKIPKTFN-------EKQLI------IKKTKSPSLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSN---------SFFSNEGLTKCSTQTKLYELDLVLMTTM----------------QNFTKYKSEFLQKLSSS--LRMVVTVFNVT-----------EINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTM 1768
            C + PC NG  C++  +  ++CSC  G +G  CE NV+DC        ++  C N G CID+    + C C   F+G  C+ + N CL+  C+  GT  C  L N  ++C+CR GF G  C      C  +P      C N G C +  N      CKC PG+ G  C+          C +  C NGG C  VL   S  C C   +TG  C  P+               + + +E       P  FN       +   I      I    +  +C+N  C    +N IC+  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CNN  CL+DG DC K   + +      C + +Q+  CD+ CN+ +C +DG DC     N              E L K ++   L EL  VL T +                 N  + K   ++K S++        +F+             E++       ++ L ++  QC     QCF+S   ++ FL A    GN L++P+++  V + I+  +K    P+Y M
Sbjct: 1186 CLSHPCHNGGTCIDLIN-TYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGG-YNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVND-YRCECRQGFTGRRCDSVVDGCKGLP------CRNGGTCAVASNTERGFICKCPPGFDGATCEYDART-----CGNLRCQNGGTCISVLK--SSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYGFIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDCDNMPENLAEGTLLIVVLMPPEKL-KNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGN-LNIPYKIEAVKSEIVETAKPPP-PLYAM 1732          

HSP 2 Score: 102.449 bits (254), Expect = 3.806e-21
Identity = 82/271 (30.26%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN---------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +N+F   C       K       C++ PC NG  C +  +  + C+C  G+ G  CE N  DC ++ C NGGTCID  N+ F+C C   F GN CQ +       PCLN                                   C+NGG C    N  ++C+C+ G+ G +C V +++C V  K++      LC N G C +    T FC+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E
Sbjct:  925 INMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN-SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINT-FSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNN-FYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMC-VDTGNTHFCRCQAGYTGSYCEEQVDE-----CSPNPCQNGATCTDYLGGY-SCECVAGYHGVNCSEEINE 1185          

HSP 3 Score: 100.138 bits (248), Expect = 1.862e-20
Identity = 69/200 (34.50%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            C++ PC NG     F+ ++ C C  G+ G TC++++N+C QNPC+NGG C+++  S + CNC ++F G  C+    PC    C NGGTC   ++  ++C C  GF G+ C      CP         C N G C    N T  C+C P +TG  C +  +   E     + C NGG C     G   C C   +TG++C+
Sbjct:  145 CASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGS-YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCP------SNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVD---ECQLMPNACQNGGTCHNTYGGY-NCVCVNGWTGEDCS 332          

HSP 4 Score: 100.138 bits (248), Expect = 1.862e-20
Identity = 82/270 (30.37%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-IKIPKTFNEKQLIIKKTKSPSLCDN---LCKAS--FENGICDQQCNTFAC 1111
            V++  C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G +C+    PC    C+NGG C ES +   F C+C  G+ G+ C +    C   P +   +C N        N +  C C PGY G  C+   +      C+ + C NGG C    N    C C   F G  C   + E       N        N      +   S   C+N    C  S  F  G C    NTF+C
Sbjct:  751 VNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV-AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNT-------NGSYKCNCKPGYAGRHCETDID-----DCQPNPCHNGGSCSDGINMF-FCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSC 1006          

HSP 5 Score: 100.138 bits (248), Expect = 2.339e-20
Identity = 72/199 (36.18%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C NRPC NG   +  +  ++C+C  G+ G  CE +++DC  NPC NGG+C D  N  F CNC + F G  C+ + N C +  C+NG  C    N  + C C+ GF G  C          P      C N G C I    T  C+C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  872 CVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGIN-MFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNS-YTCTCQPGFSGIHCENN------TPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHDINE-----CDSKPCLNGGTCQD-SYGAYKCTCPQGYTGLNC 1055          

HSP 6 Score: 94.7449 bits (234), Expect = 1.010e-18
Identity = 76/206 (36.89%), Postives = 98/206 (47.57%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C + PC N   C++    EF+C C  G++G  CE N+++C  NPC + G C+DK N +F C C + F GNLCQ + + C +  C+NG  C    N  + C+C  GF G  C      C  IP         +G C      T  C C PGYTG  CD          C S  C NGG C   +NG  IC C    TG NC   L +
Sbjct:  455 CLSNPCQNDATCLDQIG-EFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKIN-EFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNS-YTCQCTEGFTGRHCEQDINEC--IPDPCH-----YGTCKDGI-ATFTCLCRPGYTGRLCDNDINE-----CLSQPCQNGGQCTDRENGY-ICTCPKGTTGVNCETNLDD 643          

HSP 7 Score: 88.9669 bits (219), Expect = 5.335e-17
Identity = 72/210 (34.29%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            C++ PC  GKC++  D  + C+C  G+ G+ C  N+++C  NPC+NGGTC DK N  FTC C   +  ++C  E      NPC++      GTC    NG ++C C  G+ G  C V N  C   P      C N G C    +MT    C C  G++G  C           C S+ C N G C + D     C C   +TG  C   L
Sbjct:  644 CASNPCDYGKCIDKID-GYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKING-FTCVCPDGYHDHMCLSEVNECNSNPCIH------GTCHDGING-YKCDCDAGWSGSNCDVNNNECESNP------CMNGGTCK---DMTGAYICTCRAGFSGPNCQTNINE-----CASNPCLNRGTC-IDDVAGYKCNCMLPYTGAICEAVL 829          

HSP 8 Score: 85.1149 bits (209), Expect = 8.008e-16
Identity = 62/183 (33.88%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  392 EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            +F C C  G+  + C   V N C+ NPC+NGGTC +    S + C C   + G+ CQ  +PC +  C NGG C   E   + CKC  GF G  C      C   P      C N G+C +    +  C C   +TG  C++       + C    C NGG C+  D+ S  C C   F+G+NC
Sbjct:   84 DFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNP------CRNGGQC-LNEFGSYRCNCQNRFTGRNCEEPY-----VPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNC 253          

HSP 9 Score: 77.0258 bits (188), Expect = 2.399e-13
Identity = 55/184 (29.89%), Postives = 93/184 (50.54%), Query Frame = 2
Query: 2396 DEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  GRTPL +++AADA +   Q+LI  +    +++                       TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL ++    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1956 DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MCDGTTPLILAARLAVEGMVEELINAHADVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANK---DMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMD---RLPRDIAQERMHHDIVHLLDE 2113          

HSP 10 Score: 75.485 bits (184), Expect = 6.275e-13
Identity = 58/174 (33.33%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPC-LNVNCENGGTCES--LENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NGG C         C C+S + G  CQ+ NPC L   C N GTCE   L N + F C C  GF  + C       PV        C N G C++  +++ + C+C PG+TGD C +         C S+ C NGG C   +    IC+C   F G  C   + E  +    N
Sbjct:   29 CLNGGRCEMTPGGTGVCLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLT-----PVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADP------CASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNPCRN 190          
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 159.844 bits (403), Expect = 1.125e-38
Identity = 161/568 (28.35%), Postives = 239/568 (42.08%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDC--------IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC-KVLDNGSPICECKGEFTGKNCTIPL---------------KETRKEALINIKIPKTFN-------EKQLI------IKKTKSPSLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSN---------SFFSNEGLTKCSTQTKLYELDLVLMTTM----------------QNFTKYKSEFLQKLSSS--LRMVVTVFNVT-----------EINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTM 1768
            C + PC NG  C++  +  ++CSC  G +G  CE NV+DC        ++  C N G CID+    + C C   F+G  C+ + N CL+  C+  GT  C  L N  ++C+CR GF G  C      C  +P      C N G C +  N      CKC PG+ G  C+          C +  C NGG C  VL   S  C C   +TG  C  P+               + + +E       P  FN       +   I      I    +  +C+N  C    +N IC+  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CNN  CL+DG DC K   + +      C + +Q+  CD+ CN+ +C +DG DC     N              E L K ++   L EL  VL T +                 N  + K   ++K S++        +F+             E++       ++ L ++  QC     QCF+S   ++ FL A    GN L++P+++  V + I+  +K    P+Y M
Sbjct: 1199 CLSHPCHNGGTCIDLIN-TYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGG-YNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVND-YRCECRQGFTGRRCDSVVDGCKGLP------CRNGGTCAVASNTERGFICKCPPGFDGATCEYDART-----CGNLRCQNGGTCISVLK--SSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYGFIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDCDNMPENLAEGTLLIVVLMPPEKL-KNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGN-LNIPYKIEAVKSEIVETAKPPP-PLYAM 1745          

HSP 2 Score: 102.449 bits (254), Expect = 3.975e-21
Identity = 82/271 (30.26%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN---------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +N+F   C       K       C++ PC NG  C +  +  + C+C  G+ G  CE N  DC ++ C NGGTCID  N+ F+C C   F GN CQ +       PCLN                                   C+NGG C    N  ++C+C+ G+ G +C V +++C V  K++      LC N G C +    T FC+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E
Sbjct:  938 INMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN-SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINT-FSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNN-FYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMC-VDTGNTHFCRCQAGYTGSYCEEQVDE-----CSPNPCQNGATCTDYLGGY-SCECVAGYHGVNCSEEINE 1198          

HSP 3 Score: 100.138 bits (248), Expect = 1.944e-20
Identity = 69/200 (34.50%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            C++ PC NG     F+ ++ C C  G+ G TC++++N+C QNPC+NGG C+++  S + CNC ++F G  C+    PC    C NGGTC   ++  ++C C  GF G+ C      CP         C N G C    N T  C+C P +TG  C +  +   E     + C NGG C     G   C C   +TG++C+
Sbjct:  158 CASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGS-YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCP------SNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVD---ECQLMPNACQNGGTCHNTYGGY-NCVCVNGWTGEDCS 345          

HSP 4 Score: 100.138 bits (248), Expect = 2.098e-20
Identity = 82/270 (30.37%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-IKIPKTFNEKQLIIKKTKSPSLCDN---LCKAS--FENGICDQQCNTFAC 1111
            V++  C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G +C+    PC    C+NGG C ES +   F C+C  G+ G+ C +    C   P +   +C N        N +  C C PGY G  C+   +      C+ + C NGG C    N    C C   F G  C   + E       N        N      +   S   C+N    C  S  F  G C    NTF+C
Sbjct:  764 VNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV-AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNT-------NGSYKCNCKPGYAGRHCETDID-----DCQPNPCHNGGSCSDGINMF-FCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSC 1019          

HSP 5 Score: 99.7525 bits (247), Expect = 2.548e-20
Identity = 72/199 (36.18%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C NRPC NG   +  +  ++C+C  G+ G  CE +++DC  NPC NGG+C D  N  F CNC + F G  C+ + N C +  C+NG  C    N  + C C+ GF G  C          P      C N G C I    T  C+C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  885 CVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGIN-MFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNS-YTCTCQPGFSGIHCENN------TPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHDINE-----CDSKPCLNGGTCQD-SYGAYKCTCPQGYTGLNC 1068          

HSP 6 Score: 94.3597 bits (233), Expect = 1.073e-18
Identity = 76/206 (36.89%), Postives = 98/206 (47.57%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C + PC N   C++    EF+C C  G++G  CE N+++C  NPC + G C+DK N +F C C + F GNLCQ + + C +  C+NG  C    N  + C+C  GF G  C      C  IP         +G C      T  C C PGYTG  CD          C S  C NGG C   +NG  IC C    TG NC   L +
Sbjct:  468 CLSNPCQNDATCLDQIG-EFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKIN-EFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNS-YTCQCTEGFTGRHCEQDINEC--IPDPCH-----YGTCKDGI-ATFTCLCRPGYTGRLCDNDINE-----CLSQPCQNGGQCTDRENGY-ICTCPKGTTGVNCETNLDD 656          

HSP 7 Score: 88.5817 bits (218), Expect = 6.484e-17
Identity = 72/210 (34.29%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            C++ PC  GKC++  D  + C+C  G+ G+ C  N+++C  NPC+NGGTC DK N  FTC C   +  ++C  E      NPC++      GTC    NG ++C C  G+ G  C V N  C   P      C N G C    +MT    C C  G++G  C           C S+ C N G C + D     C C   +TG  C   L
Sbjct:  657 CASNPCDYGKCIDKID-GYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKING-FTCVCPDGYHDHMCLSEVNECNSNPCIH------GTCHDGING-YKCDCDAGWSGSNCDVNNNECESNP------CMNGGTCK---DMTGAYICTCRAGFSGPNCQTNINE-----CASNPCLNRGTC-IDDVAGYKCNCMLPYTGAICEAVL 842          

HSP 8 Score: 85.1149 bits (209), Expect = 8.360e-16
Identity = 62/183 (33.88%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  392 EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            +F C C  G+  + C   V N C+ NPC+NGGTC +    S + C C   + G+ CQ  +PC +  C NGG C   E   + CKC  GF G  C      C   P      C N G+C +    +  C C   +TG  C++       + C    C NGG C+  D+ S  C C   F+G+NC
Sbjct:   97 DFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNP------CRNGGQC-LNEFGSYRCNCQNRFTGRNCEEPY-----VPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNC 266          

HSP 9 Score: 77.0258 bits (188), Expect = 2.463e-13
Identity = 55/184 (29.89%), Postives = 93/184 (50.54%), Query Frame = 2
Query: 2396 DEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  GRTPL +++AADA +   Q+LI  +    +++                       TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL ++    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1969 DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDAR-------------------MCDGTTPLILAARLAVEGMVEELINAHADVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANK---DMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMD---RLPRDIAQERMHHDIVHLLDE 2126          

HSP 10 Score: 75.485 bits (184), Expect = 6.333e-13
Identity = 58/174 (33.33%), Postives = 77/174 (44.25%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPC-LNVNCENGGTCES--LENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NGG C         C C+S + G  CQ+ NPC L   C N GTCE   L N + F C C  GF  + C       PV        C N G C++  +++ + C+C PG+TGD C +         C S+ C NGG C   +    IC+C   F G  C   + E  +    N
Sbjct:   42 CLNGGRCEMTPGGTGVCLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLT-----PVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADP------CASNPCANGGKCLPFET-QYICKCPSGFHGATCKQDINECSQNPCRN 203          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Notch1 (notch 1 [Source:MGI Symbol;Acc:MGI:97363])

HSP 1 Score: 197.208 bits (500), Expect = 2.835e-50
Identity = 237/1013 (23.40%), Postives = 383/1013 (37.81%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL----------------KETRKEALINIKIPKTFNEKQLII----------KKTKSPSLCDNL----CKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS---------------------RSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQ----------KLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVN--ENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGR----------------------TPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            CS  PC NG     +   F C C  G+ G  C E +N+C+  PC+NGGTCID  NS                                              +TC C   F+G  C+ + N CL+  C+  GT   ++    F C+CR G  G  C        VI   + + C N G C +  N      C+C  G+ G  C+          C S  C NGG C +    SP C C G FTG  C  P                 + T +        P  FN     I          +    P + +      C+    N +C+ QCN  AC +DGGDC     DPW+ C       C   F+DG C+ +CN+  CLFDG DC  +  + +      C + + +  CD+ CNS +C +DG DC                        R+NSF     L+       +++ D      +  +  ++ E  +            SS L          E++       ++ L ++  QCV    QCF S   ++ FL A    G+ L++P+++  V +  +      +L +  +   A      +     GVLL  K  +   ++     +  S              + G   L    D        N+  +G+   +T + R       PD     ++R+   + ++      A  L   ++  T     +DA   DV    +V+    +      S   G  E  N  E  ++   I+  +  GA++  Q +    + LH    + R                      TPL ++++ADA +   Q+L+  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1149 CSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCES------VINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDART-----CGSLRCLNGGTC-ISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGS-LNIPYKIEAVKSEPVEPPLPSQLHLMYV---AAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD--GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLSDQTDHRQWTQQHLD------AADLRMSAMAPTPPQGEVDADCMDV----NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADA-QGVFQILLRNRATDLDARMH-------------------DGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRL---PRDIAQERMHHDIVRLLDE 2105          

HSP 2 Score: 95.9005 bits (237), Expect = 3.128e-19
Identity = 81/276 (29.35%), Postives = 114/276 (41.30%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PCVNG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC    C+N G C ES +   F C C  G+ G+ C V    C   P +    C N        N +  C C  GYTG  C+   +      C+ + C NGG C    N +  C+C   F G  C   + E       N               P  FN    I  +  +P   ++ C   F  G C    N+F C
Sbjct:  752 INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNT-------NGSYRCLCQAGYTGRNCESDID-----DCRPNPCHNGGSCTDGIN-TAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNG---IHCENNTPDCTESSC---FNGGTCVDGINSFTC 1007          

HSP 3 Score: 95.5153 bits (236), Expect = 3.551e-19
Identity = 71/216 (32.87%), Postives = 100/216 (46.30%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C ++PC +G   +  D  + C C  G  G  CE N++DC  NPC + GTC+DK +  + C C   + G++C    + C    C NGGTCE    G F C+C  G+    C  +   C   P I          HG C    N    C C PG++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  607 CHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKIDG-YECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAG-FTCRCPEGYHDPTCLSEVNECNSNPCI----------HGACRDGLN-GYKCDCAPGWSGTNCDINNNE-----CESNPCVNGGTCKDMTSGY-VCTCREGFSGPNCQTNINECASNPCLN 802          

HSP 4 Score: 91.6633 bits (226), Expect = 5.334e-18
Identity = 72/215 (33.49%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC++G C +  +  ++C C  GW G  C+ N N+C  NPC NGGTC D   S + C C   F G  CQ   N C +  C N GTC     G ++C C   + G  C V    C   P      C N G C    +   F C C  G+ G  C+      V+I  C    C +G  C+   NGS  C C+  +TG+NC   + + R     N
Sbjct:  720 CNSNPCIHGACRDGLN-GYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMT-SGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG-YKCNCPLPYTGATCEVVLAPCATSP------CKNSGVCKESEDYESFSCVCPTGWQGQTCE------VDINECVKSPCRHGASCQNT-NGSYRCLCQAGYTGRNCESDIDDCRPNPCHN 918          

HSP 5 Score: 88.1965 bits (217), Expect = 7.678e-17
Identity = 68/209 (32.54%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF---ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  C    D    C+C  G+ G+ CEENV+DC  N CKNGG C+D  N+ + C C  ++ G  C     E   +   C+NGGTC +   G + C C  G+ GE C+     C      +   C++          + +C+C  G TG  C       +   C S+ C  G  C     NG  IC C   +TG  C+  + E
Sbjct:  222 CSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNT-YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG-YNCVCVNGWTGEDCSENIDDCASAACFQGATCHDR-------VASFYCECPHGRTGLLCH------LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDE 415          

HSP 6 Score: 85.5001 bits (210), Expect = 4.555e-16
Identity = 67/206 (32.52%), Postives = 89/206 (43.20%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAFDP----EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            S  C + PC N       D     ++ CSC  G+ G  C   + N C+ NPC+NGGTC     +++ C C   + G  CQ  +PC +  C NGG C   E+  + C+C  GF G  C      C   P   R     H E   Y      C C   +TG  C    ELP  + C    C NGG C+   + +  C C   F G+NC
Sbjct:   60 SNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFES-SYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSY-----RCACRATHTGPHC----ELPY-VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNC 254          

HSP 7 Score: 83.1889 bits (204), Expect = 2.321e-15
Identity = 57/168 (33.93%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRK 961
            C NGG C +  N    C C+  F+G  CQ  NPCL+  C+N GTC  +++G    + C C  GF G  C    + AC   P      C N G CD+       C+C PG++G  C +         C S+ C NGG C   ++ S IC C   F G  C   + E  +
Sbjct:   31 CLNGGRC-EVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANP------CRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADP------CASNPCANGGQCLPFES-SYICRCPPGFHGPTCRQDVNECSQ 184          

HSP 8 Score: 82.4185 bits (202), Expect = 3.818e-15
Identity = 65/201 (32.34%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC--IDKKNS-QFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C+NG   E  +    C C   + G+ C+++ N C+  PCKN GTC  +D   +  + C+C   F G LC    +N CL   C NGGTC+ L    ++C+C  G+ G+ C  Q   C   P      C N G+C  +   +  C+C PG+ G  C +      E       C +GG C   + GS  C C+   TG +C +P
Sbjct:   31 CLNGGRCEVANGTEACVCSGAFVGQRCQDS-NPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNP------CANGGQCLPF-ESSYICRCPPGFHGPTCRQDVN---ECSQNPGLCRHGGTCHN-EIGSYRCACRATHTGPHCELP 218          

HSP 9 Score: 71.633 bits (174), Expect = 8.433e-12
Identity = 66/241 (27.39%), Postives = 93/241 (38.59%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP----------------------------------------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC NG     F+  + C C  G+ G TC ++VN+C QNP                                        C+NGGTC    ++   C C   F G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P      C N G C    +    C C  G+TG+ C +  +      C S  CF G  C      S  CEC    TG  C +
Sbjct:  144 CASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNA----CQNGGTCHNT-HGGYNCVCVNGWTGEDCSENID-----DCASAACFQGATCHDR-VASFYCECPHGRTGLLCHL 372          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Notch2 (notch 2 [Source:MGI Symbol;Acc:MGI:97364])

HSP 1 Score: 156.377 bits (394), Expect = 1.076e-37
Identity = 132/426 (30.99%), Postives = 199/426 (46.71%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP-CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC-----TIPLKE------TRKEALINIKIPKTFNEK--QLIIKKTKSP-SLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSS--CKFHK-CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTV 1528
            C N+PC NG  C++  +  F+CSC  G +G  CEEN+++C   P C NGG C+D+    +TC C   F G  C+ + N CL+  C + G+  C  L+N  + C CR  F G  C      CP  P      C N G C +  NM     C+C PG++G RC           C    C  G  C   D+G P C C      K+C     + P +        R+    + + P +F     +L    T +P + C +  C     +GICD+ CN+ AC +DGGDC     DPW  C       C    N+  C+ +CN  +CLFD  +C ++S  CK+ K C++ +++  CD+ CNS +CG+DG DC + +  +    EG            L +V++   +   +    FL+ L + L   + +
Sbjct: 1191 CQNQPCQNGGTCIDLVN-HFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGG-YTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNN-YNCICRSAFTGRHCETFLDVCPQKP------CLNGGTCAVASNMPDGFICRCPPGFSGARCQSS--------CGQVKCRRGEQCIHTDSG-PRCFC---LNPKDCESGCASNPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATCQSQYCADKARDGICDEACNSHACQWDGGDCSLTMEDPWANC--TSTLRCWEYINN-QCDEQCNTAECLFDNFECQRNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPENLA--EGT-----------LIIVVLLPPEQLLQDSRSFLRALGTLLHTNLRI 1579          

HSP 2 Score: 105.145 bits (261), Expect = 4.954e-22
Identity = 82/250 (32.80%), Postives = 114/250 (45.60%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICD 1087
            C ++PC+N          + C C  G+ G  CEE++NDC+ NPC+NGG+C+D  N+ F+C C   FIG+ CQ + N CL+  C+NGGTC    N  + C C  GF G  C         I +     C N G C    N +  C C  G+TG  C           C S+ C N G C V   G+  C C   +TGKNC         + L+N+        K   +++   P     LC   ++   CD
Sbjct:  877 CISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNT-FSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNS-YTCTCPAGFHGVHCENN------IDECTESSCFNGGTCVDGIN-SFSCLCPVGFTGPFCLHDINE-----CSSNPCLNAGTC-VDGLGTYRCICPLGYTGKNC---------QTLVNLCSRSPCKNKGTCVQEKARPHC---LCPPGWDGAYCD 1099          

HSP 3 Score: 98.9821 bits (245), Expect = 3.467e-20
Identity = 102/369 (27.64%), Postives = 146/369 (39.57%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ--FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP--ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH---------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKC 1405
            C++ PC +G     F   +RC C  G++G  CE  V++C   PC+NGGTCID  N  F C+C     G LC+   +      +C NGG C     G + C+C  GF GE C      C   P      C++ G  D       + C C   +TG  C+   ++     C    C NGG C V  N     IC C   F+G  C     +            K    +Q I   +     C N          C+  C +  C + GG C P R+        C+       C P        F G  C           ++C+   C++  ++ ICDE CNS  C +DGGDC  +  + + +     +C
Sbjct: 1153 CASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVN-HFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGG-YTCRCLPGFAGERCEGDINECLSNP------CSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDV-----CPQKPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQV-----------KCRRGEQCIHTDSGPRCFCLN-------PKDCESGCASNPCQH-GGTCYPQRQ---PPHYSCR-------CPPS-------FGGSHCELYTAPTSTPPATCQSQYCADKARDGICDEACNSHACQWDGGDCSLTMEDPWANCTSTLRC 1472          

HSP 4 Score: 95.1301 bits (235), Expect = 4.670e-19
Identity = 71/200 (35.50%), Postives = 94/200 (47.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC++G C       ++C C  GW G  CE + N+C+ NPC+NGGTC +  N  + C C   F G  CQ   + C +  C N GTC    +G + C C   + G+ C  Q +  P  P      C N   C   PN   F C C PG+ G RC    +      C S  C N GVC     GS +CEC   F+G +C
Sbjct:  724 CLSNPCIHGNCTGGLS-GYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNG-YRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSG-YTCHCMLPYTGKNC--QTVLAPCSPNP----CENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDE-----CISKPCMNNGVCHNT-QGSYVCECPPGFSGMDC 908          

HSP 5 Score: 94.7449 bits (234), Expect = 7.244e-19
Identity = 67/235 (28.51%), Postives = 118/235 (50.21%), Query Frame = 2
Query: 2243 DEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  YQ +SL+      +  GE  +H+AAR +      + ++A   +  ++ D  GR PL +++AADA +   Q+LI  +    +++ N                     TT LI A +L  + M++ L++  + VN +D  G+S +HW+A  NN   +E    +       D++DN++++PLFLAA EG+ ++ K LL +F    I   MD     P+ +A ++  ++I  L+ E
Sbjct: 1862 DLVYQGASLQA---QTDRTGEMALHLAARYSRADAAKRLLDAG--ADANAQDNMGRCPLHAAVAADA-QGVFQILIRNRVTDLDARMND-------------------GTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNN---VEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRL---PRDVARDRMHHDIVRLLDE 2065          

HSP 6 Score: 88.5817 bits (218), Expect = 4.931e-17
Identity = 69/219 (31.51%), Postives = 96/219 (43.84%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            V    C + PC NG         +RC+C  G+KG  C+ N+++C  NPC N GTC D   S +TC+C   + G  CQ    PC    CEN   C+   N   F C C  G+ G+ C V    C   P     +C+N          +  C+C PG++G  C++         C ++ C NGG C V    +  C+C   F G  C   + E   E   N
Sbjct:  756 VDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDV-SGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNT-------QGSYVCECPPGFSGMDCEEDIN-----DCLANPCQNGGSC-VDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKN 960          

HSP 7 Score: 87.8113 bits (216), Expect = 9.933e-17
Identity = 70/217 (32.26%), Postives = 101/217 (46.54%), Query Frame = 2
Query:  350 RPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQF--ENPC-LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK---KKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
             PCVN G CV   +    C C  G+ GE C+   + C +N C+NGGTC+ +    + TC C   F G  CQ+   +PC ++  C+NGGTC  L    ++C C+ GF G+ C   + AC   P +    C +             CKC  G TG +C+    + ++P         C +GG C  L  GS  C+C   FTG++C  P         +N
Sbjct:   33 EPCVNEGTCVTYHNGTGFCRCPEGFLGEYCQHR-DPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQWTD-ACLSHPCENGSTCTSVAS-------QFSCKCPAGLTGQKCEADINECDIP-------GRCQHGGTCLNLP-GSYRCQCPQGFTGQHCDSPYVPCAPSPCVN 232          

HSP 8 Score: 87.0409 bits (214), Expect = 1.392e-16
Identity = 68/209 (32.54%), Postives = 97/209 (46.41%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCL--NVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            C+  PCVNG  C +  D  F C+C  G++G TCE N++DC  + C+NGG C+D  N+ + C C  Q+ G  C  + + CL     C+NGGTC +  NG + C C  G+ G+ C+     C          C       I    +  C C  G  G  C       ++  C S+ C  G +C     NG  IC C   + G +CT  + E
Sbjct:  225 CAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNT-YNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTN-RNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTC-------IDRVASFSCLCPEGKAGLLCH------LDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDE 418          

HSP 9 Score: 86.6557 bits (213), Expect = 1.984e-16
Identity = 64/193 (33.16%), Postives = 88/193 (45.60%), Query Frame = 2
Query:  365 GKCV-EAFDPEFRCSCWHGWKGETCEENV-NDC-IQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            G CV +    +  C C  G+ GE C+ +  + C +  PC+NGGTC       + C C   F G  CQ+ + CL+  CENG TC S+ +  F CKC  G  G+ C      C  IP +    C + G C   P  +  C+C  G+TG  CD        + C    C NGG C+   + +  C C   F G  C
Sbjct:   77 GTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQWTDACLSHPCENGSTCTSVAS-QFSCKCPAGLTGQKCEADINECD-IPGR----CQHGGTCLNLPG-SYRCQCPQGFTGQHCDSPY-----VPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTC 257          

HSP 10 Score: 86.2705 bits (212), Expect = 2.950e-16
Identity = 70/205 (34.15%), Postives = 92/205 (44.88%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            GKCV   D  F C C  G+ G  CE ++N+C  +PC+N  TC+DK    FTC C   F G  C+ E N C +  C N G C    N  FQC C  GF G  C +    C   P      C N  +C  +PN    C+C  G+TG  CD+  +      C  D C +G     +D  S  C C   + G  C+  + E      +N
Sbjct:  431 GKCVNT-DGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGG-FTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVN-RFQCLCPPGFTGPVCQIDIDDCSSTP------CLNGAKCIDHPN-GYECQCATGFTGILCDENID-----NCDPDPCHHGQCQDGID--SYTCICNPGYMGAICSDQIDECYSSPCLN 618          

HSP 11 Score: 85.5001 bits (210), Expect = 3.998e-16
Identity = 65/210 (30.95%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDN-GSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NG      +  + C C +GW G+ C EN++DC    C  G TCID+  S F+C C     G LC  ++ C++  C  G  C++   NG + C C  G+ G  C      C +        C + G+C +  +    C+C  GY G RC+      ++I  C SD C N   C  LD  G   C C   F G +C + + E +    +N
Sbjct:  309 CQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVAS-FSCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAM---ANSNPCEHAGKC-VNTDGAFHCECLKGYAGPRCE------MDINECHSDPCQNDATC--LDKIGGFTCLCMPGFKGVHCELEVNECQSNPCVN 505          

HSP 12 Score: 76.6406 bits (187), Expect = 2.109e-13
Identity = 55/167 (32.93%), Postives = 69/167 (41.32%), Query Frame = 2
Query:  461 QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMF---QCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            Q PC N GTC+   N    C C   F+G  CQ  +PC    C+NGGTC  +  GM     C+C  GF GE C          P      C N G C +    T  C C  G+TG +C           C S  C NG  C  + +    C+C    TG+ C   + E
Sbjct:   32 QEPCVNEGTCVTYHNGTGFCRCPEGFLGEYCQHRDPCEKNRCQNGGTC--VPQGMLGKATCRCAPGFTGEDCQYSTSH----PCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQWTD------ACLSHPCENGSTCTSVASQF-SCKCPAGLTGQKCEADINE 185          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Notch3 (notch 3 [Source:MGI Symbol;Acc:MGI:99460])

HSP 1 Score: 132.109 bits (331), Expect = 2.962e-30
Identity = 117/414 (28.26%), Postives = 175/414 (42.27%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT--CIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCE-SLENG---MFQCKCRYGFIGEFC-----AVQNIACPV-IPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELP---VEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKS----SCK--FHK-CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLR 1513
            NG CV+     FRC+C  G+ G  CE ++N+C    C    T  C+      F C C   F G  CQ   +PC +  C++GG C  SL  G    F C C   F G  C     + + + CPV IP ++                   C C PG +G  C   +  P       C S  C +GG C  + +  P   C C   + G  C  P      E     + P+                     C+A   +  CD++CNT  C +DGGDC     DPWR+C   +   C  +FN+  C+P C++  CL+D  DC+      +C   + K C++ + +  CD+ CN+ +CG+DG DC  S   +  +   L             L ++   +   +  ++FLQ+LS+ LR
Sbjct: 1180 NGTCVDLVG-GFRCNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTA-------------RGPRCACPPGLSGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQS-VPFFRCVCAPGWGGPRCETP--SAAPEVPEEPRCPRA-------------------ACQAKRGDQNCDRECNTPGCGWDGGDCSLNVDDPWRQC---EALQCWRLFNNSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC-ASEVPALLARGVLV------------LTVLLPPEELLRSSADFLQRLSAILR 1541          

HSP 2 Score: 97.0561 bits (240), Expect = 1.320e-19
Identity = 95/334 (28.44%), Postives = 129/334 (38.62%), Query Frame = 2
Query:  317 LVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENV--NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE-----------TRKEALINIKIPKTFNEKQLIIKKTK-SPSLCDNLCKASFENGICDQQCNTFAC----NYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCL----FDGEDCH 1252
            L + ++  C+++PC +G C +A    FRC C  GW G  C +++  + C   PC+ GGTC       F C C   F G+ C+  +PC    CE+GG CES  + +  C C  G+ G  C      C          C  HG C   P     C C  GYTG  CD+  +      C  + C +GG C+    GS  C C   F G  C   + E           T   A      P  +      I     SPS C       F  G C    ++F+C     Y G  C      Y  D    +   + G+CNP     +C     F G  C 
Sbjct:  692 LCLPANHPCAHKPCSHGVCHDAPG-GFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCT-SDGIGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDEC-----AGASPCGPHGTCTNLPG-NFRCICHRGYTGPFCDQDID-----DCDPNPCLHGGSCQD-GVGSFSCSCLDGFAGPRCARDVDECLSSPCGPGTCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSC-------FNGGTCVDGVSSFSCLCRPGYTGTHCQ-----YEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQ 999          

HSP 3 Score: 83.9593 bits (206), Expect = 1.437e-15
Identity = 92/312 (29.49%), Postives = 137/312 (43.91%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC-LNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNI-----------------------ACPVIPKKKREL------------CNNHGECDIYP-NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE-----TRKEALINIKIPKTFNEKQLIIKKTKSPSLCD---NLCKAS--FENGICDQQCNTFACNYDGG 1126
            C+  PC NG  C ++ D  + C+C  G++G+ CE NV+DC  + C NGGTC+D  N+ + C C  ++ G  C  + + C L  N C NGGTC +L  G   C C  G+ GE C+ QNI                       ACP+    K  L            C+    CD  P +    C C PG+TG  CD+  +   E    ++ C + G C V   GS +C+C   +TG  C   + E      R +A    +I     +   I     + + C+   + C++S     G+C  + N F+C    G
Sbjct:  202 CAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNT-YNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGG-HSCVCVNGWTGESCS-QNIDDCATAVCFHGATCHDRVASFYCACPM---GKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVD---ECSIGANPCEHLGRC-VNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRI----GQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSG 499          

HSP 4 Score: 83.1889 bits (204), Expect = 2.049e-15
Identity = 60/185 (32.43%), Postives = 87/185 (47.03%), Query Frame = 2
Query:  395 FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            FRC C  G+ G  C+++++DC  NPC +GG+C D   S F+C+C   F G  C  + + CL+  C  G   + + +  F C C  G+ G  C +       +P      C N G C +    +  C C PGYTG  C  + +      C S  C +GG+C     G   C C+  FTG  C  P+
Sbjct:  834 FRCICHRGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGS-FSCSCLDGFAGPRCARDVDECLSSPCGPGTCTDHVAS--FTCACPPGYGGFHCEID------LPDCSPSSCFNGGTC-VDGVSSFSCLCRPGYTGTHCQYEADP-----CFSRPCLHGGICNPTHPGF-ECTCREGFTGSQCQNPV 1002          

HSP 5 Score: 82.0333 bits (201), Expect = 5.317e-15
Identity = 64/213 (30.05%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  353 PCVNGKCVEAFDP--EFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC---IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            PC NG       P  E  C C  GW GE C+   + C   PC   G C   +    ++F+C C   F G  C   +PC++  C +G  C    +G F C C  G+ G+ C      C     +    C + G C   P  +  C+C  GYTG  C    E PV + C    C NGG C+   + +  C C   F G+NC + + +      +N
Sbjct:   48 PCANGGRCTHQQPSLEAACLCLPGWVGERCQLE-DPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQPDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDEC-----RSGTTCRHGGTCLNTPG-SFRCQCPLGYTGLLC----ENPV-VPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDDCPGHRCLN 248          

HSP 6 Score: 80.4925 bits (197), Expect = 1.579e-14
Identity = 60/224 (26.79%), Postives = 110/224 (49.11%), Query Frame = 2
Query: 2276 LGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIK--MDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            LG   +  GE+ +H+AAR        + ++A   +  ++ D  GRTPL +++ ADA +   Q+LI  +    +++                       +TALI A +L  + M+  L+   + VN +D  G+S +HW+A  NN   +E    +       D++D+++++PLFLAA EG+ ++ K LL +     I   +D     P+ +A+E+   +I  L+ +
Sbjct: 1832 LGARTDRTGETALHLAARYARADAAKRLLDAG--ADTNAQDHSGRTPLHTAVTADA-QGVFQILIRNRSTDLDAR-------------------MADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNN---VEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHLANREITDHLDRL---PRDVAQERLHQDIVRLLDQ 2027          

HSP 7 Score: 78.1814 bits (191), Expect = 8.115e-14
Identity = 83/334 (24.85%), Postives = 126/334 (37.72%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC--AVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN-----IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFN----DGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKIC 1306
            C++ PC  G C +  +  + C C  G+ G  C   +N+C  +PC  GG+C+D +N  F C C    +  LC   N PC +  C + G C     G F+C C  G+ G  C  ++   AC   P +    C + G       +   C C PG+ G +C+      V   C    C +GG C+   +   +C C   + G  C   + E    +          +P  F                  +C   +    CDQ         D  DCDP    +G   +   G F+    DG   P C       D ++C  S C    C++   +  C
Sbjct:  625 CASNPCTFGVCRDGIN-RYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENG-FHCLCPPGSLPPLCLPANHPCAHKPCSH-GVCHDAPGG-FRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDG-------IGFRCTCAPGFQGHQCE------VLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFR----------------CICHRGYTGPFCDQ---------DIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCAR-----DVDECLSSPCGPGTCTDHVASFTC 911          

HSP 8 Score: 73.9442 bits (180), Expect = 1.581e-12
Identity = 64/214 (29.91%), Postives = 93/214 (43.46%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ------FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC----DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C + PCVNG   +     F C+C  G+ G  C+ +V++C   PC+NG  C+D+ +  + C C   F G LC+        +PC +  C +G          F C C  G+ G  C  Q   C      + + C   G+C    D Y      C+C PG TG  C+   +      C S+ C   GVC+   N    C C+  FTG  C + + E
Sbjct:  474 CQSSPCVNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDG-YECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDG-------IASFSCACAPGYTGIRCESQVDEC------RSQPCRYGGKCLDLVDKY-----LCRCPPGTTGVNCEVNID-----DCASNPC-TFGVCRDGINRY-DCVCQPGFTGPLCNVEINE 661          

HSP 9 Score: 71.633 bits (174), Expect = 7.037e-12
Identity = 59/189 (31.22%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PC----------LNVNCENGGTCESLENGMFQ-CKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            C +RPC++G       P F C+C  G+ G  C+  V+ C Q PC+NGG C+    +   C C   + G LC  ++ PC          L   C+ GG C  ++ G    C C  G  G  C  +   C   P      C + G C  Y      C+C  GY GD C+   +      C S  C NGG C
Sbjct:  967 CFSRPCLHGGICNPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCV---QTGAYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKC--IDKGRSHYCVCPEGRTGSHCEHEVDPCTAQP------CQHGGTCRGY-MGGYVCECPAGYAGDSCEDNIDE-----CASQPCQNGGSC 1138          

HSP 10 Score: 71.2478 bits (173), Expect = 8.762e-12
Identity = 52/161 (32.30%), Postives = 74/161 (45.96%), Query Frame = 2
Query:  395 FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            FRC C  G+ G  CE  V  C  +PC+NGGTC    +  + C C   F G  C+   + C    C NGGTC    N  + C+C   + G+FC      C + P      C+N G C ++    +  C C  G+TG+ C +  +      C +  CF+G  C
Sbjct:  182 FRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVN-TYNCQCPPEWTGQFCTEDVDECQLQPNA----CHNGGTCFNLLGGHS--CVCVNGWTGESCSQNID-----DCATAVCFHGATC 330          

HSP 11 Score: 68.5514 bits (166), Expect = 6.746e-11
Identity = 51/166 (30.72%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  464 NPCKNGGTCIDKKNS-QFTCNCTSQFIGNLCQFENPCLNVNCENGGTCES---LENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSD-YCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            +PC NGG C  ++ S +  C C   ++G  CQ E+PC +  C   G C+S        F C+C  GF G  C+  +   P + +     C +   C + P+    C C PGY G  C    +      C+S   C +GG C +   GS  C+C   +TG  C  P+
Sbjct:   47 SPCANGGRCTHQQPSLEAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQPD---PCVSRP----CVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDE-----CRSGTTCRHGGTC-LNTPGSFRCQCPLGYTGLLCENPV 199          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 117.087 bits (292), Expect = 9.790e-26
Identity = 121/437 (27.69%), Postives = 171/437 (39.13%), Query Frame = 2
Query:  284 FPMNVFILGCLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP--ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQ-LIIKKTKSPSLCDNL-------------------CKASFENGICDQ---------QC--------------NTFACNYDGGD--CD---------------------PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH-KSSCKF---HKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNS 1375
            FP++         I  S LC N     G C++     F C C  G++G+ C++NVN C  NPC +G TC+ +  S + C C   + G  C +  + C +  C N GTC S   G F C C  GF+G  C      C   P         H   + +     +C+C PG+TG RC+ + +L     C+S  C NGG C++     P   C C   F G  C+           ++  I    N    L   K  SP LC  L                         NG C +         QC                  C   GGD  CD                     PW+ C  +    C  +F DG C+P+C++ +CLFDG DC    +C       C + + N  C++ CN+ +CG+DGGDC     +S
Sbjct:  878 FPLSCQKAAMSQGIEISGLCQN----GGLCIDTGSSYF-CRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQP-SGYVCQCAPGYEGQNCSKVLDACQSQPCHNHGTCTSRPGG-FHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACHSLANAF-----YCQCLPGHTGQRCEVEMDL-----CQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCS--------HKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNGTCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCSLGVPDPWKGCPPH--SQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFHNGHCEKGCNNAECGWDGGDCRPEGEDS 1287          

HSP 2 Score: 91.2781 bits (225), Expect = 7.388e-18
Identity = 71/199 (35.68%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL 946
            PC +G         F C C  G+ G  CE + N+C+  PC  G TC+D   + F C C     G LC+ E N C +  C N   C  L NG FQC C  GF G  C      C   P      C N G C   P    +C+C PG+ G  C+K+ +      C SD C  G  C  L  G+  C C+  FTG+ C +PL
Sbjct:  442 PCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLL-ATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNG-FQCLCLPGFTGARCEKDMDECSSTP------CANGGRCRDQPG-AFYCECLPGFEGPHCEKEVDE-----CLSDPCPVGASCLDLP-GAFFCLCRPGFTGQLCEVPL 625          

HSP 3 Score: 81.2629 bits (199), Expect = 9.299e-15
Identity = 55/171 (32.16%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  467 PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVN-CENGGTCESLENGM-------------FQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            PC NGGTC+     Q  C C   F+G  CQF +PC +   C+NGG+C++L                 F C C  GF G+ C       CP         C+N G C +  +    C C+PG+TG++C  +        C ++ C NGGVC +       C C   F G  C
Sbjct:   31 PCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPP------SFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDF------CSANPCANGGVC-LATYPQIQCRCPPGFEGHTC 188          

HSP 4 Score: 80.8777 bits (198), Expect = 1.029e-14
Identity = 70/233 (30.04%), Postives = 97/233 (41.63%), Query Frame = 2
Query:  317 LVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAV--------------------QNIACP-----VIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            L  V    C++ PC+N          F+C C  G+ G  CE+++++C   PC NGG C D+  + F C C   F G  C+ E + CL+  C  G +C  L  G F C CR GF G+ C V                        CP      +P +    C +HG C         C CD G+TG  C+ +       GC S  C +GG C    +G   C C   + G  C+
Sbjct:  506 LCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRCRDQPGA-FYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLP-GAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPC-HHGHCQRS-----LCVCDEGWTGPECETELG-----GCISTPCAHGGTCHPQPSGY-NCTCPAGYMGLTCS 724          

HSP 5 Score: 80.8777 bits (198), Expect = 1.239e-14
Identity = 64/271 (23.62%), Postives = 122/271 (45.02%), Query Frame = 2
Query: 2129 LAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINA-INPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQ 2938
            L   +    ++ST G  P   GLG++     + +     + +   +           GE+ +H+AAR +      + + A  NP+     D  GRTPL +++AADA E   QLL+  +Q   +++                       TT L+ A +L  ++++  L+   + V   D +G++ +HW+A  NN+     L      +   D +D+ +++PLFLAA EGA++  + LL       ++ D     P  +A ++  +++  L++
Sbjct: 1583 LMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGACPQAHTVGT-----------GETPLHLAARFSRPTAARRLLEAGANPNQP---DRAGRTPLHTAVAADAREVC-QLLLASRQTTVDARTED-------------------GTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVNNARAARSLLQAGADK---DAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLR-DQAGLAPGDVARQRSHWDLLTLLE 1815          

HSP 6 Score: 78.5666 bits (192), Expect = 5.076e-14
Identity = 77/251 (30.68%), Postives = 102/251 (40.64%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI-CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC 1084
            C + PC +G         + C+C  G+ G TC E V  C   PC NGG+C  +    ++C C     G  CQ   + C++ +C NGGTC + + G F C C  GF G  C  + N +C   P      C N   C   P     C C PGYTG  C    +L     C    C +   C  L +G    C C   +TG  C  PL   +      I+I        L I  T S   C   C   F+  +C
Sbjct:  692 CISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEG-YSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVN-KPGTFFCLCATGFQGLHCEEKTNPSCADSP------CRNKATCQDTPRGAR-CLCSPGYTGSSCQTLIDL-----CARKPCPHTARC--LQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCI-DTGSSYFCR--CPPGFQGKLC 923          

HSP 7 Score: 78.5666 bits (192), Expect = 5.295e-14
Identity = 65/208 (31.25%), Postives = 86/208 (41.35%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NG   +     F C C  GW G  CEEN++DC    C  G TCID+  S F+C C     G LC  E+ CL+  C     C +    G   C C+ G+ G  C      C  + ++    C + G C   P  +  C C PGYTG RC+          C S  C  G  C  L   +  C C     G+ C + + E      +N
Sbjct:  323 CRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGS-FSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDEC-QMAQQGPSPCEHGGSCINTPG-SFNCLCLPGYTGSRCEADHNE-----CLSQPCHPGSTCLDL-LATFHCLCPPGLEGRLCEVEVNECTSNPCLN 521          

HSP 8 Score: 69.3218 bits (168), Expect = 3.292e-11
Identity = 54/156 (34.62%), Postives = 67/156 (42.95%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD 805
            C ++PC  G         F C C  G +G  CE  VN+C  NPC N   C D  N  F C C   F G  C+ + + C +  C NGG C   + G F C+C  GF G  C  +   C   P      C     C   P    FC C PG+TG  C+
Sbjct:  476 CLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNG-FQCLCLPGFTGARCEKDMDECSSTPCANGGRCRD-QPGAFYCECLPGFEGPHCEKEVDECLSDP------CPVGASCLDLPG-AFFCLCRPGFTGQLCE 622          

HSP 9 Score: 69.3218 bits (168), Expect = 3.434e-11
Identity = 75/267 (28.09%), Postives = 103/267 (38.58%), Query Frame = 2
Query:  317 LVIVSSKLC--SNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCE--ENVNDCIQNPCKNGGTC-------------IDKKNSQFTCNCTSQFIGNLCQ--FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKK-KELPVEIG----------------------------------CKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTI 940
            +++    LC  S  PC NG  C+     +  C C  G+ GETC+  +   D     CKNGG+C                    F+C C S F G+ CQ   E  C    C NGG C    +G  QC C  G+ GE C +++  C   P      C N G C   YP +   C+C PG+ G  C++   E  +E G                                  C    C NGG C+++  G     +C C   FTG +C +
Sbjct:   17 VILTRELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRD--TQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDF-CSANP------CANGGVCLATYPQIQ--CRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEM 272          

HSP 10 Score: 64.3142 bits (155), Expect = 1.102e-9
Identity = 60/190 (31.58%), Postives = 78/190 (41.05%), Query Frame = 2
Query:  323 IVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCL--NVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYP---NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            +     CSN     G C        +CSC  GW GE C+  + D C  NPC NGG C+     Q  C C   F G+ C+ + N C      C  G +C +   G +QC C  G  G  C ++  ACP         C N G C + P   +    C C PG+TG  C+   +      C    C NG  C
Sbjct:  118 LCPPSFCSN----GGHCYVQASGRPQCSCEPGWTGEQCQ--LRDFCSANPCANGGVCL-ATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTL-GSYQCLCPVGQEGPQCKLRKGACPP------GSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPD-----DCVRHQCQNGATC 288          

HSP 11 Score: 58.9214 bits (141), Expect = 5.386e-8
Identity = 63/209 (30.14%), Postives = 84/209 (40.19%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCI--QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENG---MFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC----DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
             CS  PC NG    A  P+ +C C  G++G TCE ++N+C     PC  G +C +   S + C C     G  C+  +  C   +C NGGTC+ +  G      C C  GF G  C +    C       R  C N   C    D Y      C C   + G  C +  +     G     C NGG C+    GS  C C   + G  C
Sbjct:  156 FCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGS-YQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDC------VRHQCQNGATCLDGLDTY-----TCLCPKTWKGWDCSEDIDECEARG--PPRCRNGGTCQNT-AGSFHCVCVSGWGGAGC 349          
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Match: Sned1 (sushi, nidogen and EGF-like domains 1 [Source:MGI Symbol;Acc:MGI:3045960])

HSP 1 Score: 105.531 bits (262), Expect = 3.234e-22
Identity = 75/201 (37.31%), Postives = 104/201 (51.74%), Query Frame = 2
Query:  350 RPCVNG-KCVE---AFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            RPC+NG KC++     +P + CSC  G+ G  C  +VN+C  +PC+NGGTC    NS F+C C + F G  C+  ++PC N  C+NGG C++ E+    C C+ G+ G  C      C   P      C N G C D+  N +  C C   + G +C+    L V   C S+ C NGG C   D G  +CEC   F G +C
Sbjct:  276 RPCLNGGKCIDDCVTGNPSYTCSCLAGFTGRRCHLDVNECASHPCQNGGTCTHGVNS-FSCQCPAGFKGPTCESAQSPCDNKVCQNGGQCQA-ESSSAVCVCQAGYTGATCETDVDECSSDP------CQNGGSCVDLVGNYS--CICVEPFEGPQCETGSYL-VPSPCLSNPCQNGGTCVDADEGY-VCECPEGFMGLDC 464          

HSP 2 Score: 92.8189 bits (229), Expect = 2.450e-18
Identity = 77/241 (31.95%), Postives = 110/241 (45.64%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-----FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKREL----CNNHGECDIYPNMTLFCKCDPGY---------TGDRCDKKKELP-----VEIG--------------------CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C N+ C NG   +A      C C  G+ G TCE +V++C  +PC+NGG+C+D   + ++C C   F G  C+       +PCL+  C+NGGTC   + G + C+C  GF+G  C            ++R L    C N G C +  N TL C+C PG+         T   C+   + P     +E G                    C SD CFNGG C   ++ S  CEC   F G++C
Sbjct:  353 CDNKVCQNGGQCQAESSSAVCVCQAGYTGATCETDVDECSSDPCQNGGSCVDLVGN-YSCICVEPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDADEG-YVCECPEGFMGLDC------------RERILNDCDCRNGGRC-LGANTTL-CQCPPGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNISHSLPSPCDSDPCFNGGSCDAHED-SYTCECPRGFHGRHC 576          

HSP 3 Score: 82.8037 bits (203), Expect = 2.392e-15
Identity = 53/165 (32.12%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEI 832
            C ++PC++G   +    +++C C  G++G  CE   ++C   PC+NGG+C D   + F C C   F+G  C+ E + C +  C++GG CE    G + C C  GF G  C   +  C   P      C + G C +  N +  C C  GYTG  C K+   P  +
Sbjct:  757 CRSQPCLHGGSCQDLIADYQCLCSPGYEGVHCELETDECQAQPCRNGGSCRDLPRA-FICQCPEGFVGIHCETEVDACASSPCQHGGRCED-GGGAYLCVCPEGFFGYNCETVSDPCFSSP------CGSRGYC-LASNGSHSCTCKVGYTGKDCTKELLPPTAL 912          

HSP 4 Score: 77.411 bits (189), Expect = 1.042e-13
Identity = 58/163 (35.58%), Postives = 74/163 (45.40%), Query Frame = 2
Query:  458 IQNPCKNGGTCID---KKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            +  PC NGG CID     N  +TC+C + F G  C  + N C +  C+NGGTC    N  F C+C  GF G  C      C        ++C N G+C    + +  C C  GYTG  C+   +      C SD C NGG C  L  G+  C C   F G  C
Sbjct:  274 VLRPCLNGGKCIDDCVTGNPSYTCSCLAGFTGRRCHLDVNECASHPCQNGGTCTHGVNS-FSCQCPAGFKGPTCESAQSPC------DNKVCQNGGQCQAE-SSSAVCVCQAGYTGATCETDVDE-----CSSDPCQNGGSCVDL-VGNYSCICVEPFEGPQC 422          

HSP 5 Score: 75.485 bits (184), Expect = 4.986e-13
Identity = 66/239 (27.62%), Postives = 102/239 (42.68%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKK---------ELP--VEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN----IKIPKTF 997
             LCS+ PC NG   +    E+RC+C + + G  CE    D C   PC NGGTC      ++ C+C   F G  C+   +PC    C NGGTCE L    F C C+ G+ G  C  + + C    + +      +G    +        C+PG++       +         + P  +E+  C+S  C +GG C+ L      C C   + G +C +   E + +   N      +P+ F
Sbjct:  582 HLCSSGPCRNGGTCKEMGDEYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIG-KYKCDCPPGFSGRHCEIAPSPCFRSPCMNGGTCEDLGTD-FSCYCQPGYTGHRCQAE-VDCGHPEEVEHATMRFNG---THVGSVALYTCEPGFSLSALSHIRVCQPQGVWSQPPQCIEVDECRSQPCLHGGSCQDL-IADYQCLCSPGYEGVHCELETDECQAQPCRNGGSCRDLPRAF 813          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|G3I6Z6|NOTC1_CRIGR (Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 1.158e-50
Identity = 236/1013 (23.30%), Postives = 388/1013 (38.30%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL----------------KETRKEALINIKIPKTFNEKQLII----------KKTKSPSLCDNL----CKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS---------------------RSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQ---KLSSSLRMVVTVFNVT-------EINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVN--ENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGR----------------------TPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            CS  PC NG     +   F C C  G+ G  C E +N+C+  PC+NGGTCID  N+                                              ++C C   F+G  C+ + N CL+  C+  GT + ++    F C+CR G  G  C        VI   + + C N G C +  N      C+C  G+ G  C+          C S  C NGG C +    SP C C G FTG  C  P                 + T +        P  FN     I          +    P + +      C+    N +C+ QCN  AC +DGGDC     DPW+ C       C   F+DG C+ +CN+  CLFDG DC ++  + +      C + + +  CD+ CNS +C +DG DC                        R+NSF     L+       +++ D      +  +  ++ E  +   K S+      ++   T       E++       ++ L ++  QCV    QCF S   ++ FL A    GN L++P+++  V +  +      +L +  +   A      +     GVLL  K  +   ++     +  S              + G   L    D        N+  +G+   +T + R       PD     ++R+   + ++      A  L   ++  T     +DA   DV    +V+    +      S   G  E  N  E  ++   I+  +  GA++  Q +    + LH    + R                      TPL ++++ADA +   Q+L+  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1165 CSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNTYKCSCPRGTQGVHCEINVDDCHPHLDPASRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDINECLSNPCDPRGTQDCVQRVNDFHCECRAGHTGRRCES------VINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDART-----CGSLRCLNGGTC-ISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQEDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFSDGHCDSQCNSASCLFDGFDCQRTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECDWDGLDCADHVPERLAAGTLVLVVLLPPEQLRNNSFHFLRELSHVLHTNVVFKRDAEGQQMIFPYYGHEEELRKHPIKRSAVGWTTSSLLPSTNGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGN-LNIPYKIEAVKSETVEPPLPSQLHLMYL---AAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD--GALMDDNQNEWGDEDLETKKFRFEEPVVVPDLDDQTDHRQWTQQHLD------AADLRMSAMAPTPPQGEVDADCMDV----NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADA-QGVFQILLRNRATDLDARMH-------------------DGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRL---PRDIAQERMHHDIVRLLDE 2121          

HSP 2 Score: 95.9005 bits (237), Expect = 2.169e-18
Identity = 71/216 (32.87%), Postives = 100/216 (46.30%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C ++PC +G   +  D  + C C  G  G  CE N++DC  NPC + GTC+DK +  + C C   + G++C    + C    C NGGTCE    G F C+C  G+    C  +   C   P I          HG C    N    C C PG++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  623 CHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKIDG-YECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAG-FTCRCPEGYHDPTCLSEVNECNSNPCI----------HGACRDGLN-GYKCDCAPGWSGTNCDINNNE-----CESNPCVNGGTCKDMTSGY-VCTCREGFSGPNCQTNINECASNPCLN 818          

HSP 3 Score: 95.5153 bits (236), Expect = 2.866e-18
Identity = 80/276 (28.99%), Postives = 114/276 (41.30%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PCVNG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC    C+N G C ES +   F C C  G+ G+ C +    C   P +    C N        N +  C C  GYTG  C+   +      C+ + C NGG C    N +  C+C   F G  C   + E       N               P  FN    I  +  +P   ++ C   F  G C    N+F C
Sbjct:  768 INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNT-------NGSYRCLCQAGYTGRNCESDID-----DCRPNPCHNGGSCTDGINMA-FCDCLPGFQGAFCEEDINECASNPCRNGANCTDCVDSYTCTCPAGFNG---IHCENNTPDCTESSC---FNGGTCVDGINSFTC 1023          

HSP 4 Score: 91.6633 bits (226), Expect = 4.725e-17
Identity = 71/215 (33.02%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC++G C +  +  ++C C  GW G  C+ N N+C  NPC NGGTC D   S + C C   F G  CQ   N C +  C N GTC     G ++C C   + G  C V    C   P      C N G C    +   F C C  G+ G  C+      ++I  C    C +G  C+   NGS  C C+  +TG+NC   + + R     N
Sbjct:  736 CNSNPCIHGACRDGLN-GYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKD-MTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG-YKCNCPLPYTGATCEVVLAPCATSP------CKNSGVCKESEDYESFSCVCPTGWQGQTCE------IDINECVKSPCRHGASCQNT-NGSYRCLCQAGYTGRNCESDIDDCRPNPCHN 934          

HSP 5 Score: 88.1965 bits (217), Expect = 4.497e-16
Identity = 68/209 (32.54%), Postives = 96/209 (45.93%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  C    D    C+C  G+ G+ CEENV+DC  N CKNGG C+D  N+ + C C  ++ G  C  + + C  +   C+NGGTC +   G + C C  G+ GE C+     C      +   C++          + +C+C  G TG  C       +   C S+ C  G  C     NG  IC C   +TG  C+  + E
Sbjct:  238 CSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNT-YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG-YNCVCVNGWTGEDCSENIDDCASAACFQGATCHDR-------VASFYCECPHGRTGLLCH------LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDE 431          

HSP 6 Score: 84.3445 bits (207), Expect = 7.596e-15
Identity = 65/208 (31.25%), Postives = 89/208 (42.79%), Query Frame = 2
Query:  359 VNGKCVEAFDPEFRCSCWHGWKGET---CEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRK 961
            + G C +  DP     C H     +   C +    C+     NGG C +  N    C C+  F+G  CQ  NPCL+  C+N GTC  +E+G    + C C  GF G  C    + AC   P      C N G CD+       C+C PG++G  C +         C S+ C NGG C   ++ S IC C   F G  C   + E  +
Sbjct:   12 LEGGCEQNIDPRRAAHCHHPRLATSSLRCSQPSGTCL-----NGGRC-EVANGTEACVCSGPFVGQRCQDPNPCLSTPCKNAGTCHVVEHGGTVNYACSCPLGFSGPLCLTPLDNACLANP------CRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADP------CASNPCANGGQCLPFES-SYICGCPPGFHGPTCRQDVNECSQ 200          

HSP 7 Score: 81.2629 bits (199), Expect = 6.868e-14
Identity = 61/181 (33.70%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  395 FRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            + CSC  G+ G  C   + N C+ NPC+NGGTC     +++ C C   + G  CQ  +PC +  C NGG C   E+  + C C  GF G  C      C   P   R     H E   Y      C C   +TG  C    ELP  + C    C NGG C+   + +  C C   F G+NC
Sbjct:  101 YACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFES-SYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSY-----RCVCRATHTGPHC----ELPY-VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNC 270          

HSP 8 Score: 77.411 bits (189), Expect = 1.012e-12
Identity = 67/215 (31.16%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  323 IVSSKLCSNRP---CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---QFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            + +S L  ++P   C+NG   E  +    C C   + G+ C++  N C+  PCKN GTC   ++     + C+C   F G LC    +N CL   C NGGTC+ L    ++C+C  G+ G+ C  Q   C   P      C N G+C  +   +  C C PG+ G  C +      E       C +GG C   + GS  C C+   TG +C +P
Sbjct:   33 LATSSLRCSQPSGTCLNGGRCEVANGTEACVCSGPFVGQRCQD-PNPCLSTPCKNAGTCHVVEHGGTVNYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNP------CANGGQCLPF-ESSYICGCPPGFHGPTCRQDVN---ECSQNPGLCRHGGTCHN-EIGSYRCVCRATHTGPHCELP 234          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|Q01705|NOTC1_MOUSE (Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3)

HSP 1 Score: 197.208 bits (500), Expect = 1.983e-49
Identity = 237/1013 (23.40%), Postives = 383/1013 (37.81%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL----------------KETRKEALINIKIPKTFNEKQLII----------KKTKSPSLCDNL----CKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS---------------------RSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQ----------KLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVN--ENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGR----------------------TPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            CS  PC NG     +   F C C  G+ G  C E +N+C+  PC+NGGTCID  NS                                              +TC C   F+G  C+ + N CL+  C+  GT   ++    F C+CR G  G  C        VI   + + C N G C +  N      C+C  G+ G  C+          C S  C NGG C +    SP C C G FTG  C  P                 + T +        P  FN     I          +    P + +      C+    N +C+ QCN  AC +DGGDC     DPW+ C       C   F+DG C+ +CN+  CLFDG DC  +  + +      C + + +  CD+ CNS +C +DG DC                        R+NSF     L+       +++ D      +  +  ++ E  +            SS L          E++       ++ L ++  QCV    QCF S   ++ FL A    G+ L++P+++  V +  +      +L +  +   A      +     GVLL  K  +   ++     +  S              + G   L    D        N+  +G+   +T + R       PD     ++R+   + ++      A  L   ++  T     +DA   DV    +V+    +      S   G  E  N  E  ++   I+  +  GA++  Q +    + LH    + R                      TPL ++++ADA +   Q+L+  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1149 CSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCES------VINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDART-----CGSLRCLNGGTC-ISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGS-LNIPYKIEAVKSEPVEPPLPSQLHLMYV---AAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD--GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLSDQTDHRQWTQQHLD------AADLRMSAMAPTPPQGEVDADCMDV----NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADA-QGVFQILLRNRATDLDARMH-------------------DGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRL---PRDIAQERMHHDIVRLLDE 2105          

HSP 2 Score: 95.9005 bits (237), Expect = 2.188e-18
Identity = 81/276 (29.35%), Postives = 114/276 (41.30%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PCVNG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC    C+N G C ES +   F C C  G+ G+ C V    C   P +    C N        N +  C C  GYTG  C+   +      C+ + C NGG C    N +  C+C   F G  C   + E       N               P  FN    I  +  +P   ++ C   F  G C    N+F C
Sbjct:  752 INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNT-------NGSYRCLCQAGYTGRNCESDID-----DCRPNPCHNGGSCTDGIN-TAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNG---IHCENNTPDCTESSC---FNGGTCVDGINSFTC 1007          

HSP 3 Score: 95.5153 bits (236), Expect = 2.484e-18
Identity = 71/216 (32.87%), Postives = 100/216 (46.30%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C ++PC +G   +  D  + C C  G  G  CE N++DC  NPC + GTC+DK +  + C C   + G++C    + C    C NGGTCE    G F C+C  G+    C  +   C   P I          HG C    N    C C PG++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  607 CHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKIDG-YECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAG-FTCRCPEGYHDPTCLSEVNECNSNPCI----------HGACRDGLN-GYKCDCAPGWSGTNCDINNNE-----CESNPCVNGGTCKDMTSGY-VCTCREGFSGPNCQTNINECASNPCLN 802          

HSP 4 Score: 91.6633 bits (226), Expect = 3.731e-17
Identity = 72/215 (33.49%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC++G C +  +  ++C C  GW G  C+ N N+C  NPC NGGTC D   S + C C   F G  CQ   N C +  C N GTC     G ++C C   + G  C V    C   P      C N G C    +   F C C  G+ G  C+      V+I  C    C +G  C+   NGS  C C+  +TG+NC   + + R     N
Sbjct:  720 CNSNPCIHGACRDGLN-GYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMT-SGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG-YKCNCPLPYTGATCEVVLAPCATSP------CKNSGVCKESEDYESFSCVCPTGWQGQTCE------VDINECVKSPCRHGASCQNT-NGSYRCLCQAGYTGRNCESDIDDCRPNPCHN 918          

HSP 5 Score: 88.1965 bits (217), Expect = 5.371e-16
Identity = 68/209 (32.54%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF---ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  C    D    C+C  G+ G+ CEENV+DC  N CKNGG C+D  N+ + C C  ++ G  C     E   +   C+NGGTC +   G + C C  G+ GE C+     C      +   C++          + +C+C  G TG  C       +   C S+ C  G  C     NG  IC C   +TG  C+  + E
Sbjct:  222 CSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNT-YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG-YNCVCVNGWTGEDCSENIDDCASAACFQGATCHDR-------VASFYCECPHGRTGLLCH------LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDE 415          

HSP 6 Score: 85.5001 bits (210), Expect = 3.186e-15
Identity = 67/206 (32.52%), Postives = 89/206 (43.20%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAFDP----EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            S  C + PC N       D     ++ CSC  G+ G  C   + N C+ NPC+NGGTC     +++ C C   + G  CQ  +PC +  C NGG C   E+  + C+C  GF G  C      C   P   R     H E   Y      C C   +TG  C    ELP  + C    C NGG C+   + +  C C   F G+NC
Sbjct:   60 SNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFES-SYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSY-----RCACRATHTGPHC----ELPY-VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNC 254          

HSP 7 Score: 83.1889 bits (204), Expect = 1.623e-14
Identity = 57/168 (33.93%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRK 961
            C NGG C +  N    C C+  F+G  CQ  NPCL+  C+N GTC  +++G    + C C  GF G  C    + AC   P      C N G CD+       C+C PG++G  C +         C S+ C NGG C   ++ S IC C   F G  C   + E  +
Sbjct:   31 CLNGGRC-EVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANP------CRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADP------CASNPCANGGQCLPFES-SYICRCPPGFHGPTCRQDVNECSQ 184          

HSP 8 Score: 82.4185 bits (202), Expect = 2.671e-14
Identity = 65/201 (32.34%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC--IDKKNS-QFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C+NG   E  +    C C   + G+ C+++ N C+  PCKN GTC  +D   +  + C+C   F G LC    +N CL   C NGGTC+ L    ++C+C  G+ G+ C  Q   C   P      C N G+C  +   +  C+C PG+ G  C +      E       C +GG C   + GS  C C+   TG +C +P
Sbjct:   31 CLNGGRCEVANGTEACVCSGAFVGQRCQDS-NPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNP------CANGGQCLPF-ESSYICRCPPGFHGPTCRQDVN---ECSQNPGLCRHGGTCHN-EIGSYRCACRATHTGPHCELP 218          

HSP 9 Score: 71.633 bits (174), Expect = 5.899e-11
Identity = 66/241 (27.39%), Postives = 93/241 (38.59%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP----------------------------------------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC NG     F+  + C C  G+ G TC ++VN+C QNP                                        C+NGGTC    ++   C C   F G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P      C N G C    +    C C  G+TG+ C +  +      C S  CF G  C      S  CEC    TG  C +
Sbjct:  144 CASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNA----CQNGGTCHNT-HGGYNCVCVNGWTGEDCSENID-----DCASAACFQGATCHDR-VASFYCECPHGRTGLLCHL 372          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|Q07008|NOTC1_RAT (Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 4.316e-49
Identity = 236/1013 (23.30%), Postives = 385/1013 (38.01%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP----------------LKETRKEALINIKIPKTFNEKQLII----------KKTKSPSLCDNL----CKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS---------------------RSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQ---KLSSSLRMVVTVFNVT-------EINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVN--ENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGR----------------------TPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            CS  PC NG     +   F C C  G+ G  C E +N+C+  PC+NGGTCID  N+                                              +TC C   F+G  C+ + N CL+  C+  GT   ++    F C+CR G  G  C        VI   + + C N G C +  N      C+C  G+ G  C+          C S  C NGG C +    SP C C G FTG  C  P                 + T +        P  FN     I          +    P + +      C+    N +C+ QCN  AC +DGGDC     DPW+ C       C   F+DG C+ +CN+  CLFDG DC  +  + +      C + + +  CD+ CNS +C +DG DC                        R+NSF     L+       +++ D      +  +   + E  +   K S+      ++   T       E++       ++ L ++  QCV    QCF S   ++ FL A    G+ L++P+++  V +  +      +L +  +   A      +     GVLL  K  +   ++     +  S              + G   L    D        N+  +G+   +T + R       PD     ++R+   + ++      A  L   ++  T     +DA   DV    +V+    +      S   G  E  N  E  ++   I+  +  GA++  Q +    + LH    + R                      TPL ++++ADA +   Q+L+  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1149 CSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNTYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCES------VINGCRGKPCRNGGVCAVASNTARGFICRCPAGFEGATCENDART-----CGSLRCLNGGTC-ISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQEDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGREEELRKHPIKRSAVGWATTSLLPGTNGGRQRRELDPMDIHGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGS-LNIPYKIEAVKSETVEPPLPSQLHLMYV---AAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD--GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLD------AADLRVSAMAPTPPQGEVDADCMDV----NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADA-QGVFQILLRNRATDLDARMH-------------------DGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRL---PRDIAQERMHHDIVRLLDE 2105          

HSP 2 Score: 97.0561 bits (240), Expect = 9.980e-19
Identity = 80/276 (28.99%), Postives = 114/276 (41.30%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PCVNG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC    C+N G C ES +   F C C  G+ G+ C +    C   P +    C N        N +  C C  GYTG  C+   +      C+ + C NGG C    N +  C+C   F G  C   + E       N               P  FN    I  +  +P   ++ C   F  G C    N+F C
Sbjct:  752 INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNT-------NGSYRCLCQAGYTGRNCESDID-----DCRPNPCHNGGSCTDGVNAA-FCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPTGFNG---IHCENNTPDCTESSC---FNGGTCVDGINSFTC 1007          

HSP 3 Score: 91.6633 bits (226), Expect = 3.795e-17
Identity = 71/215 (33.02%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC++G C +  +  ++C C  GW G  C+ N N+C  NPC NGGTC D   S + C C   F G  CQ   N C +  C N GTC     G ++C C   + G  C V    C   P      C N G C    +   F C C  G+ G  C+      ++I  C    C +G  C+   NGS  C C+  +TG+NC   + + R     N
Sbjct:  720 CNSNPCIHGACRDGLN-GYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKD-MTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG-YKCNCPLPYTGATCEVVLAPCATSP------CKNSGVCKESEDYESFSCVCPTGWQGQTCE------IDINECVKSPCRHGASCQNT-NGSYRCLCQAGYTGRNCESDIDDCRPNPCHN 918          

HSP 4 Score: 88.1965 bits (217), Expect = 4.653e-16
Identity = 68/209 (32.54%), Postives = 97/209 (46.41%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  C    D    C+C  G+ G+ CEENV+DC  N CKNGG C+D  N+ + C C  ++ G  C  + + C  +   C+NGGTC +  +G + C C  G+ GE C+     C      +   C++          + +C+C  G TG  C       +   C S+ C  G  C     NG  IC C   +TG  C+  + E
Sbjct:  222 CSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNT-YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHN-SHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDR-------VASFYCECPHGRTGLLCH------LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDE 415          

HSP 5 Score: 85.8853 bits (211), Expect = 2.516e-15
Identity = 72/252 (28.57%), Postives = 98/252 (38.89%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN------------------------------------SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C   PC  G C +     F C C  G+ G  CE N+N+C   PC++GGTC D+ N                                      + C C   + G++C    + C    C NGGTCE    G F C+C  G+    C  +   C   P I          HG C    N    C C PG++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  570 CDPDPCHYGLCKDGVA-TFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNYYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAG-FTCRCPEGYHDPTCLSEVNECNSNPCI----------HGACRDGLN-GYKCDCAPGWSGTNCDINNNE-----CESNPCVNGGTCKDMTSGY-VCTCREGFSGPNCQTNINECASNPCLN 802          

HSP 6 Score: 83.1889 bits (204), Expect = 1.467e-14
Identity = 66/203 (32.51%), Postives = 87/203 (42.86%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDP----EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC N       D     ++ CSC  G+ G  C   + N C+ NPC+NGGTC     +++ C C   + G  CQ  +PC +  C NGG C   E+  + C C  GF G  C      C   P   R     H E   Y      C C   +TG  C    ELP  + C    C NGG C+   + +  C C   F G+NC
Sbjct:   63 CLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFES-SYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSY-----RCACRATHTGPHC----ELPY-VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNC 254          

HSP 7 Score: 80.1073 bits (196), Expect = 1.261e-13
Identity = 54/167 (32.34%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRK 961
            C NGG C +  N    C C+  F+G  CQ  +PCL+  C+N GTC  +++G    + C C  GF G  C       P+        C N G CD+       C+C PG++G  C +         C S+ C NGG C   ++ S IC C   F G  C   + E  +
Sbjct:   31 CLNGGRC-EVANGTEACVCSGAFVGQRCQDPSPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLT-----PLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADP------CASNPCANGGQCLPFES-SYICGCPPGFHGPTCRQDVNECSQ 184          

HSP 8 Score: 77.0258 bits (188), Expect = 1.083e-12
Identity = 64/201 (31.84%), Postives = 91/201 (45.27%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC--IDKKN-SQFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C+NG   E  +    C C   + G+ C++  + C+  PCKN GTC  +D      + C+C   F G LC     N CL   C NGGTC+ L    ++C+C  G+ G+ C  Q   C   P      C N G+C  +   +  C C PG+ G  C +      E       C +GG C   + GS  C C+   TG +C +P
Sbjct:   31 CLNGGRCEVANGTEACVCSGAFVGQRCQD-PSPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNP------CANGGQCLPF-ESSYICGCPPGFHGPTCRQDVN---ECSQNPGLCRHGGTCHN-EIGSYRCACRATHTGPHCELP 218          

HSP 9 Score: 72.0182 bits (175), Expect = 3.527e-11
Identity = 66/241 (27.39%), Postives = 93/241 (38.59%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP----------------------------------------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC NG     F+  + C C  G+ G TC ++VN+C QNP                                        C+NGGTC    ++   C C   F G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P      C N G C    +    C C  G+TG+ C +  +      C S  CF G  C      S  CEC    TG  C +
Sbjct:  144 CASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNA----CQNGGTCH-NSHGGYNCVCVNGWTGEDCSENID-----DCASAACFQGATCHDR-VASFYCECPHGRTGLLCHL 372          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|P21783|NOTC1_XENLA (Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3)

HSP 1 Score: 192.586 bits (488), Expect = 5.219e-48
Identity = 232/939 (24.71%), Postives = 389/939 (41.43%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT--CIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDN-LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLT--------KCSTQTKLYELDLVLMTT---------------------------MQNFTKYKSEFLQKLSSSLRMVVTV-FNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQEL-PIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPK-TDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHP-IDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYV-------NENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLI------LEKQLRKESKQNKVRSGINGI------NLGTPCEY-FVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIK--MDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            NGKC++     + C C  G+ GE CE +VN+C+ NPC + GT  CI   N  + C C   F G  C+   + C  + C NGGTC    N    F CKC  GF G  C   +  C  +       C N G C I    +  C C  GYTG  C    + PV   C S  C+NGG C+      P   C C   F G  C I          ++ + P    +    I    +  +C+N  C    +N +C+  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CNN  CL+DG DC K   + +      C + +Q+  CD+ CN+ +C +DG DC     N       L         K ++   L EL  VL T                            ++  T Y S+    + S+++  + +  +  E++       ++ L ++  QC     QCF+S   ++ FL A    G++ +L +++  V +  +   K   L P+ +M++  LL++F   + ++    R + G+L         W               G+    P   + +D   E  +  K I   +     D +++  GD+E     ++ N++ ++E      Q +  +L+ D  +        +DA    + +MA      + +      ++ G   +        +  G    +     ++ AN+I         + +  D  G T L  +      ++ ++LL       ++  + +      V +   G+      N  T  +      TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++ LFLAA EG+ ++ K LL ++    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1240 NGKCIDRVG-GYNCICPPGFVGERCEGDVNECLSNPCDSRGTQNCIQLVN-DYRCECRQGFTGRRCESVVDGCKGMPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDSRTCSNL------RCQNGGTC-ISVLTSSKCVCSEGYTGATC----QYPVISPCASHPCYNGGTCQFFAE-EPFFQCFCPKNFNGLFCHI----------LDYEFPGGLGKN---ITPPDNDDICENEQCSELADNKVCNANCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFNDGKCDSQCNNTGCLYDGFDCQKVEVQCNPLYDQYCKDHFQDGHCDQGCNNAECEWDGLDCANMPENLAEGTLVLVVLMPPERLKNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKRSTDYWSDAPSAIFSTMKESILLGRHRRELDEMEVRGSIVYLEIDNRQCYKSSSQCFNSATDVAAFLGALASLGSLDTLSYKIEAVKSENMETPKPSTLYPMLSMLVIPLLIIFVFMMVIVNKKRRREHGQL---------W------------FPDGFIPKEPSKKKRRDRLGEDSVGLKPIKNMTDGSFMDDNQNEWGDEE-----TLENKRFRFE-----EQVILPELVDDKTDPRQWTRQHLDAADLRISSMAPTPPQGEIEADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANMISDFIGQGAQLHNQTDRTGETALHLAARYARADAAKRLLESSADANVQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDARMFDGTTPLILAARLAVEGMVEELINAHADVNAVDEFGKSALHWAAAVNNVDAAAVLLKNSANK---DMQNNKEETSLFLAAREGSYETAKVLLDHYANRDITDHMD---RLPRDIAQERMHHDIVHLLDE 2112          

HSP 2 Score: 102.064 bits (253), Expect = 2.491e-20
Identity = 82/271 (30.26%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN---------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKR----ELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +N+F   C       K       C++ PC NG  C +  +  + C+C  G+ G  CE N  DC ++ C NGGTCID  N+ FTC C   F G+ CQ +       PCLN                                   C+NGG C    N  ++C+C+ G+ G +C V +++C V  K++      LC N G C +    T FC+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E
Sbjct:  925 INMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN-SYTCTCQPGFSGIHCESNTPDCTESSCFNGGTCIDGINT-FTCQCPPGFTGSYCQHDINECDSKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNN-FYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIVHLCRNSGMC-VDTGNTHFCRCQAGYTGSYCEEQVDE-----CSPNPCQNGATCTDYLGGYS-CECVAGYHGVNCSEEINE 1185          

HSP 3 Score: 102.064 bits (253), Expect = 3.129e-20
Identity = 88/264 (33.33%), Postives = 118/264 (44.70%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCD---NLCKAS--FENGICDQQCNTFAC 1111
            C + PC N   C++    EF+C C  G++G  CE N+++C  NPC + G CIDK N +F C+C + F GNLCQ + + C +  C+NG  C    N  + C+C  GF G  C      C  IP         +G C      T  C C PGYTG  CD          C S  C NGG C   +NG  IC C    TG NC   + +       N K     +  +   +   +  LC+   N C ++     G C  Q N F C
Sbjct:  455 CLSNPCQNDSTCLDQIG-EFQCICMPGYEGLYCETNIDECASNPCLHNGKCIDKIN-EFRCDCPTGFSGNLCQHDFDECTSTPCKNGAKCLDGPNS-YTCQCTEGFTGRHCEQDINEC--IPDPCH-----YGTCKDGI-ATFTCLCRPGYTGRLCDNDINE-----CLSKPCLNGGQCTDRENGY-ICTCPKGTTGVNCETKIDDCASNLCDNGKCIDKIDGYECTCEPGYTGKLCNININECDSNPCRNGGTCKDQINGFTC 701          

HSP 4 Score: 100.908 bits (250), Expect = 5.845e-20
Identity = 72/199 (36.18%), Postives = 94/199 (47.24%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C NRPC NG   +  +  ++C+C  G+ G  CE +++DC  NPC NGG+C D  N  F CNC + F G  C+ + N C +  C+NG  C    N  + C C+ GF G  C          P      C N G C I    T  C+C PG+TG  C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  872 CVNRPCRNGATCQNTNGSYKCNCKPGYTGRNCEMDIDDCQPNPCHNGGSCSDGIN-MFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNS-YTCTCQPGFSGIHCESN------TPDCTESSCFNGGTC-IDGINTFTCQCPPGFTGSYCQHDINE-----CDSKPCLNGGTCQD-SYGTYKCTCPQGYTGLNC 1055          

HSP 5 Score: 98.2117 bits (243), Expect = 3.974e-19
Identity = 69/211 (32.70%), Postives = 100/211 (47.39%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +++  C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G +C+    PC    C+NGG C ES +   F C+C  G+ G+ C +    C   P +    C N        N +  C C PGYTG  C    E+ ++  C+ + C NGG C    N    C C   F G  C   + E
Sbjct:  751 INNNECESNPCMNGGTCKDMTGAYICTCKAGFSGPNCQTNINECSSNPCLNHGTCIDDV-AGYKCNCMLPYTGAICEAVLAPCAGSPCKNGGRCKESEDFETFSCECPPGWQGQTCEIDMNECVNRPCRNGATCQNT-------NGSYKCNCKPGYTGRNC----EMDID-DCQPNPCHNGGSCSDGINMF-FCNCPAGFRGPKCEEDINE 947          

HSP 6 Score: 97.8265 bits (242), Expect = 5.076e-19
Identity = 71/210 (33.81%), Postives = 103/210 (49.05%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEA 967
            C++ PC NG     F+ ++ C C  G+ G TC++++N+C QNPCKNGG CI++  S + C C ++F G  C +   PC    C NGGTC   ++  + C C  GF G+ C      CP         C N G C    N T  C+C P +TG  C +  +   E     + C NGG C     G   C C   +TG++C+  + +    A
Sbjct:  145 CASNPCANGGKCLPFEIQYICKCPPGFHGATCKQDINECSQNPCKNGGQCINEFGS-YRCTCQNRFTGRNCDEPYVPCNPSPCLNGGTCRQTDDTSYDCTCLPGFSGQNCEENIDDCP------SNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVD---ECQLMPNACQNGGTCHNTYGGY-NCVCVNGWTGEDCSENIDDCANAA 342          

HSP 7 Score: 87.0409 bits (214), Expect = 9.856e-16
Identity = 78/243 (32.10%), Postives = 105/243 (43.21%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLN------VN--------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI-CECKGEFTGKNCTIPLKE 952
            C++  C NGKC++  D  + C+C  G+ G+ C  N+N+C  NPC+NGGTC D+ N  FTC C   +  ++C  E      NPC++      VN                          C NGGTC+ +  G + C C+ GF G  C      C   P      C NHG C I       C C   YTG  C+      V   C    C NGG CK  ++     CEC   + G+ C I + E
Sbjct:  644 CASNLCDNGKCIDKID-GYECTCEPGYTGKLCNININECDSNPCRNGGTCKDQING-FTCVCPDGYHDHMCLSEVNECNSNPCIHGACHDGVNGYKCDCEAGWSGSNCDINNNECESNPCMNGGTCKDM-TGAYICTCKAGFSGPNCQTNINECSSNP------CLNHGTC-IDDVAGYKCNCMLPYTGAICEA-----VLAPCAGSPCKNGGRCKESEDFETFSCECPPGWQGQTCEIDMNE 871          

HSP 8 Score: 85.5001 bits (210), Expect = 2.902e-15
Identity = 63/183 (34.43%), Postives = 86/183 (46.99%), Query Frame = 2
Query:  392 EFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            +F C C  G+  + C   V N C+ NPC+NGGTC +    +++ C C   + G+ CQ  +PC +  C NGG C   E   + CKC  GF G  C      C   P      C N G+C I    +  C C   +TG  CD+       + C    C NGG C+  D+ S  C C   F+G+NC
Sbjct:   84 DFICHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLNSVTEYKCRCPPGWTGDSCQQADPCASNPCANGGKCLPFEI-QYICKCPPGFHGATCKQDINECSQNP------CKNGGQC-INEFGSYRCTCQNRFTGRNCDEPY-----VPCNPSPCLNGGTCRQTDDTSYDCTCLPGFSGQNC 253          

HSP 9 Score: 74.3294 bits (181), Expect = 6.866e-12
Identity = 73/239 (30.54%), Postives = 108/239 (45.19%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL-CSNRP--CVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC---IDKKNSQFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            + + +L C L +++  L C+     C+NG +C         C C + + GE C+      I+N C N GTC   +      F C+C   F   +C    +N C+N  C NGGTCE L +   ++C+C  G+ G+ C  Q   C   P      C N G+C  +  +   CKC PG+ G  C +         C  + C NGG C + + GS  C C+  FTG+NC  P         +N
Sbjct:    4 IGLAVLLCSLPVLTQGLRCTQTAEMCLNGGRCEMTPGGTGVCLCGNLYFGERCQFPNPCTIKNQCMNFGTCEPVLQGNAIDFICHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLNSVTEYKCRCPPGWTGDSCQ-QADPCASNP------CANGGKCLPF-EIQYICKCPPGFHGATCKQDINE-----CSQNPCKNGGQC-INEFGSYRCTCQNRFTGRNCDEPYVPCNPSPCLN 228          
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Match: sp|P46531|NOTC1_HUMAN (Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4)

HSP 1 Score: 191.045 bits (484), Expect = 1.566e-47
Identity = 236/973 (24.25%), Postives = 378/973 (38.85%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP----------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL----------------KETRKEALINIKIPKTFNEKQLII---------KKTKSPSLCDNLC-----KASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLT---------KCSTQTKLYELDLVLMTTM----------QNFTKYKSE--------------------FLQKLSSSLRMVVTVFNVTEINFNF--ATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVN--ENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGI------NLGTPCEYFVKK-TTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C + PC NG         ++CSC  G +G  CE NV+DC  NP          C N GTC+D+    ++C C   F+G  C+ + N CL+  C+  GT   ++    F C+CR G  G  C        VI   K + C N G C +  N      CKC  G+ G  C+          C S  C NGG C +    SP C C G FTG  C  P                 + T +        P  FN     I          +   P L +  C     +    N +C  QCN  AC +DGGDC     DPW+ C       C   F+DG C+ +CN+  CLFDG DC ++  + +      C + + +  CD+ CNS +C +DG DC         +   +          + S+   L EL  VL T +            F  Y  E                     L ++ +SL    +         +       ++ L ++  QCV    QCF S   ++ FL A    G+ L++P+++  V +  +      +L    +   A      +     GVLL  K  +   ++     +  S              + G   L    D        N+  +G+   +T + R       PD     ++R+   + ++      A  L   ++  T     +DA   DV    +V+    +      S   G  E  N  E  ++   I+  +  GA++  Q +    + LH    + R+  A  +   + ++      ++  + +      V +   G+      N  T  +  +   TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N +++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1187 CLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDC--NPPVDPVSRSPKCFNNGTCVDQVGG-YSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCES------VINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDART-----CGSLRCLNGGTC-ISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNC--TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGS-LNIPYKIEAVQSETVEPPPPAQLHFMYV---AAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD--GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLD------AADLRMSAMAPTPPQGEVDADCMDV----NVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADAN-----IQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRL---PRDIAQERMHHDIVRLLDE 2115          

HSP 2 Score: 100.523 bits (249), Expect = 8.938e-20
Identity = 72/213 (33.80%), Postives = 102/213 (47.89%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CS++PC +G   +  D  + C C  G  G  CE N++DC  +PC + GTC+DK +  + C C   + G++C    + C    C NGGTCE   NG F C+C  G+    C  +   C   P         HG C    N    C CDPG++G  CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  607 CSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDS-GTCLDKIDG-YECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGING-FTCRCPEGYHDPTCLSEVNECNSNPCV-------HGACRDSLN-GYKCDCDPGWSGTNCDINNNE-----CESNPCVNGGTCKDMTSGY-VCTCREGFSGPNCQTNINECASNPCLN 802          

HSP 3 Score: 95.5153 bits (236), Expect = 2.897e-18
Identity = 69/220 (31.36%), Postives = 98/220 (44.55%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +++  C + PCVNG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC    C NGG C   E+   F C C  G+ G+ C V    C + P +    C N HG           C C  GY+G  C+   +      C+ + C NGG C    N +  C+C   F G  C   + E   +   N
Sbjct:  752 INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHG--------GYRCHCQAGYSGRNCETDID-----DCRPNPCHNGGSCTDGIN-TAFCDCLPGFRGTFCEEDINECASDPCRN 956          

HSP 4 Score: 89.7373 bits (221), Expect = 1.454e-16
Identity = 71/215 (33.02%), Postives = 98/215 (45.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PCV+G C ++ +  ++C C  GW G  C+ N N+C  NPC NGGTC D   S + C C   F G  CQ   N C +  C N GTC     G ++C C   + G  C V    C   P      C N GEC    +   F C C  G+ G  C+      V+I  C    C +G  C+    G   C C+  ++G+NC   + + R     N
Sbjct:  720 CNSNPCVHGACRDSLN-GYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKD-MTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAG-YKCNCLLPYTGATCEVVLAPCAPSP------CRNGGECRQSEDYESFSCVCPTGWQGQTCE------VDINECVLSPCRHGASCQNTHGGY-RCHCQAGYSGRNCETDIDDCRPNPCHN 918          

HSP 5 Score: 86.6557 bits (213), Expect = 1.240e-15
Identity = 68/201 (33.83%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC--IDKKN-SQFTCNCTSQFIGNLC--QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C+NG   EA +    C C   + G  C++  N C+  PCKN GTC  +D++  + + C+C   F G LC    +N CL   C NGGTC+ L    ++C+C  G+ G+ C  Q   C   P      C N G+C  +   +  C C P + G  C +      E G K   C +GG C   + GS  C C+   TG NC  P
Sbjct:   31 CLNGGKCEAANGTEACVCGGAFVGPRCQD-PNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNP------CANGGQCLPF-EASYICHCPPSFHGPTCRQDVN---ECGQKPGLCRHGGTCHN-EVGSYRCVCRATHTGPNCERP 218          

HSP 6 Score: 85.8853 bits (211), Expect = 2.277e-15
Identity = 67/209 (32.06%), Postives = 95/209 (45.45%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  C    D    C+C  G+ G+ CEEN++DC  N CKNGG C+D  N+ + C C  ++ G  C  + + C  +   C+NGGTC +   G + C C  G+ GE C+     C          C++          + +C+C  G TG  C       +   C S+ C  G  C     NG  IC C   +TG  C+  + E
Sbjct:  222 CSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNT-YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG-YNCVCVNGWTGEDCSENIDDCASAACFHGATCHDR-------VASFYCECPHGRTGLLCH------LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDE 415          

HSP 7 Score: 81.2629 bits (199), Expect = 5.387e-14
Identity = 68/211 (32.23%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLK 949
            C++ PC +G C++  D  + C+C  G+ G  C  N+++C  NPC NGGTC D  N  FTC C   +    C  E      NPC++      G C    NG ++C C  G+ G  C + N  C   P      C N G C    +MT    C C  G++G  C           C S+ C N G C + D     C C   +TG  C + L 
Sbjct:  645 CASSPCDSGTCLDKID-GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGING-FTCRCPEGYHDPTCLSEVNECNSNPCVH------GACRDSLNG-YKCDCDPGWSGTNCDINNNECESNP------CVNGGTCK---DMTSGYVCTCREGFSGPNCQTNINE-----CASNPCLNQGTC-IDDVAGYKCNCLLPYTGATCEVVLA 831          

HSP 8 Score: 81.2629 bits (199), Expect = 5.714e-14
Identity = 63/203 (31.03%), Postives = 88/203 (43.35%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFD----PEFRCSCWHGWKGETCEENV-NDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PC N       D     ++ CSC  G+ G  C   + N C+ NPC+NGGTC     +++ C C   + G  CQ  +PC +  C NGG C   E   + C C   F G  C      C     +K  LC + G C      +  C C   +TG  C++       + C    C NGG C+   + +  C C   FTG+NC
Sbjct:   63 CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFE-ASYICHCPPSFHGPTCRQDVNEC----GQKPGLCRHGGTCHNEVG-SYRCVCRATHTGPNCERPY-----VPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNC 254          

HSP 9 Score: 79.337 bits (194), Expect = 2.077e-13
Identity = 56/165 (33.94%), Postives = 72/165 (43.64%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLEN---GMFQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C NGG C +  N    C C   F+G  CQ  NPCL+  C+N GTC  ++      + C C  GF G  C    + AC   P      C N G CD+       C+C PG++G  C +         C S+ C NGG C   +  S IC C   F G  C   + E
Sbjct:   31 CLNGGKC-EAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNP------CRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADP------CASNPCANGGQCLPFE-ASYICHCPPSFHGPTCRQDVNE 181          

HSP 10 Score: 66.2402 bits (160), Expect = 2.198e-9
Identity = 56/183 (30.60%), Postives = 77/183 (42.08%), Query Frame = 2
Query:  395 FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            +RC C     G  CE     C  +PC+NGGTC    +    C C   F G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P      C N G C    +    C C  G+TG+ C +  +      C S  CF+G  C      S  CEC    TG  C +
Sbjct:  202 YRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNA----CQNGGTCHNT-HGGYNCVCVNGWTGEDCSENID-----DCASAACFHGATCHDR-VASFYCECPHGRTGLLCHL 372          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A158QVN9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8230 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.460e-68
Identity = 262/1051 (24.93%), Postives = 434/1051 (41.29%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEA-------FDPE----FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNM----------------TLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKA------SFENGICDQQCNTFAC--NYDGGDCDPWRKC-------YGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDC-------------------------HKSSCKFH-KCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVV--TVFNVTE----INFNFATALLIKLHVNYTQCVLYG--GQCFSSLEQISNFLKAGIEKGNV-LSLPFRLARVDTRIISASKKQELPIYT-----MXXXXXXXXXXXXXXXXG---------VLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQL--KDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRK----------------YETIN-RNH-QALAFQLISDSLEST----DGIHPIDAGL---------GDVYTMASVK-----NHMKYD-----------EKYQTSSLEGLGEYVNE--------------NGESLMHIAARMNSGANIIKQI------------NAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQL----RKESKQNKVRSGINGINLGTPC-------------EYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C  +PC NG  C E        ++P+    + C C  GW+G  C  NV+DC  NPC+NGG C DK N+QF C+C   FIG  C++ +PCL+  C+N G C+S   G++QC C   + G+ C    I C    +     C N G C++   +                   C C+PG+TG  CD++ ++     C    C NG  C  + N    C+C   F G  C  P++ +         IP   N      KK ++ +  D  C+       +  NG C  +C    C        C  W  C       +G   + C   + DGVC+ EC    C +DG DC                         ++SSC     C+ +Y + +C  ECN P CGFDGGDC T    S              +   + LVL T    +   +   L +++ +LR VV   V   T+    ++ +    + I L ++          G+ + S++  ++ LKA ++  +V L LP     V     S    +  P+       +     + L+ +   L G         V+ R  W + R +++T G+W+P S +  S+     G     P+ P +   D     Q  +K +   +  + +   H  G +   +P +  + + +                ++TI+ R H Q  A   ++  L ST    DG+HP+              + +++AS +     +H+K               + T +  G+G   ++              NGE+++H+AARMN GA  I+++            ++     L  LD+ GR+PL +S A D  E+T  L  LE++     R  +    V         G                    +++T L+ ++K    E+  LLLDEG  +  +D  GR++VHW+A+ N + LL R+SH K F ++ + +D+ D++PL LA  E ++++ + LL +     +  D     P   A+ +GF  +  L+ E
Sbjct:   58 CDAQPCKNGASCRERDVPQSIYYEPQNRLPYECDCQFGWEGVNCTINVDDCKGNPCQNGGRCEDKPNAQFVCHCRDGFIGQKCEYRDPCLDSPCQNNGRCDSSPLGVYQCICPRWYEGQNCEKAKIPC----ESTHNQCRN-GTCEVLYELFETRVQSQPKTASRISGFRCNCNPGWTGVFCDRELDV-----CLHHECQNGAKCVGVGNHY-QCQCPEGFDGLLCEQPIRAS---------IPNQSN------KKREAQNGLDEKCQVLGCANLTATNGTCLGRCIQAGCFNQEQLNACRAWIDCLEATKSDFGPGQRSCVERYRDGVCDHECAISSCFYDGFDCTDAGNQNWSSPNMDINRRMSTFTPPNRSSCPTEDHCTAVYGDGVCHPECNFPTCGFDGGDCLTPLDPSTPPR------IDNVRTGYIALVLNTDRNTYITLEKTVLSRVAEALRAVVRPAVDEKTQQPVIVDMDGGLRIRITLTIDLLPEGFQANAGEAYESIDLAAHTLKAALDTKSVDLPLPVAQLWVAKDPHSPPPGETTPVTPGGLPFLRSKDAIGLYIVLCVLSGAVIILLVFIVIQRRPWKQARKRVRTHGIWSPPSFFFHSSG----GGGSAHPRAPPVLSTDPGILLQQGHKTVPKTAASQLEDLLHPGGKRPRYSPPTTESYEEEACGLLHQESHTGGYTTHQTIDPRPHRQTDAATAVTKELTSTIRGSDGLHPLSPEALSKLEVVIRDNQHSLASPQLYVHPHHLKRSFSTVEASEFESPVFVTGAGRGIGAATDKLQHQDSFVTTRNPLNGETILHLAARMNVGARAIRRLCGTLVAEDGAPASSEKTLALLCLDKDGRSPLTASAATDGLETTTALYRLEREAITCSRSAASAQSVPPTSTSEGGGATSNEKPSTEARRRARHVESRRSTPLMVSLKAGCTEVTKLLLDEGCSIQGVDETGRNLVHWAAVLNAASLLTRISHTKGFSRMLEARDDCDRTPLLLAVRENSLEAAQILLEHQAIIDV-FDYTDSSPISEAKARGFTRMLALLME 1071          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: V4BGJ2 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_184955 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.272e-56
Identity = 262/997 (26.28%), Postives = 413/997 (41.42%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDK---------------------------------------KNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC--KVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNL-CKASFENGICDQQCNTFACNYDGGDCD----PWRKCYG-NDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQ--------NKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTM--QNFTKYKSEFLQKLSSSLRMVVTVF------------------NVTE-INFNFATALLIKLHVNYTQCVLYG-GQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGD---QEPDNPISINNRKRKYETINRNHQALAFQLISDSLEST--------------------DGIHPIDA------GLGDV--YTMASVK-NHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLH----------------------SLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLI 2935
            C+N+PC N G C +  D +F+CSC  G  G  CE N NDC  N C +GGTC+DK                                        ++ + C C + F G LC+    C    C+NGGTC + ++G  +C C  G+ G++C  Q+  C   P      C N G C    +   FC C  G +G  C    E+     C S  C N G C  K+   G   C C   +TG +C    +     A+  I  P T  +  L +   K   LC+   C+A   NG CD +CN  AC+YD  +C     PW++C G  D   C  VF DG CNP+CNN +CL+DG DC     K  +C+ +Y         N  CD+ C++ +C +DG DC  S                  +L E  LV++  +  + F     EFL+KL   LR VV V                   +V++ I         + L ++   C  Y   +CF + +  + F+ A +++ N   L   + ++++  +      + P  T +   +     + ITL+ +++      +  K + A  W P   ++   S      N   P   ++KD +K          G    + D+    HGD    E ++P +   R+R  E  + + Q+L    I DS + T                     G  PID       G G +    +AS++ N +      ++ S EG      E+  +   I   +  GA+I  Q +    + LH                      +LD  GRTPL +++AADA +   Q+L+  +     +K                       TT LI A +L  ++M+  L++  + +N  D+ G++ +HWSA  NN    E L      +   D +DN+D++PLFLAA EG+ ++ K LL ++    I     C  P+ +A+E+  ++I  L+
Sbjct:  905 CANQPCANNGVCHDLVD-DFKCSCPAGTLGLLCEINSNDCFDNACYHGGTCVDKIGHYECKCPPGFAGPRCEGDVNECSSNPCSALGTQDCVQLDNDYRCQCKAGFSGRLCENRIQCSEAPCKNGGTCTNTDSGP-KCSCLKGYSGDYCEFQSADCDSSP------CQNDGTCRPTQD-GYFCLCPAGASGINC----EIDEMDECLSSPCKNDGTCHDKI---GYYECYCPRYYTGIHC----QNYDVNAVPGIGRPVTM-KPSLNLNPDKE--LCEQYGCEAKANNGKCDNECNMHACDYDNKECSYGMKPWKECSGMRDGVFCWKVFKDGTCNPQCNNEECLYDGFDCQT---KLKECNPIYDSYCKKYYGNGHCDQGCDTEECEWDGLDCDKSPE----------------RLAEGTLVIIVLVEPEAFRNMSKEFLRKLGHLLRAVVRVLKDKNGSPMIYPWQQKEGDDVSDVIRVKRWAETKVYLEIDNRGCYKYSTDECFDNTDNAAQFVAAALQR-NDADLGMPVGKIES--LGKEPTVDSPAITFVYIVVACGAILLITLVVIIV------ISRKRERAVTWFPEGFFNKRGSEKAGVRNRRGPDGEEMKDVQK----------GSHHSQLDKMDDRHGDWGEDEEEHPKA--KRQRIDEQGDSSDQSLVNFEIQDSRQWTQKHMEAANVTNPSILTLTPPQGDDPIDTKDINARGPGGMTPLMLASLRGNTLDTSCDDESGSAEG----NEEDNRAADVINNLLFQGASINLQTDRTGETSLHLAARYARADAAKVLLDAGADCNALDSTGRTPLHTAVAADA-QGVFQILLRNRSTNLNAK-------------------MYDGTTPLILAARLAIEDMVEDLINADADINAFDNNGKTALHWSAAVNNVEATESLLERNANR---DAQDNKDETPLFLAAREGSFEAAKALLNHYANREITDHLECL-PREVADERHHHDIVQLL 1810          

HSP 2 Score: 101.293 bits (251), Expect = 1.355e-17
Identity = 73/211 (34.60%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCK------SDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C++ PC++G     +   + C+C  G+ G  CE N NDC ++ C N G CID  N+ FTC C   F G++CQ   NPC    C N GTC +  NG + C C YGF G  C      C      K   C N G C+ + N    C C   +TG++CD ++ +P            S  C NGG+CK L   +  C C+  + G  C   + E
Sbjct:  666 CASNPCMHGSTCTDYVNSYTCTCRLGFSGVHCEVNDNDCTKSSCLNDGKCIDGVNN-FTCQCKGGFTGSICQTRINPCDTNPCMNAGTCFN-HNGNYYCNCPYGFQGTHCERVQDWC------KNNPCQNSGTCEQFAN-NFRCTCTSDWTGEKCDIRR-VPCNSAAALKGVDVSKLCRNGGICKNLGGTTHECICQAGYEGSYCEREINE 866          

HSP 3 Score: 94.3597 bits (233), Expect = 1.695e-15
Identity = 108/360 (30.00%), Postives = 147/360 (40.83%), Query Frame = 2
Query:  317 LVIVSSKLCSNRP--CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICD---QQCNTFACNYDGGDCDPWRKCYGNDLK------HCKGVFNDGVCNPECNNVDC----LFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDG 1345
            L  +    C   P  C NG      +  F C C +GW G  C EN++DC  NPC NGG C D+    F C C     G  C  ++ C +  C  G +CE+   +G   C C+ G+ G+ C+     C    +     C + G C   P  +  C C  G+TG  C+      V I  C S+ C N G C + + G+  C C   FTG+NC +   E      IN  +       Q ++ K K        C A FE   C     +C TF C  +GG C+     Y    K      HC+   ++      C  VDC      DG D +  SC       L Q  I  +EC+S  C F G
Sbjct:    5 LCQIDVDECETTPFICQNGGTCMNHNDGFMCICVNGWTGSDCSENIDDCKNNPCFNGGNCEDRV-GYFYCKCPRGKTGMRCHLDDACESNPCNAGASCETSPIDGSPICTCKRGWTGDTCSRDVDEC---TESADTPCEHGGTCINTPG-SYKCDCAVGFTGPWCE------VNINECSSNPCINDGTC-LDEKGAYRCLCMPGFTGRNCEVEYDECGSNPCINGGV------CQDLVNKFKC------TCPAGFEGPTCAVNIDECETFPC-LNGGTCNDQINTYTCTCKTGYSGVHCQENVDN------CRKVDCGHGTCVDGLDTYTCSCLPGYTGLLCQYDI--DECSSNPCKFGG 331          

HSP 4 Score: 93.5893 bits (231), Expect = 3.306e-15
Identity = 77/231 (33.33%), Postives = 102/231 (44.16%), Query Frame = 2
Query:  314 LLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNE 1003
            LL       CS+ PC  G      D  + C C +G  G+ CE+N N+C+ NPC NG TCID  N ++ C C   + G  C+ + + C +  C NGG C  L N  F+C+C  G+    C      C   P      C N+G C    N    C C  GY G RC           C S+ C +GG C    N S  C+CK  F GKNC   + E      ++ +     NE
Sbjct:  313 LLCQYDIDECSSNPCKFGGTCSNLDNSYECRCPYGTSGQNCEKNYNECVSNPCHNGATCIDGIN-RYNCKCKPGYEGTHCELDIDDCASQPCHNGGKCTDLIN-KFKCECPAGYYDAECRSNVNECGSNP------CMNYGTCVDGVNK-FECLCLDGYGGHRCQNDIN-----DCVSNPCQHGGTCNDHLN-SYSCDCKPGFEGKNCDKNINECASNPCVHGECVDLANE 528          

HSP 5 Score: 89.7373 bits (221), Expect = 4.699e-14
Identity = 108/387 (27.91%), Postives = 160/387 (41.34%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINI-KIPKTFNEKQLIIKKTKSPSLCDNLCKASFEN-----GICDQQCNTFACN----YDGGDCDP-WRKCYGNDLKH--CKGVFND--GVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDG 1345
            C + PC+NG   +    +F+C+C  G++G TC  N+++C   PC NGGTC D+ N+                                     +TC+C   + G LCQ++ + C +  C+ GGTC +L+N  ++C+C YG  G+ C      C   P      C+N   C I       CKC PGY G  C    EL ++  C S  C NGG C  L N    CEC   +    C   + E      +N        N+ + +         C N       N     G C+   N+++C+    ++G +CD    +C  N   H  C  + N+    CNP  +  +C  +   CH S C+ H    +  N   D EC  P  GF G
Sbjct:  209 CGSNPCINGGVCQDLVNKFKCTCPAGFEGPTCAVNIDECETFPCLNGGTCNDQINTYTCTCKTGYSGVHCQENVDNCRKVDCGHGTCVDGLDTYTCSCLPGYTGLLCQYDIDECSSNPCKFGGTCSNLDN-SYECRCPYGTSGQNCEKNYNECVSNP------CHNGATC-IDGINRYNCKCKPGYEGTHC----ELDID-DCASQPCHNGGKCTDLINKFK-CECPAGYYDAECRSNVNECGSNPCMNYGTCVDGVNKFECLCLDGYGGHRCQNDINDCVSNPCQHGGTCNDHLNSYSCDCKPGFEGKNCDKNINECASNPCVHGECVDLANEYHCNCNPPYSGKNCEQELNPCHPSPCQNHA-QCVPTNNYKDFECRCPT-GFTG 579          

HSP 6 Score: 88.9669 bits (219), Expect = 6.932e-14
Identity = 70/199 (35.18%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  344 SNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            S  PC NG      +  F+C C  G++G+ CE N +DC  NPC NGGTC+D+    ++C C   F G  CQ + + C +  C +G TC    N  + C CR GF G  C V +  C       +  C N G+C D   N T  C+C  G+TG  C  +        C ++ C N G C    NG+  C C   F G +C
Sbjct:  591 SGSPCRNGAQCVNKNGSFKCICLRGYEGKRCEVNHDDCAPNPCINGGTCVDEIGG-YSCRCVDGFGGQHCQNDIDECASNPCMHGSTCTDYVN-SYTCTCRLGFSGVHCEVNDNDC------TKSSCLNDGKCIDGVNNFT--CQCKGGFTGSICQTRINP-----CDTNPCMNAGTC-FNHNGNYYCNCPYGFQGTHC 773          

HSP 7 Score: 85.1149 bits (209), Expect = 1.227e-12
Identity = 65/200 (32.50%), Postives = 95/200 (47.50%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECD-IYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C++ PC NG   +     + C C  G++G+ CE N++DC   PC N G C D  +  F C+C +  +G LC+   N C +  C +GGTC   + G ++CKC  GF G  C      C   P      C+  G  D +  +    C+C  G++G  C+ +      I C    C NGG C   D+G P C C   ++G  C
Sbjct:  867 CASAPCKNGATCKDLVNHYTCQCMTGFQGQNCEYNIDDCANQPCANNGVCHDLVD-DFKCSCPAGTLGLLCEINSNDCFDNACYHGGTCVD-KIGHYECKCPPGFAGPRCEGDVNECSSNP------CSALGTQDCVQLDNDYRCQCKAGFSGRLCENR------IQCSEAPCKNGGTCTNTDSG-PKCSCLKGYSGDYC 1051          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A3B3BFS6 (Notch receptor 2 OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 2.949e-56
Identity = 242/954 (25.37%), Postives = 409/954 (42.87%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTG------KNCTIP-------LKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC-DNLCKASFENGICDQQCNTFACNYDGGDCD-----PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHK---SSCKFHK-CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLV-LMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATA-------------LLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDN----------PISINN--RKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYT---MASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLH----------------------SLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C +RPC+NG +C+   +  F CSC  G  G  CE N +DC   P      C NGG C+D    ++TC+C   F+G  C+ + N C +  C   GT + +E    ++C CR G+ G  C      C   P      C N G C +  +      C C PGYTG  C + +       C    C NGG C +  NG P+C+C   F+G      + C++        +K+       + + P  F+      + + SP  C D  C+    + +CD QCN   C +DGGDC      PW  C  +    C  +F +G C+ ECNN  CLFD  +C +   S C++ K C + Y N ICD  C    CG+DG DC  + +    +   +     Q K    DL   + ++    +   + +++  ++  MV   + V + +   A A              L+ L ++  +C      CFS  E++++F+ A   K +   LP+ L  V + +I    ++  P Y M L  + +   +      ++L      ++ K K   +W P     ++          G      +K+FK   Q    +  G+SQ         H D+ P            P++++    +R++   +R    ++     D L++  G   ++    D +T   +AS++N    D        E  G+   E G S+  I+  +  GA+++ Q +    + LH                      + D  GRTPL +++AADA +   Q+LI  +    +++ N                     TT LI A +L  + M+  L+   + +N +D  G+S +HW+A  NN   +E    +       D++DN++++PLFLAA EG+ ++ + LL +++   I   MD     P+  A+E+  ++I  L+ +
Sbjct: 1197 CHSRPCLNGGRCINLIN-RFTCSCPPGTHGVQCEVNEDDCAPQPGSSEPRCLNGGQCVDGV-GRYTCSCPPGFVGEHCEGDVNECRSAPCHGPGTLDCVELVNDYRCLCRLGYTGRHCESMVNLCVSKP------CRNGGVCSMNSSSVRGYTCSCPPGYTGSTCAELQNH----SCGGLRCLNGGSC-LHHNGQPLCQCPPGFSGPLCENEQRCSVTCHNGGTCVKDPANPFQHSCRCPPLFSGHFCEKRASLSPPTCPDPQCEHLSGDKVCDNQCNNHQCQWDGGDCSLSCLQPWVNCTAS--VPCWDLFQNGRCDQECNNAACLFDSFECQQAPPSVCEYDKYCKDHYGNGICDHSCYDEACGWDGLDCSDNITPELATGTLIIVVRLQPKELLDDLRGFLRSLGGLLRTNVQ-VKRNDNNQPMVFPYYGVIDKHGQQAQASRRRREVEKEVIGSLVHLDIDNRECSRTSSHCFSHAEKVASFIAAAHIKKS--ELPYPLVSVTSEVI----EEPEPTYLMYLVGVGVAVVL------LILVLGMLAVKRKHKHGALWLPEGFIVSNDKRREP---VGQDDF-DMKNFK--LQDGGLMDGGQSQ-------RWHEDEAPPKKSRTEDKPLLPLALDGGVDQREWTLQHRKAADISHTPPQDDLDA--GCLDVNVKGPDGFTPLMVASLRNGGGLDCSVHAEEEEESGD---EPGPSI--ISDLIAQGASLMAQTDRTGETALHLAARYARADAAKRLLDAGADPNAHDNMGRTPLHAAVAADA-QGVFQILIRNRATELDARMN-------------------DGTTPLILAARLAVEGMVEELIHCHADINAVDDHGKSALHWAAAVNN---VEATLVLLKNGANRDMQDNKEETPLFLAAREGSFEAAQVLLDHYSNRDITDHMDRL---PRDTAQERMHHDIVRLLDQ 2076          

HSP 2 Score: 111.309 bits (277), Expect = 1.238e-20
Identity = 74/222 (33.33%), Postives = 112/222 (50.45%), Query Frame = 2
Query:  317 LVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            L +  +  C+ +PCV+G CVE     +RC C  GW G  CE+  ++C  NPC+NGG C+D+ N  +TC C   F GN C+   + C +  C N G C    N  + C+C   + G+ C V+   C   P      C + G C    + T F C+C  G+ G RC +  +      C SD C N G+C+    GS IC+C+  ++G+NC   + + +    +N
Sbjct:  722 LCLSGTDHCARQPCVHGDCVEQ-QLGYRCECEAGWVGAHCEQEKDECQPNPCQNGGNCLDRHNG-YTCQCQPGFTGNNCEKNRDECASSPCLNRGVCIDGVN-SYTCRCSPPYTGKHCEVEQAPCASHP------CKSGGVCLPSADYTSFTCRCPTGWQGARCSEDVDE-----CLSDPCRNDGLCENR-RGSYICKCQRGYSGQNCQTDIDDCKPNPCLN 928          

HSP 3 Score: 103.99 bits (258), Expect = 2.293e-18
Identity = 81/255 (31.76%), Postives = 113/255 (44.31%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE---------------------------------------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC NG     +   F C+C  G++G  CE N+ +C ++ C N GTC+D  NS F+C C   F+G  C++E                                       N C  V+C NGGTC S     + C+C+ G+ G +C V N++C     +K      +C N G+C    N +  C C PGYTG  C    E PV+  C S+ C NG  CK    G+  C CK  F G NC   + E      +N
Sbjct:  959 CASNPCRNGATCHDYVNSFVCACREGFRGIQCEHNIPECTESSCLNNGTCVDGINS-FSCRCPLGFLGLFCEYESNECDSQPCKNGGSCTDGLRTYSCVCPVGYSGSNCQNYVNVCKGVHCLNGGTC-SQSTTSWVCRCQAGWTGLYCDVPNMSCQNFAARKGVDVENVCKNAGQCKNVGN-SHQCICQPGYTGSYC----EDPVDE-CLSNPCRNGATCKDY-QGNYQCTCKPGFQGVNCEYDVDECHSRPCLN 1204          

HSP 4 Score: 95.5153 bits (236), Expect = 8.322e-16
Identity = 68/209 (32.54%), Postives = 95/209 (45.45%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDN-GSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C NG         + C C +GW G  C EN+NDC++  C+ G TCID+  S F C C     G LC   + C++  C +G  C++    G F C C  G++G  C +    C +        C + G+C +  + +  C C  GYTG RC++         C S  C N G C  LD  G   C C   FTG +C I + E      +N
Sbjct:  316 CQNGGTCHNGIGSYNCVCVNGWSGVDCSENLNDCLEASCREGSTCIDRVAS-FICLCPRGKTGLLCHLTDACMSNPCRDGSQCDTNPITGNFNCNCPPGYVGNTCNIDRNECSI----GTNPCEHGGQC-VNTDGSFTCNCAKGYTGPRCEQDVNE-----CASSPCQNDGTC--LDRIGEYSCICMSGFTGSHCEIEVDECLSSPCLN 511          

HSP 5 Score: 94.7449 bits (234), Expect = 1.581e-15
Identity = 82/267 (30.71%), Postives = 120/267 (44.94%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINI-KIPKTFNEKQLIIKKTKSPSLC----DNLCKASFENGICDQQCNTFAC----NYDGGDCD 1135
            G+CV   D  F C+C  G+ G  CE++VN+C  +PC+N GTC+D+   +++C C S F G+ C+ E + CL+  C N G C   +   F C+C  GF GE C +    C   P      C N  +C   PN    C+C  G+TG  C +  +      C    C +G         +  CEC+  +TG  C I ++E       N  +     N  Q   +   S S C    D+   +  E+G C    N++ C     Y G  CD
Sbjct:  437 GQCVNT-DGSFTCNCAKGYTGPRCEQDVNECASSPCQNDGTCLDRI-GEYSCICMSGFTGSHCEIEVDECLSSPCLNQGKCLD-QVSHFVCECPAGFSGEVCQIDIDECSSTP------CLNGAKCIDRPN-GYDCECAEGFTGLLCQENIDDCTPAPCHYGVCHDG-------IATFFCECESGYTGSICNIQVQECHSNPCQNQGRCIDLVNAYQCNCQPGTSGSNCEINEDDCANSPCEHGECQDGINSYRCVCSPGYTGSKCD 686          

HSP 6 Score: 94.3597 bits (233), Expect = 1.920e-15
Identity = 63/180 (35.00%), Postives = 79/180 (43.89%), Query Frame = 2
Query:  401 CSCWHGWKGETCEENVNDCI--QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C+C  G+ G+ C+   N      NPC NGGTC      ++ C CT  + G  C+ E+ CL+  C NGG C S   G + C C  G+ G  C +    C   P     LC N GEC   P  +  C C  G+TG  C+        I C    C NGG C      S  C C   F G NC
Sbjct:   95 CTCPLGYTGQRCQTPQNSTCYPNNPCANGGTCTLLSLDKYKCECTRGWTGPHCEHEDSCLSDPCANGGRCSSQSGGRYTCHCPPGYKGPRCLIDRDECAETPS----LCQNDGECFNTPG-SYKCVCKAGFTGRLCESSY-----IPCSPSPCLNGGTCHQTSETSYSCHCLPGFNGTNC 264          

HSP 7 Score: 94.3597 bits (233), Expect = 2.019e-15
Identity = 68/202 (33.66%), Postives = 101/202 (50.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C+N PC +G+C +  +  +RC C  G+ G  C+  +N+C  NPC +GGTC+D+ N  F C C     G LC    + C    C +G   E  +   ++C+C  G++G  C  +   C   P      C N G C D +   T  C+C PG+TG+ C+K ++      C S  C N GVC +    S  C C   +TGK+C +
Sbjct:  655 CANSPCEHGECQDGIN-SYRCVCSPGYTGSKCDVEINECGSNPCMSGGTCMDQVNG-FYCLCPPNTHGPLCLSGTDHCARQPCVHGDCVE--QQLGYRCECEAGWVGAHCEQEKDECQPNP------CQNGGNCLDRHNGYT--CQCQPGFTGNNCEKNRDE-----CASSPCLNRGVC-IDGVNSYTCRCSPPYTGKHCEV 838          

HSP 8 Score: 92.8189 bits (229), Expect = 6.051e-15
Identity = 68/211 (32.23%), Postives = 94/211 (44.55%), Query Frame = 2
Query:  347 NRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF------ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETR 958
            N PC NG  C      +++C C  GW G  CE   + C+ +PC NGG C  +   ++TC+C   + G  C        E P L   C+N G C +   G ++C C+ GF G  C    I C   P      C N G C      +  C C PG+ G  C+   +      C    C NGG C    N +  C+C  E+TG++CT  + E R
Sbjct:  117 NNPCANGGTCTLLSLDKYKCECTRGWTGPHCEHE-DSCLSDPCANGGRCSSQSGGRYTCHCPPGYKGPRCLIDRDECAETPSL---CQNDGECFNTP-GSYKCVCKAGFTGRLCESSYIPCSPSP------CLNGGTCHQTSETSYSCHCLPGFNGTNCENNID-----DCPEHQCANGGTCMDGVN-TYNCQCPPEWTGQHCTEDVDECR 310          

HSP 9 Score: 92.0485 bits (227), Expect = 9.073e-15
Identity = 98/356 (27.53%), Postives = 139/356 (39.04%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCES------------------------------LENGM-------FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC----NYDGGDC-DPWRKCYGNDLKH---CKGVFND--GVCNPECNNVDCLFDGEDCHKSSC 1264
            C + PC N    E     + C C  G+ G+ C+ +++DC  NPC NGG+C+DK  + F+C C   F G  C+ E + C +  C NG TC                                L NG        F C+C  GF+G FC  ++  C   P      C N G C      T  C C  GY+G  C     +     CK  +C NGG C      S +C C+  +TG  C +P          N+        K + +         +N+CK +   G C    N+  C     Y G  C DP  +C  N  ++   CK    +    C P    V+C +D ++CH   C
Sbjct:  883 CLSDPCRNDGLCENRRGSYICKCQRGYSGQNCQTDIDDCKPNPCLNGGSCLDKV-AGFSCKCRPGFEGERCETEVDECASNPCRNGATCHDYVNSFVCACREGFRGIQCEHNIPECTESSCLNNGTCVDGINSFSCRCPLGFLGLFCEYESNECDSQP------CKNGGSC-TDGLRTYSCVCPVGYSGSNCQNYVNV-----CKGVHCLNGGTCS-QSTTSWVCRCQAGWTGLYCDVP----------NMSCQNFAARKGVDV---------ENVCKNA---GQCKNVGNSHQCICQPGYTGSYCEDPVDECLSNPCRNGATCKDYQGNYQCTCKPGFQGVNCEYDVDECHSRPC 1202          

HSP 10 Score: 82.4185 bits (202), Expect = 8.954e-12
Identity = 75/249 (30.12%), Postives = 110/249 (44.18%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC-LNVN-CENGGTCESLENGMFQCKCRYGFIGEFCA--------------------VQNIACPVIPKKKREL------------CNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CS  PC+NG  C +  +  + C C  G+ G  CE N++DC ++ C NGGTC+D  N+ + C C  ++ G  C  + + C L  N C+NGGTC +   G + C C  G+ G  C+                    V +  C + P+ K  L            C +  +CD  P    F C C PGY G+ C+  +    E    ++ C +GG C V  +GS  C C   +TG  C   + E       N
Sbjct:  232 CSPSPCLNGGTCHQTSETSYSCHCLPGFNGTNCENNIDDCPEHQCANGGTCMDGVNT-YNCQCPPEWTGQHCTEDVDECRLQPNTCQNGGTCHN-GIGSYNCVCVNGWSGVDCSENLNDCLEASCREGSTCIDRVASFIC-LCPRGKTGLLCHLTDACMSNPCRDGSQCDTNPITGNFNCNCPPGYVGNTCNIDRN---ECSIGTNPCEHGGQC-VNTDGSFTCNCAKGYTGPRCEQDVNECASSPCQN 473          

HSP 11 Score: 76.2554 bits (186), Expect = 5.681e-10
Identity = 71/233 (30.47%), Postives = 94/233 (40.34%), Query Frame = 2
Query:  467 PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCE-SLENGM-----FQCKCRYGFIGEFCAV-QNIAC-PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQ---CNTFACNYDGGDC 1132
            PC N  TC+   N    C C + F+G  CQ E+PC    C N GTC  S+ +G+       C C  G+ G+ C   QN  C P  P      C N G C +       C+C  G+TG  C+       E  C SD C NGG C     G   C C   + G  C I   E  +   +     + FN          +P     +CKA F   +C+     C+   C  +GG C
Sbjct:   34 PCVNNATCVTFGNGTEYCRCAAGFLGEYCQHEDPCQPGLCLNRGTCSVSMPDGVPVPGSALCTCPLGYTGQRCQTPQNSTCYPNNP------CANGGTCTLLSLDKYKCECTRGWTGPHCEH------EDSCLSDPCANGGRCSSQSGGRYTCHCPPGYKGPRCLIDRDECAETPSLCQNDGECFN----------TPGSYKCVCKAGFTGRLCESSYIPCSPSPC-LNGGTC 243          

HSP 12 Score: 73.559 bits (179), Expect = 3.572e-9
Identity = 65/203 (32.02%), Postives = 89/203 (43.84%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP--CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            C + PC NG +C       + C C  G+KG  C  + ++C + P  C+N G C +   S + C C + F G LC+    PC    C NGGTC       + C C  GF G  C      CP         C N G C    N T  C+C P +TG  C +  +   E   + + C NGG C     GS  C C   ++G +C+
Sbjct:  153 CLSDPCANGGRCSSQSGGRYTCHCPPGYKGPRCLIDRDECAETPSLCQNDGECFNTPGS-YKCVCKAGFTGRLCESSYIPCSPSPCLNGGTCHQTSETSYSCHCLPGFNGTNCENNIDDCP------EHQCANGGTCMDGVN-TYNCQCPPEWTGQHCTEDVD---ECRLQPNTCQNGGTCHN-GIGSYNCVCVNGWSGVDCS 343          

HSP 13 Score: 71.2478 bits (173), Expect = 1.979e-8
Identity = 80/330 (24.24%), Postives = 124/330 (37.58%), Query Frame = 2
Query:  398 RCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGV--CKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSF 1378
            +C C  G+ G  CE+ V++C+ NPC+NG TC D + + + C C   F G  C+++ + C +  C NGG C +L N  F C C  G  G  C V    C   P      C N G+C +       C C PG+ G+ C+          C+S  C   G   C  L N    C C+  +TG++C         E+++N+ + K      +    + S       C   +    C +                                   + N  C  + CL  G   H +     +C   +   +C+ E        +GG C    +N F
Sbjct: 1140 QCICQPGYTGSYCEDPVDECLSNPCRNGATCKDYQGN-YQCTCKPGFQGVNCEYDVDECHSRPCLNGGRCINLIN-RFTCSCPPGTHGVQCEVNEDDCAPQPGSSEPRCLNGGQC-VDGVGRYTCSCPPGFVGEHCEGDVNE-----CRSAPCHGPGTLDCVELVNDY-RCLCRLGYTGRHC---------ESMVNLCVSKPCRNGGVCSMNSSSVRGYTCSCPPGYTGSTCAE-----------------------------------LQNHSCGGLRCLNGGSCLHHNGQPLCQCPPGFSGPLCENEQRCSVTCHNGGTCVKDPANPF 1416          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: H2V8L9 (Notch receptor 2 OS=Takifugu rubripes OX=31033 GN=LOC101080224 PE=4 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 9.104e-56
Identity = 244/945 (25.82%), Postives = 397/945 (42.01%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNP------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT----LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC-------------TIPLKETRKEALINIKIPKTFNEKQLIIKKTKS-PSLCDNL-CKASFENGICDQQCNTFACNYDGGDCD-----PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHK-SSCKFHK-CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNF------------ATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQH---RHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLE-STDGIHPIDAGLGDVYT---MASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLH----------------------SLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C ++PC++G         F C C  G  G  CE NV+DC   P      C NGG C+D    ++TC+C   F+G  C+ + N CL+  C   G+  C  L N  +QC+CR G+ G  C      C   P      C N G C +  NMT      C C PG+ G  C + +       C   +C NGG C     G   C+C+  F+G +C                +K++      +   P  F+ +        S PS C  L CK    + +CD QCN   C++DGGDC      PW  C  +    C  +F +G C+ EC+N  CLFDG +C K  +CK+ K C++ + NKICD  C +  CG+DG DC             +     Q K    DL           Y +  ++   ++  MV   F V                       ++ L ++  +C    G+CFS  E++++FL A   K +   LP+ L  V++      ++  +  Y + ++ ++LL  + + ++    + K G L         W P    +            G      LK+FK   Q    L  G+SQ   +     R    + +P  P++++    + E   ++ +A    L     E  +DG+  ++    D +T   +AS++N    D        E  G     +      I+  ++ GA++I Q +    + LH                      + D  GRTPL +++AADA +   Q+LI  +    +S+ N                     TT LI A +L  + M+  L+   + +N +D  G+S +HW+A  NN   +E    +       D++DN++++PLFLAA EG+ ++ + LL +++   I   MD     P+  A+E+  ++I  L+ +
Sbjct: 1198 CHSKPCLHGGTCINLINRFTCVCPSGTHGVQCEVNVDDCAPKPGSWEPRCLNGGQCLDGI-GRYTCSCPPGFVGEHCEGDLNECLSGPCHATGSLDCVQLVND-YQCRCRLGYTGRHCDSMVDLCLSKP------CRNGGVCSM--NMTSVHGYMCSCPPGFIGFNCGEIEGYT----CAKLHCQNGGRCVESAGGHLYCQCQQGFSGAHCENSQWCPWPCQNGGTCMKDSANPVQYSCHCPNNFSGRYCENNVVGSGPSTCPYLQCKHHSADKVCDAQCNNHECDWDGGDCSLNWKQPWSNCTAS--VSCWDLFKNGRCDKECDNPGCLFDGFECQKHKTCKYEKYCADHFGNKICDPSCYTKACGWDGLDCAGDTPAKIVPGTLVIVVLLQPKELLGDLRGFLRSLGALLYTNLQVKLDENNKPMVYPYFGVENHGQQLKGSRSKRELEKEVIGSVVHLEIDNRKCSESSGECFSKTEEVASFLAAAHIKAD---LPYPLVSVNSSPAVPIRETHILPYLVGVSVVILLLIVVLGMLAAKRKHKHGLL---------WLPDGFMANKNDKRRE--PVGQDDF-DLKNFKT--QDGAVLDGGQSQRWLEDEVPPRKPRLEGKPLLPMAMDGGVDRREWTRQHRKAADISLTPPQAELDSDGVD-VNVKGPDGFTPLMLASLRNGGVLDCNLHGDEEEESGGDEPGSSV----ISDLISQGASLIAQTDRTGETALHLAARYARADAAKRLLDAGADPNAHDNMGRTPLHAAVAADA-QGVFQILIRNRATELDSRMN-------------------DGTTPLILAARLAVEGMVEELIHCHADINAVDDHGKSALHWAAAVNN---VEATLVLLKNGANRDMQDNKEETPLFLAAREGSFEAAQVLLDHYSNRDITDHMDRL---PRDTAQERMHHDIVRLLDQ 2078          

HSP 2 Score: 112.464 bits (280), Expect = 6.204e-21
Identity = 94/311 (30.23%), Postives = 132/311 (42.44%), Query Frame = 2
Query:  314 LLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS-------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTF-NEKQLIIKKTKSPSLCDN---LCKAS--FENGICDQQCNTFAC 1111
            LL +  +  C  +PCV+GKC+E  +  F C C  GW G+ CE+  ++C+ NPC+N G+C+D+ N                                       +TC C   F G  C+ E +PC +  C+ GG C  S +   F C+C  G+ G  C+     C      K+  C N G C   P  +  CKC  GY+G  C    +      C  + C NGG C V D GS  CEC+  F G++C I   E   +   N  I + + N      +      LCD+    C  S    NG C    NTF+C
Sbjct:  721 LLCLSGTDHCVAQPCVHGKCIEQQNGYF-CQCEAGWVGQHCEQEKDECLPNPCQNSGSCLDRHNGFTCVCQAGYRGVNCEKNIDECTSGPCLNQGICIDGLNSYTCQCVPPFAGEHCEVELDPCSSRPCQRGGVCLPSADYTYFTCRCPAGWQGLHCSEDVNEC------KKNPCRNGGHCINSPG-SYICKCPSGYSGHNCQTDID-----DCSPNPCLNGGSC-VDDVGSFSCECRPGFEGEHCEIEADECASQPCRNGAICRDYVNSFVCECRLGFDGILCDHNILECTESSCLNNGTCIDDINTFSC 1017          

HSP 3 Score: 98.9821 bits (245), Expect = 7.326e-17
Identity = 72/260 (27.69%), Postives = 110/260 (42.31%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE---------------------------------------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            + +  C+++PC NG     +   F C C  G+ G  C+ N+ +C ++ C N GTCID  N+ F+C C   F G  C++E                                       N C  V C NGG+C       + C C  G+ G +C V +++C     +K      +C N G C +    +  C+C PGYTG  C++  +      CKS+ C NG  CK    G+  C CK  + G NC   + E   +  ++
Sbjct:  954 IEADECASQPCRNGAICRDYVNSFVCECRLGFDGILCDHNILECTESSCLNNGTCIDDINT-FSCRCLPGFFGTFCEYEQNECDSQPCKNGGTCTDGLGTYRCTCPAGYNGQNCQNYVNLCRQVRCHNGGSCSHTGATSWTCHCTMGWTGPYCDVPDMSCRDFAARKGLEEENVCKNAGRC-VNVGNSHKCECQPGYTGSYCEEMVDE-----CKSNPCRNGATCKDY-QGTYECICKPGYQGVNCEYEVDECHSKPCLH 1205          

HSP 4 Score: 98.2117 bits (243), Expect = 1.416e-16
Identity = 78/220 (35.45%), Postives = 103/220 (46.82%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFD-PEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CS+RPC  G  C+ + D   F C C  GW+G  C E+VN+C +NPC+NGG CI+   S + C C S + G+ CQ +      NPCL     NGG+C   + G F C+CR GF GE C ++   C   P      C N   C  Y N +  C+C  G+ G  CD        + C    C N G C + D  +  C C   F G  C     E   +   N
Sbjct:  843 CSSRPCQRGGVCLPSADYTYFTCRCPAGWQGLHCSEDVNECKKNPCRNGGHCINSPGS-YICKCPSGYSGHNCQTDIDDCSPNPCL-----NGGSCVD-DVGSFSCECRPGFEGEHCEIEADECASQP------CRNGAICRDYVN-SFVCECRLGFDGILCDHNI-----LECTESSCLNNGTC-IDDINTFSCRCLPGFFGTFCEYEQNECDSQPCKN 1042          

HSP 5 Score: 89.7373 bits (221), Expect = 4.792e-14
Identity = 60/180 (33.33%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  401 CSCWHGWKGETCE--ENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            CSC  G+ G+ C+  +N      NPC N G C      ++ C C   + G  C++E+ CL+  C NGGTC +L  G + C C  G+ G  C      C   P     +C N G C I    +  C C  G+TG  C+        I C    C NGG C      S  C C   F G NC
Sbjct:   95 CSCPLGYAGQHCQIPQNSTCYPNNPCANRGICTLLPFDKYKCECARGWTGPGCEYEDSCLSSPCANGGTCSTLSGGSYTCSCLPGYTGRHCLNDTDECAATPS----ICQNEGTC-INTRGSYKCMCALGFTGKHCESSY-----IPCSPSPCLNGGTCNQNSETSYSCHCLPGFNGTNC 264          

HSP 6 Score: 86.6557 bits (213), Expect = 4.087e-13
Identity = 68/180 (37.78%), Postives = 93/180 (51.67%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVC 871
            CS+ PC+NG KC++  +  + C C  G+KG  CEEN+NDC+  PC + G C D   + F+C C + + G +C  +   C +  C+N G C  L N  +QC C  G  G  C +    C         LC  +GEC    N    C C PGYTGD+CD      V+I  C S+ C +GG C
Sbjct:  542 CSSTPCLNGAKCIDLPN-GYDCECAEGFKGLLCEENINDCVPEPCHH-GQCKDGI-ATFSCECYAGYTGAICNIQVQECHSNPCQNRGRCIDLVN-AYQCNCPPGISGVNCEINEDDC------ASNLC-VYGECQDGIN-EYKCVCSPGYTGDKCD------VDINECSSNPCMSGGTC 703          

HSP 7 Score: 85.5001 bits (210), Expect = 1.025e-12
Identity = 65/206 (31.55%), Postives = 91/206 (44.17%), Query Frame = 2
Query:  347 NRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC---QFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            N PC N G C      +++C C  GW G  CE   + C+ +PC NGGTC       +TC+C   + G  C     E       C+N GTC +   G ++C C  GF G+ C    I C   P      C N G C+     +  C C PG+ G  C+   +      C    C N G C +    +  C+C  E+TG++CT  + E
Sbjct:  117 NNPCANRGICTLLPFDKYKCECARGWTGPGCEYE-DSCLSSPCANGGTCSTLSGGSYTCSCLPGYTGRHCLNDTDECAATPSICQNEGTCINTR-GSYKCMCALGFTGKHCESSYIPCSPSP------CLNGGTCNQNSETSYSCHCLPGFNGTNCENNID-----DCPGHQCANRGTC-IDGVNTYNCQCPPEWTGQHCTEDVNE 308          

HSP 8 Score: 83.5741 bits (205), Expect = 3.605e-12
Identity = 67/209 (32.06%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            PC +G      +  F C+C  G+ G  CE++VN+C  NPC+N GTC+D+    ++C C   F G  C+ E N CL+  C N G C   +   F C+C  GF GE C +    C   P      C N  +C   PN    C+C  G+ G  C++     V   C    C +G         +  CEC   +TG  C I ++E       N
Sbjct:  432 PCEHGGQCVNTEGSFTCNCAKGYAGPRCEQDVNECASNPCQNDGTCLDRI-GDYSCICMPGFGGTHCENELNECLSSPCLNRGKCLD-QVSRFVCECPAGFSGEMCQIDIDECSSTP------CLNGAKCIDLPN-GYDCECAEGFKGLLCEENINDCVPEPCHHGQCKDG-------IATFSCECYAGYTGAICNIQVQECHSNPCQN 624          

HSP 9 Score: 81.6481 bits (200), Expect = 1.367e-11
Identity = 93/323 (28.79%), Postives = 133/323 (41.18%), Query Frame = 2
Query:  455 CIQN--PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCE-SLENGM-----FQCKCRYGFIGEFCAV-QNIAC-PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC-----DNLCKASF---------ENGICDQQCNT-FACN----YDGGDCD-PWRKCYGNDLKHCKGVFNDGV------CNPECNNVDCLFDGEDCH--KSSCK-FHKCSELYQNKIC 1306
            C+ N  PC N  TC+   N    C C   F+G  CQ ++PC    C NGG C  S+  G+       C C  G+ G+ C + QN  C P  P      C N G C + P     C+C  G+TG  C+       E  C S  C NGG C  L  GS  C C   +TG++C     E      I        NE   I  +     +C        C++S+           G C+Q   T ++C+    ++G +C+     C G+   + +G   DGV      C PE     C  D  +CH   ++C+    CS L+ + +C
Sbjct:   28 CMDNKAPCVNNATCVTLNNRTEYCRCAPGFLGEYCQHKDPCQPGYCLNGGNCSVSMSAGVPVPGSATCSCPLGYAGQHCQIPQNSTCYPNNP------CANRGICTLLPFDKYKCECARGWTGPGCE------YEDSCLSSPCANGGTCSTLSGGSYTCSCLPGYTGRHCLNDTDECAATPSI------CQNEGTCINTRGSYKCMCALGFTGKHCESSYIPCSPSPCLNGGTCNQNSETSYSCHCLPGFNGTNCENNIDDCPGHQCAN-RGTCIDGVNTYNCQCPPEWTGQHCTEDVNECHLQPNTCQNGGTCSNLFGSYVC 331          
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Match: A0A1A9W977 (Uncharacterized protein OS=Glossina brevipalpis OX=37001 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.572e-55
Identity = 239/958 (24.95%), Postives = 400/958 (41.75%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT--CIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP-------LKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQ--------NKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTV----------------FNVTEI-NFNFA-------------TALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDK--------W------------GKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKL---PQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAF--QLISDSLESTDGIHPIDA----GLGDVYTMASVKNHMKYDEKYQTSS-----------LEG--LGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQETLRK 2953
            NG C++     F C+C  G+ G  CE ++N+C+ NPC N GT  C+   N+ + CNC   ++G  C+ + + C N  C+NGG C S + G   C C  GF G+ C      C   P +        G C I       C C  G  G  C    E+     C  + C  G  C  L  G  +C C  ++TGK C I        + ++ + AL N        ++++ +K+          C+    N ICDQ+CNT+ACN+DG DC    +PW  C       C  VF DG+CN ECN+  CL+DG DC K   K   C+ +Y         N  CD  C++ +C +DG DC         ++  ++            +V++  ++ F + +  FL+++   LR  V +                  +T+I N +FA             T + I L ++  +C     +CF+   + + FL A I     LS  F +  V          +E P     +   ++L  ++  L GVL+  +        W             + R +   +G    +   + S + +++  N     +   PQ  D + +   P +L            R+ HG    D+ +  +  +      ++ H  +A     I       DG H +D     G+  +   A     +   E  ++S             +G  L   +++ GE+ +H+AAR        + ++A   +  +  D  GRTPL +++ ADA     Q+L+  +     ++ N                     TT LI AV+L  ++M+  L+   + +N  D+ GR+ +HW+A  NN+   E L+ + +     D +D++D++PLFLAA EG+  S K LL  F    I    +C  P+ +A E+  ++I  L+ E + +
Sbjct: 1007 NGTCIDRVG-SFECACPPGFVGSRCEGDINECLSNPCSNAGTLDCVQLVNN-YHCNCKPGYMGRHCENKVDFCANSPCQNGGIC-SPKQGGHHCVCAEGFYGKNCEFSGHDCDSNPCQA-------GSCVIDDGGGYRCICPRGTEGRHC----EIDTMDECSPNPCLQGAACDNL-LGDFVCFCPSKWTGKRCEIHDPKYPGWVSDSSRGAL-NKYAKDLEYQREMCVKRG---------CEQKKGNHICDQECNTYACNFDGNDCSLGINPWVNCTA--PIECWRVFMDGICNEECNDAACLYDGRDCEK---KLQPCNPVYDAYCQKHYANGFCDYGCDNAECNWDGLDCENESKPPKLADGAIS------------VVMLMDIKQFREQQVVFLREIGHLLRTTVRIKKDSMGNDMIFTWKGSSQLTDIQNTDFARRHKILFTERNGQTGIQIYLEIDNRKCT----ECFNRAAEAAEFLGA-IASKYTLSSKFPIYSVRGVQNPGEDVEETPTNVKYVTTGVILVVLAFALSGVLVTTQRKRAHGITWFPEGFRTPTTAINRQRRRRDPSGQEMRNLNKNPSIACMSNDVNMNSGHIGHAPQWSDDESDMPQPKRL------------RNDHGGYASDHTMVTDYEEADQRVWSQAHLDVAGVRSSIMTPPAHQDGKHDVDVRGPCGMTPLMVAAVRGGGIDSGEDIESSDDIAAQVIADLIAQGAQLNAVMDKTGETPLHLAARYARADAAKRLLDA--GADANCEDSTGRTPLHAAVGADAV-GVFQILLRNRATNLNARMN-------------------DGTTPLILAVRLAIEDMVEKLITADADINAADNTGRTALHWAAAVNNT---EALNILLMHHANRDAQDDKDETPLFLAAREGSYGSCKALLDNFANREITDHMDCL-PRDVAAERLHHDIVRLLDEHVPR 1879          

HSP 2 Score: 101.679 bits (252), Expect = 1.182e-17
Identity = 78/247 (31.58%), Postives = 112/247 (45.34%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLN---------------------------------VNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKR----ELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C + PC NG     +   + C+C  G+ G  C+ N  DC ++ C NGGTCID  NS + C+C   F G+ CQ++       PC N                                   CENG TC  ++N  F C+C  G+ G+ C V+ ++C     +K     +LCNN G C  + N+   C C  GYTG  C ++        C+S  C NGG C+ L  GS  C C+  F G+NC + + +
Sbjct:  724 CLSMPCQNGATCRQYVNSYTCTCPLGFSGINCQTNDEDCTESSCMNGGTCIDGINS-YNCSCLPGFTGSNCQYKINKCDSQPCQNGATCHENNDEYTCHCSYGYTGKQCTDYVDWCTKSPCENGATCTQVKN-QFSCRCAPGWTGKLCDVEMVSCRDAALRKAVPLDQLCNN-GTCKEHGNIHR-CYCKQGYTGSYCQQEINE-----CESQPCLNGGTCRDLI-GSYACVCRKGFQGQNCELNIDD 960          

HSP 3 Score: 95.5153 bits (236), Expect = 8.418e-16
Identity = 70/202 (34.65%), Postives = 98/202 (48.51%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC+NG   E    EF C C  G+ G+ CE ++++C  NPC++GG C+D+ N+ F C C   + G  C+   + C+N  C NGGTC    NG ++C C+  + G  C  +   C          C N   C   PN   F C C  GYTG  CD+     ++    S  C NG  C  L  GS  C C   + G +C I
Sbjct:  493 CASNPCINGGRCEDGVNEFICHCSPGYGGKRCEIDIDECSSNPCQHGGICVDELNA-FKCQCMPGYTGYKCEINIDDCVNNPCANGGTCIDKVNG-YKCVCKVPYTGIDCESKLDPCAT------NRCRNDAMCTPSPNFLDFSCTCKLGYTGRYCDED----IDECSLSTPCRNGATCLNLP-GSYRCICAKGYEGHDCAI 681          

HSP 4 Score: 92.8189 bits (229), Expect = 4.753e-15
Identity = 69/196 (35.20%), Postives = 87/196 (44.39%), Query Frame = 2
Query:  353 PCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            PC NG         +RC C  G++G  C  N +DC   PC+NGGTC+D     + C C   F G  C+ + N CL++ C+NG TC    N  + C C  GF G  C   +  C          C N G C I    +  C C PG+TG  C  K        C S  C NG  C   +N    C C   +TGK CT
Sbjct:  652 PCRNGATCLNLPGSYRCICAKGYEGHDCAINTDDCASFPCQNGGTCLDGI-GDYYCLCVDGFDGKHCETDINECLSMPCQNGATCRQYVNS-YTCTCPLGFSGINCQTNDEDC------TESSCMNGGTC-IDGINSYNCSCLPGFTGSNCQYKINK-----CDSQPCQNGATCHE-NNDEYTCHCSYGYTGKQCT 832          

HSP 5 Score: 89.3521 bits (220), Expect = 6.295e-14
Identity = 65/211 (30.81%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLE-NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKI 985
            C NG         + C C +GW G  C EN++DC    C NG TC+D   S F C C     G LC  ++ C +  C     C++   NG + C C  G+ G  C+     C      +   C ++G C   P  +  C C  G+TG RC+          C+S  C N G C + D G+  C C   FTG  C I + E +    +N  +
Sbjct:   79 CKNGATCTNSPGSYSCICVNGWNGTDCSENIDDCATASCLNGATCVDGVGS-FYCRCAPGKTGLLCHLDDACTSNPCHADAICDTSPINGSYTCSCAAGYKGVDCSEDIDEC-----DQGSPCEHNGICVNTPG-SFMCNCSQGFTGPRCETNINE-----CESHPCQNEGSC-LDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGV 276          

HSP 6 Score: 87.8113 bits (216), Expect = 1.607e-13
Identity = 71/228 (31.14%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCN---------------------NHGECDIYP---------NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            NG CV      F C+C  G+ G  CE N+N+C  +PC+N G+C+D   + F C C   F G  C+ + + C +  C N G C  + +G F+C C +GF G  C +    C   P +   +C+                     N  +CD  P         + +  C CDPG+TG  C  +        C+S+ C  GG C V   GS IC C    +GK+C I + E
Sbjct:  198 NGICVNTPG-SFMCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGT-FRCVCMPGFTGTQCEIDIDECQSNPCLNDGVCHDMISG-FKCSCAFGFTGSRCQINIDDCHSQPCRNNGICHDSIGGYTCECPPGYTGLSCEININDCDSNPCHRGKCIDGDNSFKCVCDPGFTGYLCQTQINE-----CESNPCQYGGHC-VDRVGSYICHCLPGTSGKDCEINVNE 416          

HSP 7 Score: 77.0258 bits (188), Expect = 3.333e-10
Identity = 67/218 (30.73%), Postives = 88/218 (40.37%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF------ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+N          F+CSC  G+ G  C+ N++DC   PC+N G C D     +TC C   + G  C+        NPC    C +G       +  F+C C  GF G  C  Q   C   P      C   G C +    +  C C PG +G  C    E+ V   C S+ C NG  C    N    C C   FTG +C I + E       N
Sbjct:  266 CQSNPCLNDGVCHDMISGFKCSCAFGFTGSRCQINIDDCHSQPCRNNGICHDSIGG-YTCECPPGYTGLSCEININDCDSNPCHRGKCIDG-------DNSFKCVCDPGFTGYLCQTQINECESNP------CQYGGHC-VDRVGSYICHCLPGTSGKDC----EINVNE-CHSNPCNNGATCIDGIN-KYTCNCVPGFTGVHCEININECASNPCAN 462          

HSP 8 Score: 74.3294 bits (181), Expect = 2.461e-9
Identity = 60/203 (29.56%), Postives = 93/203 (45.81%), Query Frame = 2
Query:  416 GWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF---ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKETRKEAL-----INIKIPKTF 997
            G++G+ CE N++DC  N C+NGGTCID   S ++C+C   + G  CQ    E   ++  C+NG TC +   G + C C  G+ G  C+        I       C N   C +    + +C+C PG TG  C       ++  C S+ C    +C     NGS  C C   + G +C+  + E  + +      I +  P +F
Sbjct:   21 GFQGKHCEHNIDDCPGNQCQNGGTCIDGITS-YSCSCPPNYTGEYCQTDVDECAIMSSVCKNGATCTN-SPGSYSCICVNGWNGTDCSEN------IDDCATASCLNGATC-VDGVGSFYCRCAPGKTGLLCH------LDDACTSNPCHADAICDTSPINGSYTCSCAAGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSF 208          

HSP 9 Score: 71.633 bits (174), Expect = 1.713e-8
Identity = 69/219 (31.51%), Postives = 94/219 (42.92%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC-IDKKNSQFTCNCTSQFIGNLCQFE-NPC-LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKI 985
            C+   C+NG  CV+     F C C  G  G  C  + + C  NPC     C     N  +TC+C + + G  C  + + C     CE+ G C +   G F C C  GF G  C      C   P      C N G C   P  T  C C PG+TG +C    E+ ++  C+S+ C N GVC  + +G   C C   FTG  C I + +   +   N  I
Sbjct:  112 CATASCLNGATCVDGVG-SFYCRCAPGKTGLLCHLD-DACTSNPCHADAICDTSPINGSYTCSCAAGYKGVDCSEDIDECDQGSPCEHNGICVNTP-GSFMCNCSQGFTGPRCETNINECESHP------CQNEGSCLDDPG-TFRCVCMPGFTGTQC----EIDIDE-CQSNPCLNDGVCHDMISGFK-CSCAFGFTGSRCQINIDDCHSQPCRNNGI 314          

HSP 10 Score: 70.0922 bits (170), Expect = 4.752e-8
Identity = 80/322 (24.84%), Postives = 127/322 (39.44%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACP-VIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPIC--ECKG---EFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCD-PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSS 1261
             C+N PC NG           C C  G+ G+ CE + +DC  NPC+  G+C+      + C C     G  C+ +       NPCL      G  C++L  G F C C   + G+ C + +   P  +    R   N + + D+                   + ++E+ V+ GC+               G+ IC  EC      F G +C++ +        +N   P                      C   F +GIC+++CN  AC YDG DC+   + C      +C+  + +G C+  C+N +C +DG DC   S
Sbjct: 1076 FCANSPCQNGGICSPKQGGHHCVCAEGFYGKNCEFSGHDCDSNPCQ-AGSCVIDDGGGYRCICPRGTEGRHCEIDTMDECSPNPCL-----QGAACDNLL-GDFVCFCPSKWTGKRCEIHDPKYPGWVSDSSRGALNKYAK-DL-------------------EYQREMCVKRGCEQ------------KKGNHICDQECNTYACNFDGNDCSLGIN-----PWVNCTAPIE--------------------CWRVFMDGICNEECNDAACLYDGRDCEKKLQPCNPVYDAYCQKHYANGFCDYGCDNAECNWDGLDCENES 1333          
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 202.986 bits (515), Expect = 4.085e-52
Identity = 244/1010 (24.16%), Postives = 404/1010 (40.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP---------------LKETRKEALINIKIPKTFNE--------------KQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS----RSNSF------FSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFL-------------QKLSSSLRMVVTVFNVTEINFNFATAL--LIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPK--LPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDS----------------LESTDGIHPI------DAGL--GDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C   PC NG     +   + C C  G+ G  C   +N+C+  PC+NGGTCID  N+                                              + C C   ++G  C+ + N CL+  C+  GT  C  L N  ++C+CR G+ G+ C        V    K + C N G C +  N      CKC PG+TG  C+   +      C S  C NGG C V  + +P C C   FTG  C  P                + + +    +   P  FN                + I    +  + C+   C+A   N  CD  CN+  C++DGGDC     DPW+ C  +D   C   FN+G C+ +C++  CL+DG DC +S  + +      C + Y +  CD+ CN+ +C +DG DC  +    R+            E L   ++   L EL  VL T +      + E +                  SL     V+     + +    +  ++ L ++  QC     +CF S   ++ FL A    GN L+LP+ +A      +  +  +  P+Y ++ +  LL F     +     R + G+L         W P    ++  S        G     L  LK+        N+  +GE +P  D  R  + +Q     + +++++   +   ++  A   ++ S +                +   DG  P+        GL  G+         ++  D  YQ ++L       +  GE+ +H+AAR        + + A   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1148 CIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNN-YRCECRTGYTGQRCDT------VFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAQ-----ACGSLQCKNGGTC-VSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNC--SDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCADNVPEKRATGLLVLVVHLPPEQLRN-NSSGFLRELSRVLHTNIVFRQDTQGELMIYPYYGSPHELRKHNKKRSLDSWSDVYGSGRRDQDQTQVVGSVVYLEIDNRQCYQQSAECFQSATDVAAFLGALASSGN-LNLPYVMAVTSESEVPPT-TELYPLYVVLASVALLAFVAVGMVASRKRRREHGQL---------WFPDGFKTSEPSKKKRREPVGEDSVGLKPLKNSDISLMDDNQNEWGEEEP-VDTKRFRYEEQA---MLDLDDQQDHRQWTQQHLDAADLRIPSVAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLH---NQTDRTGETALHLAARYARSDAAKRLLEASADANIQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMH-------------------DGTTPLILAARLAVEGMVEELINCHADVNAIDDFGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMD---RLPRDIAQERMHHDIVRLMDE 2095          

HSP 2 Score: 108.612 bits (270), Expect = 3.009e-23
Identity = 120/434 (27.65%), Postives = 171/434 (39.40%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVI--PKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK-----------------------------------KKELPVEIGCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC----DQQCNTFACNYDGGDCDP--------------------------WRKCYGNDLK------------HCKGVFNDGVCNPECNNVDCLFDGEDCH-------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTS 1363
            ++LC N    +G C++A +  + C C  G+ G  CEE V++CI NPC+NG TC D     ++C C   + G  C  E N CL+  C+NGGTC  L N  ++C C  G  G  C +    C     P  K   C N G C +       C C PGY G+RC+                                    ++   V  GCK   C NGG C V  N +P   IC+C   FTG  C     E   +A  +++           +   K+P     LC  SF    C    D  C +  C Y+GG C+P                          +   +G D+              C+    +  C+  CN+ +C +DG DC        ++     +C   + N  CDE+C+S  C +DG DC  S
Sbjct: 1112 ARLCRN----SGLCLDAGNTHY-CQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGG-YSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVN-TYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRC-VDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASN-TPHGFICKCPPGFTGSTC-----EYDAQACGSLQC----KNGGTCVSGHKNPRC---LCSPSFTGPECQYPSDGPCLSNPC-YNGGTCEPSTESPYFHCVCPADFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNCSDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRS 1523          

HSP 3 Score: 97.4413 bits (241), Expect = 7.891e-20
Identity = 71/218 (32.57%), Postives = 105/218 (48.17%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+   C NG  CV+  +  F C C  G+ G  C+ ++N+C   PC NGGTC D   + + C C   + G  CQ   N C    C+NGGTC       + C+C+ G+ G +C V +++C V  K++      LC N G C +    T +C+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E   +   N
Sbjct:  986 CTESSCFNGGTCVDGIN-TFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGT-YKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQ-SGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLC-LDAGNTHYCQCQAGYTGSYCEEQVDE-----CIPNPCQNGATCTDYLGGY-SCECVPGYHGVNCSSEINECLSQPCQN 1193          

HSP 4 Score: 95.9005 bits (237), Expect = 2.306e-19
Identity = 76/252 (30.16%), Postives = 106/252 (42.06%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C ++    F C C  G+ G  CE N+N+C+ +PC+NGGTC D++N+                                     + C C   + G LC    + C    C NGGTC    NG F C+CR G+    C  Q   C   P I          HG C+   N    C CD G++G+ CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  569 CLSNPCHYGLCKDSL-AGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNG-FMCQCRDGYHDPTCQSQLNECLSNPCI----------HGHCEDRVN-GYNCICDSGWSGNNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCSCRAGFSGPNCQTNINECASNPCLN 801          

HSP 5 Score: 90.1225 bits (222), Expect = 1.505e-17
Identity = 74/227 (32.60%), Postives = 104/227 (45.81%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEK 1006
            CS  PC++G  CV+  +  + CSC  G+ G+ CEEN++DC  + C NGGTC+D  N+ + C C  ++ G  C  + N C  +  +C+NGGTC + + G + C C  G+ GE C+        I       CN    C      + FC+C PG TG  C       +   C S+ C  G  C     NG  IC C   + G  C   + E    A       K  N K
Sbjct:  221 CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNT-YNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGG-YNCVCVNGWTGEDCSKN------IDDCADAACNVGATCHDRV-ASFFCECPPGRTGLLCH------LNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTK 432          

HSP 6 Score: 88.1965 bits (217), Expect = 4.703e-17
Identity = 81/278 (29.14%), Postives = 116/278 (41.73%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PC+NG   +     + CSC  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+   +PC    C+N G C ES +   F C C  G+ G+ C +    C   P +    C N          +  C C  GYTG  C+   +      CK + C NGG CK   +G  +  C C   F G  C   + E       N               P  F+    I  +  +P   ++ C   F  G C    NTF+C
Sbjct:  751 INNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNS-------IGSYRCSCKSGYTGRNCETDID-----DCKPNPCSNGGFCK---DGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSG---INCENNTPDCTESSC---FNGGTCVDGINTFSC 1006          

HSP 7 Score: 85.8853 bits (211), Expect = 2.814e-16
Identity = 82/283 (28.98%), Postives = 122/283 (43.11%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQF-TCNCTSQFIGNLCQFENPCLNVNCENGGTCESL--ENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACN----YDGGDCDP-WRKCYGNDLKHCKGVFNDGVCNPECNNVDCL--FDGEDCHKS--SCKFHKC 1279
            C+NGGTC+   + +   C C  +F G+ CQF NPCL   C NGG C+ +  +N + F C+C  G++   C       P     +   C N G C++    T  CKC PG+TG  C +         C S+ C NGG C   D+   IC C   F+G+ C                       KQ + +   SP  C+N        G+C  +  ++ CN    Y G  C+  ++ C  +   H       G  + EC+   CL  F G++C ++   C  H+C
Sbjct:   28 CQNGGTCVPTPDGRGGECKCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLT-----PTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADP------CASNPCANGGQCSPFDSHY-ICTCTPFFSGETC-----------------------KQDVNECALSPFPCNN-------GGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECS---CLPGFSGQNCEENIDDCPDHRC 265          

HSP 8 Score: 71.2478 bits (173), Expect = 6.946e-12
Identity = 63/206 (30.58%), Postives = 82/206 (39.81%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAF----DPEFRCSCWHGWKGETC-EENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            S  C   PC NG   +        +F C C  G+    C     N C  +PC NGGTC       + C C   + G  CQ  +PC +  C NGG C   ++  + C C   F GE C      C + P      CNN G C +    +  C C   YTG  C+   +      C    C +GG C      S  C C   F+G+NC
Sbjct:   59 SNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCASNPCANGGQCSPFDS-HYICTCTPFFSGETCKQDVNECALSPFP----CNNGGVC-VNEVGSYRCNCPTEYTGKHCETLYQP-----CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNC 253          

HSP 9 Score: 69.707 bits (169), Expect = 2.224e-11
Identity = 52/164 (31.71%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  353 PCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGC 838
            PC NG  CV      +RC+C   + G+ CE     C  +PC +GGTC+ K  + + C+C   F G  C+   + C +  C NGGTC    N  + C+C+  + G+FC      C ++P      C N G C +       C C  G+TG+ C K  +   +  C
Sbjct:  187 PCNNGGVCVNEVG-SYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNS----CQNGGTC-LNTQGGYNCVCVNGWTGEDCSKNIDDCADAAC 343          
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 202.986 bits (515), Expect = 4.085e-52
Identity = 244/1010 (24.16%), Postives = 404/1010 (40.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP---------------LKETRKEALINIKIPKTFNE--------------KQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS----RSNSF------FSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFL-------------QKLSSSLRMVVTVFNVTEINFNFATAL--LIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPK--LPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDS----------------LESTDGIHPI------DAGL--GDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C   PC NG     +   + C C  G+ G  C   +N+C+  PC+NGGTCID  N+                                              + C C   ++G  C+ + N CL+  C+  GT  C  L N  ++C+CR G+ G+ C        V    K + C N G C +  N      CKC PG+TG  C+   +      C S  C NGG C V  + +P C C   FTG  C  P                + + +    +   P  FN                + I    +  + C+   C+A   N  CD  CN+  C++DGGDC     DPW+ C  +D   C   FN+G C+ +C++  CL+DG DC +S  + +      C + Y +  CD+ CN+ +C +DG DC  +    R+            E L   ++   L EL  VL T +      + E +                  SL     V+     + +    +  ++ L ++  QC     +CF S   ++ FL A    GN L+LP+ +A      +  +  +  P+Y ++ +  LL F     +     R + G+L         W P    ++  S        G     L  LK+        N+  +GE +P  D  R  + +Q     + +++++   +   ++  A   ++ S +                +   DG  P+        GL  G+         ++  D  YQ ++L       +  GE+ +H+AAR        + + A   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1148 CIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNN-YRCECRTGYTGQRCDT------VFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAQ-----ACGSLQCKNGGTC-VSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNC--SDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCADNVPEKRATGLLVLVVHLPPEQLRN-NSSGFLRELSRVLHTNIVFRQDTQGELMIYPYYGSPHELRKHNKKRSLDSWSDVYGSGRRDQDQTQVVGSVVYLEIDNRQCYQQSAECFQSATDVAAFLGALASSGN-LNLPYVMAVTSESEVPPT-TELYPLYVVLASVALLAFVAVGMVASRKRRREHGQL---------WFPDGFKTSEPSKKKRREPVGEDSVGLKPLKNSDISLMDDNQNEWGEEEP-VDTKRFRYEEQA---MLDLDDQQDHRQWTQQHLDAADLRIPSVAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLH---NQTDRTGETALHLAARYARSDAAKRLLEASADANIQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMH-------------------DGTTPLILAARLAVEGMVEELINCHADVNAIDDFGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMD---RLPRDIAQERMHHDIVRLMDE 2095          

HSP 2 Score: 108.612 bits (270), Expect = 3.009e-23
Identity = 120/434 (27.65%), Postives = 171/434 (39.40%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVI--PKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK-----------------------------------KKELPVEIGCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC----DQQCNTFACNYDGGDCDP--------------------------WRKCYGNDLK------------HCKGVFNDGVCNPECNNVDCLFDGEDCH-------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTS 1363
            ++LC N    +G C++A +  + C C  G+ G  CEE V++CI NPC+NG TC D     ++C C   + G  C  E N CL+  C+NGGTC  L N  ++C C  G  G  C +    C     P  K   C N G C +       C C PGY G+RC+                                    ++   V  GCK   C NGG C V  N +P   IC+C   FTG  C     E   +A  +++           +   K+P     LC  SF    C    D  C +  C Y+GG C+P                          +   +G D+              C+    +  C+  CN+ +C +DG DC        ++     +C   + N  CDE+C+S  C +DG DC  S
Sbjct: 1112 ARLCRN----SGLCLDAGNTHY-CQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGG-YSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVN-TYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRC-VDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASN-TPHGFICKCPPGFTGSTC-----EYDAQACGSLQC----KNGGTCVSGHKNPRC---LCSPSFTGPECQYPSDGPCLSNPC-YNGGTCEPSTESPYFHCVCPADFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNCSDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRS 1523          

HSP 3 Score: 97.4413 bits (241), Expect = 7.891e-20
Identity = 71/218 (32.57%), Postives = 105/218 (48.17%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+   C NG  CV+  +  F C C  G+ G  C+ ++N+C   PC NGGTC D   + + C C   + G  CQ   N C    C+NGGTC       + C+C+ G+ G +C V +++C V  K++      LC N G C +    T +C+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E   +   N
Sbjct:  986 CTESSCFNGGTCVDGIN-TFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGT-YKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQ-SGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLC-LDAGNTHYCQCQAGYTGSYCEEQVDE-----CIPNPCQNGATCTDYLGGY-SCECVPGYHGVNCSSEINECLSQPCQN 1193          

HSP 4 Score: 95.9005 bits (237), Expect = 2.306e-19
Identity = 76/252 (30.16%), Postives = 106/252 (42.06%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C ++    F C C  G+ G  CE N+N+C+ +PC+NGGTC D++N+                                     + C C   + G LC    + C    C NGGTC    NG F C+CR G+    C  Q   C   P I          HG C+   N    C CD G++G+ CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  569 CLSNPCHYGLCKDSL-AGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNG-FMCQCRDGYHDPTCQSQLNECLSNPCI----------HGHCEDRVN-GYNCICDSGWSGNNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCSCRAGFSGPNCQTNINECASNPCLN 801          

HSP 5 Score: 90.1225 bits (222), Expect = 1.505e-17
Identity = 74/227 (32.60%), Postives = 104/227 (45.81%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEK 1006
            CS  PC++G  CV+  +  + CSC  G+ G+ CEEN++DC  + C NGGTC+D  N+ + C C  ++ G  C  + N C  +  +C+NGGTC + + G + C C  G+ GE C+        I       CN    C      + FC+C PG TG  C       +   C S+ C  G  C     NG  IC C   + G  C   + E    A       K  N K
Sbjct:  221 CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNT-YNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGG-YNCVCVNGWTGEDCSKN------IDDCADAACNVGATCHDRV-ASFFCECPPGRTGLLCH------LNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTK 432          

HSP 6 Score: 88.1965 bits (217), Expect = 4.703e-17
Identity = 81/278 (29.14%), Postives = 116/278 (41.73%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PC+NG   +     + CSC  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+   +PC    C+N G C ES +   F C C  G+ G+ C +    C   P +    C N          +  C C  GYTG  C+   +      CK + C NGG CK   +G  +  C C   F G  C   + E       N               P  F+    I  +  +P   ++ C   F  G C    NTF+C
Sbjct:  751 INNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNS-------IGSYRCSCKSGYTGRNCETDID-----DCKPNPCSNGGFCK---DGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSG---INCENNTPDCTESSC---FNGGTCVDGINTFSC 1006          

HSP 7 Score: 85.8853 bits (211), Expect = 2.814e-16
Identity = 82/283 (28.98%), Postives = 122/283 (43.11%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQF-TCNCTSQFIGNLCQFENPCLNVNCENGGTCESL--ENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACN----YDGGDCDP-WRKCYGNDLKHCKGVFNDGVCNPECNNVDCL--FDGEDCHKS--SCKFHKC 1279
            C+NGGTC+   + +   C C  +F G+ CQF NPCL   C NGG C+ +  +N + F C+C  G++   C       P     +   C N G C++    T  CKC PG+TG  C +         C S+ C NGG C   D+   IC C   F+G+ C                       KQ + +   SP  C+N        G+C  +  ++ CN    Y G  C+  ++ C  +   H       G  + EC+   CL  F G++C ++   C  H+C
Sbjct:   28 CQNGGTCVPTPDGRGGECKCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLT-----PTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADP------CASNPCANGGQCSPFDSHY-ICTCTPFFSGETC-----------------------KQDVNECALSPFPCNN-------GGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECS---CLPGFSGQNCEENIDDCPDHRC 265          

HSP 8 Score: 71.2478 bits (173), Expect = 6.946e-12
Identity = 63/206 (30.58%), Postives = 82/206 (39.81%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAF----DPEFRCSCWHGWKGETC-EENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            S  C   PC NG   +        +F C C  G+    C     N C  +PC NGGTC       + C C   + G  CQ  +PC +  C NGG C   ++  + C C   F GE C      C + P      CNN G C +    +  C C   YTG  C+   +      C    C +GG C      S  C C   F+G+NC
Sbjct:   59 SNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCASNPCANGGQCSPFDS-HYICTCTPFFSGETCKQDVNECALSPFP----CNNGGVC-VNEVGSYRCNCPTEYTGKHCETLYQP-----CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNC 253          

HSP 9 Score: 69.707 bits (169), Expect = 2.224e-11
Identity = 52/164 (31.71%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  353 PCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGC 838
            PC NG  CV      +RC+C   + G+ CE     C  +PC +GGTC+ K  + + C+C   F G  C+   + C +  C NGGTC    N  + C+C+  + G+FC      C ++P      C N G C +       C C  G+TG+ C K  +   +  C
Sbjct:  187 PCNNGGVCVNEVG-SYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNS----CQNGGTC-LNTQGGYNCVCVNGWTGEDCSKNIDDCADAAC 343          
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 202.601 bits (514), Expect = 4.936e-52
Identity = 244/1010 (24.16%), Postives = 404/1010 (40.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS---------------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP---------------LKETRKEALINIKIPKTFNE--------------KQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTS----RSNSF------FSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFL-------------QKLSSSLRMVVTVFNVTEINFNFATAL--LIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPK--LPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDS----------------LESTDGIHPI------DAGL--GDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C   PC NG     +   + C C  G+ G  C   +N+C+  PC+NGGTCID  N+                                              + C C   ++G  C+ + N CL+  C+  GT  C  L N  ++C+CR G+ G+ C        V    K + C N G C +  N      CKC PG+TG  C+   +      C S  C NGG C V  + +P C C   FTG  C  P                + + +    +   P  FN                + I    +  + C+   C+A   N  CD  CN+  C++DGGDC     DPW+ C  +D   C   FN+G C+ +C++  CL+DG DC +S  + +      C + Y +  CD+ CN+ +C +DG DC  +    R+            E L   ++   L EL  VL T +      + E +                  SL     V+     + +    +  ++ L ++  QC     +CF S   ++ FL A    GN L+LP+ +A      +  +  +  P+Y ++ +  LL F     +     R + G+L         W P    ++  S        G     L  LK+        N+  +GE +P  D  R  + +Q     + +++++   +   ++  A   ++ S +                +   DG  P+        GL  G+         ++  D  YQ ++L       +  GE+ +H+AAR        + + A   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L  + M+  L++  + VN +D  G+S +HW+A  NN      L      +   D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1122 CIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNN-YRCECRTGYTGQRCDT------VFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAQ-----ACGSLQCKNGGTC-VSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNC--SDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCADNVPEKRATGLLVLVVHLPPEQLRN-NSSGFLRELSRVLHTNIVFRQDTQGELMIYPYYGSPHELRKHNKKRSLDSWSDVYGSGRRDQDQTQVVGSVVYLEIDNRQCYQQSAECFQSATDVAAFLGALASSGN-LNLPYVMAVTSESEVPPT-TELYPLYVVLASVALLAFVAVGMVASRKRRREHGQL---------WFPDGFKTSEPSKKKRREPVGEDSVGLKPLKNSDISLMDDNQNEWGEEEP-VDTKRFRYEEQA---MLDLDDQQDHRQWTQQHLDAADLRIPSVAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLH---NQTDRTGETALHLAARYARSDAAKRLLEASADANIQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMH-------------------DGTTPLILAARLAVEGMVEELINCHADVNAIDDFGKSALHWAAAVNNVDAAVVLLKNGANK---DMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMD---RLPRDIAQERMHHDIVRLMDE 2069          

HSP 2 Score: 108.227 bits (269), Expect = 3.722e-23
Identity = 120/434 (27.65%), Postives = 171/434 (39.40%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVI--PKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDK-----------------------------------KKELPVEIGCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC----DQQCNTFACNYDGGDCDP--------------------------WRKCYGNDLK------------HCKGVFNDGVCNPECNNVDCLFDGEDCH-------KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTS 1363
            ++LC N    +G C++A +  + C C  G+ G  CEE V++CI NPC+NG TC D     ++C C   + G  C  E N CL+  C+NGGTC  L N  ++C C  G  G  C +    C     P  K   C N G C +       C C PGY G+RC+                                    ++   V  GCK   C NGG C V  N +P   IC+C   FTG  C     E   +A  +++           +   K+P     LC  SF    C    D  C +  C Y+GG C+P                          +   +G D+              C+    +  C+  CN+ +C +DG DC        ++     +C   + N  CDE+C+S  C +DG DC  S
Sbjct: 1086 ARLCRN----SGLCLDAGNTHY-CQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGG-YSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVN-TYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRC-VDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASN-TPHGFICKCPPGFTGSTC-----EYDAQACGSLQC----KNGGTCVSGHKNPRC---LCSPSFTGPECQYPSDGPCLSNPC-YNGGTCEPSTESPYFHCVCPADFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNCSDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRS 1497          

HSP 3 Score: 97.4413 bits (241), Expect = 8.680e-20
Identity = 71/218 (32.57%), Postives = 105/218 (48.17%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+   C NG  CV+  +  F C C  G+ G  C+ ++N+C   PC NGGTC D   + + C C   + G  CQ   N C    C+NGGTC       + C+C+ G+ G +C V +++C V  K++      LC N G C +    T +C+C  GYTG  C+++ +      C  + C NG  C     G   CEC   + G NC+  + E   +   N
Sbjct:  960 CTESSCFNGGTCVDGIN-TFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGT-YKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQ-SGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLC-LDAGNTHYCQCQAGYTGSYCEEQVDE-----CIPNPCQNGATCTDYLGGY-SCECVPGYHGVNCSSEINECLSQPCQN 1167          

HSP 4 Score: 95.5153 bits (236), Expect = 2.737e-19
Identity = 76/252 (30.16%), Postives = 106/252 (42.06%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNS------------------------------------QFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIAC---PVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C ++    F C C  G+ G  CE N+N+C+ +PC+NGGTC D++N+                                     + C C   + G LC    + C    C NGGTC    NG F C+CR G+    C  Q   C   P I          HG C+   N    C CD G++G+ CD          C+S+ C NGG CK + +G  +C C+  F+G NC   + E      +N
Sbjct:  543 CLSNPCHYGLCKDSL-AGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNG-FMCQCRDGYHDPTCQSQLNECLSNPCI----------HGHCEDRVN-GYNCICDSGWSGNNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCSCRAGFSGPNCQTNINECASNPCLN 775          

HSP 5 Score: 89.7373 bits (221), Expect = 1.685e-17
Identity = 74/227 (32.60%), Postives = 104/227 (45.81%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPC--LNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEK 1006
            CS  PC++G  CV+  +  + CSC  G+ G+ CEEN++DC  + C NGGTC+D  N+ + C C  ++ G  C  + N C  +  +C+NGGTC + + G + C C  G+ GE C+        I       CN    C      + FC+C PG TG  C       +   C S+ C  G  C     NG  IC C   + G  C   + E    A       K  N K
Sbjct:  195 CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNT-YNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGG-YNCVCVNGWTGEDCSKN------IDDCADAACNVGATCHDRV-ASFFCECPPGRTGLLCH------LNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTK 406          

HSP 6 Score: 88.1965 bits (217), Expect = 5.265e-17
Identity = 81/278 (29.14%), Postives = 116/278 (41.73%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFAC 1111
            +++  C + PC+NG   +     + CSC  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+   +PC    C+N G C ES +   F C C  G+ G+ C +    C   P +    C N          +  C C  GYTG  C+   +      CK + C NGG CK   +G  +  C C   F G  C   + E       N               P  F+    I  +  +P   ++ C   F  G C    NTF+C
Sbjct:  725 INNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNS-------IGSYRCSCKSGYTGRNCETDID-----DCKPNPCSNGGFCK---DGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSG---INCENNTPDCTESSC---FNGGTCVDGINTFSC 980          

HSP 7 Score: 74.3294 bits (181), Expect = 9.533e-13
Identity = 75/264 (28.41%), Postives = 111/264 (42.05%), Query Frame = 2
Query:  524 CTSQFIGNLCQFENPCLNVNCENGGTCESL--ENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACN----YDGGDCDP-WRKCYGNDLKHCKGVFNDGVCNPECNNVDCL--FDGEDCHKS--SCKFHKC 1279
            C  +F G+ CQF NPCL   C NGG C+ +  +N + F C+C  G++   C       P     +   C N G C++    T  CKC PG+TG  C +         C S+ C NGG C   D+   IC C   F+G+ C                       KQ + +   SP  C+N        G+C  +  ++ CN    Y G  C+  ++ C  +   H       G  + EC+   CL  F G++C ++   C  H+C
Sbjct:   21 CPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLT-----PTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADP------CASNPCANGGQCSPFDSHY-ICTCTPFFSGETC-----------------------KQDVNECALSPFPCNN-------GGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECS---CLPGFSGQNCEENIDDCPDHRC 239          

HSP 8 Score: 71.2478 bits (173), Expect = 8.052e-12
Identity = 63/206 (30.58%), Postives = 82/206 (39.81%), Query Frame = 2
Query:  332 SKLCSNRPCVNGKCVEAF----DPEFRCSCWHGWKGETC-EENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            S  C   PC NG   +        +F C C  G+    C     N C  +PC NGGTC       + C C   + G  CQ  +PC +  C NGG C   ++  + C C   F GE C      C + P      CNN G C +    +  C C   YTG  C+   +      C    C +GG C      S  C C   F+G+NC
Sbjct:   33 SNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCASNPCANGGQCSPFDS-HYICTCTPFFSGETCKQDVNECALSPFP----CNNGGVC-VNEVGSYRCNCPTEYTGKHCETLYQP-----CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNC 227          

HSP 9 Score: 69.3218 bits (168), Expect = 2.689e-11
Identity = 52/164 (31.71%), Postives = 77/164 (46.95%), Query Frame = 2
Query:  353 PCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGC 838
            PC NG  CV      +RC+C   + G+ CE     C  +PC +GGTC+ K  + + C+C   F G  C+   + C +  C NGGTC    N  + C+C+  + G+FC      C ++P      C N G C +       C C  G+TG+ C K  +   +  C
Sbjct:  161 PCNNGGVCVNEVG-SYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNS----CQNGGTC-LNTQGGYNCVCVNGWTGEDCSKNIDDCADAAC 317          
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:103042072])

HSP 1 Score: 162.155 bits (409), Expect = 1.414e-39
Identity = 144/567 (25.40%), Postives = 233/567 (41.09%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVN-------CENGGTCESLENGMFQCKCRYGFIGEFC-------------AVQNIACPVIPKKKRELC----------NNHGECDIYP-------------NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC------TIPLKETRKEALI---------------NIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVV----------TVFNVTEINFNFATALL---------IKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIY 1762
            C ++PC+NG     +   + C C  G++G+ CE  +N+C  +PC+NGGTCID     + C+C    +G LC+  E+ C           C+N GTC     G ++C C  G+ G+ C             A  ++ C  +P     +C          N  G C+  P              +   C C  GYTG  C++       + C+   C+NGG C V   G+  C C+  F G  C      +   K  R   +                  K  +   E +++ +   +  + D  C     +G+CD++CN+ AC +DGGDC    +PW +C       C  VFN+  C+  CNN DCL+D  DC       +      C + Y +  CD+ CN+ +CG+DG DC  +R+      +G+           L +V++   +   +  + FLQKLSS LR  +           +   T  +      L+         + L ++   C      CF + +  + +L A +    +L  P+ L  V    I   K Q +P++
Sbjct: 1103 CEDKPCLNGATCRGYVGGYTCDCMPGYEGQNCEREINECRSHPCQNGGTCIDLV-GHYICSCPPGTMGVLCEINEDDCATPTRPRGTPKCQNNGTCVDRVGG-YRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPNDYLCVCKPGFTGRGCQNRFGVCESQPCKNGGACSGAGSSPLGYICTCQLGYTGTNCERS------MSCRELSCYNGGSCTVTSRGA-RCSCQQGFAGPQCQHRSNQSCSSKPCRNNGICIEEANFPFFSCQCMEGWKGKRCEQESRMLERPAPTCLIAD--CHGKANDGVCDKECNSMACRWDGGDCSLAANPWARCAD---PRCWRVFNNSQCDESCNNADCLYDNFDCKTKEKVCNPIYETYCMDHYADGRCDQGCNNEECGWDGLDC--ARTIPEDLADGV-----------LVIVVLLPPEELLRTGTAFLQKLSSILRTSLRFRLDQNGDAMIRPYTRRDGRPKRELMPQQEVIGSIVYLEIDNRLCSQDSNDCFPTADSAAEYLGA-LSAREMLRFPYPLKEVRGEKI---KDQVVPVW 1638          

HSP 2 Score: 111.694 bits (278), Expect = 3.893e-24
Identity = 78/202 (38.61%), Postives = 103/202 (50.99%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPE-FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            CS+ PCV+G C E  DP+ +RC C  GW G+ C+ + NDC+ NPC+N GTCID+ N  FTC C   F GN CQ   N C +  C N GTC       F C C   + G  CA     C   P      C+NH  C   P+   + C C PG+ G  C+      +++  C S+ C N G C     G  +C C+G ++G NC
Sbjct:  675 CSSSPCVHGACRE--DPDGYRCECEPGWVGKNCDLDRNDCLPNPCQNAGTCIDQLNG-FTCKCRQGFRGNQCQVNINECASSPCLNQGTCVD-GVASFTCLCEAPYSGPTCAEVLTPCSPNP------CSNHAVCTHTPDYFGYQCNCQPGWQGHLCN------IDVNECASNPCKNRGTCTNTLGGY-VCSCRGGYSGPNC 859          

HSP 3 Score: 98.2117 bits (243), Expect = 4.225e-20
Identity = 73/202 (36.14%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C + PC N   C++    EF C C  G+ G  CE ++++C  NPC N G C D  N+ FTC C + F G +CQ + + C +  C+NG  C    NG ++C+C  GF G  C      C   P        +HG C +    +  C C PGYTG RC+ +        C S+ C NGG C  L N   IC+C+   +G NC I
Sbjct:  411 CLSMPCQNDATCLDRIG-EFTCICMPGYTGTHCEIDIDECESNPCVNDGICRDLVNA-FTCTCQTGFTGTMCQIDIDECASTPCQNGAKCIDRPNG-YECRCAEGFEGRLCESNIDNCQPDPC-------HHGTC-VDGIASYTCNCVPGYTGYRCENQLNE-----CHSNPCQNGGKCVDLVNKY-ICQCQHGTSGTNCEI 595          

HSP 4 Score: 97.4413 bits (241), Expect = 7.629e-20
Identity = 77/279 (27.60%), Postives = 111/279 (39.78%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN----------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +N F   CL      +       C + PC NG     +   + C+C  G+ G  CE N  DC ++ C NGGTC+DK N  F+C C   F G  CQ+E       PCLN                                    C+NGG C   +     C C  G+ G +C +  ++C +   ++     ELC+  G C +    T +CKC   YTG  C+ + +      C+   C NG  C+    G   C+C   + G+NC   + E R     N
Sbjct:  881 INTFYCTCLPGFTGPRCAIEVDECQSAPCKNGGTCTDYVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTCVDKING-FSCTCRVGFTGEHCQYEVNECDSQPCLNGGVCQDGLESFRCSCPKGYTGSRCQVRVDWCRHSNPCQNGGRCRPKDG---SCDCVGGWSGRYCDIPGVSCEMAAMQRGLQTDELCHRGGHC-VNTGNTHYCKCPNDYTGSYCESQVDH-----CEDKPCLNGATCRGYVGGY-TCDCMPGYEGQNCEREINECRSHPCQN 1148          

HSP 5 Score: 97.0561 bits (240), Expect = 1.097e-19
Identity = 76/249 (30.52%), Postives = 103/249 (41.37%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM-------------------------------------FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEAL 970
            C++ PC N G C       + CSC  G+ G  CE ++NDC+ NPC +GG+C D  N+ F C C   F G  C  E + C +  C+NGGTC    N                                       F C CR GF GE C  +   C   P     +C +  E       +  C C  GYTG RC    ++ V+    S+ C NGG C+  D     C+C G ++G+ C IP       A+
Sbjct:  828 CASNPCKNRGTCTNTLG-GYVCSCRGGYSGPNCETDINDCLPNPCMSGGSCTDGINT-FYCTCLPGFTGPRCAIEVDECQSAPCKNGGTCTDYVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTCVDKINGFSCTCRVGFTGEHCQYEVNECDSQPCLNGGVCQDGLE-------SFRCSCPKGYTGSRC----QVRVDWCRHSNPCQNGGRCRPKDGS---CDCVGGWSGRYCDIPGVSCEMAAM 1060          

HSP 6 Score: 90.1225 bits (222), Expect = 1.360e-17
Identity = 69/235 (29.36%), Postives = 119/235 (50.64%), Query Frame = 2
Query: 2243 DEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  YQ +SL   G   +  GE+ +H+AAR        + ++A   +  ++ D  GRTPL +++A+DA +   Q+LI  +    +++                       +TALI A +L  + M+  L+   + VN +D  G+S +HW+A  NN   +E    +       D++D ++++PLFLAA EG+ ++VK LLA+F    I   MD     P+ IA+++  ++I  L+ E
Sbjct: 1822 DLIYQGASL---GAQTDRTGETALHLAARYARADAAKRLLDAG--ADANAQDNTGRTPLHAAVASDA-QGVFQILIRTRATDLDAR-------------------MYDGSTALILAARLAVEGMVEELITCHADVNAVDELGKSALHWAAAVNN---VEATVALLKNGANKDMQDLKEETPLFLAAREGSCEAVKILLAHFANREITDHMDRL---PRDIAQDRMHHDIVQLLDE 2025          

HSP 7 Score: 87.4261 bits (215), Expect = 1.005e-16
Identity = 67/214 (31.31%), Postives = 95/214 (44.39%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+  PC NG     ++  + CSC  G++G+ C  ++++C +   C NGG CI+   S F C C S + G  C+    PC    C NGGTC    +  ++C C  GF G  C V    CP         C N G C    N T  C+C P +TG  C +      E   + + C NGG C     G   C C   +TG +C+  + +       N
Sbjct:  100 CATSPCANGARCTNWNNHYNCSCPPGFQGKNCRNDIDECRKPGKCLNGGICINTHGS-FRCECVSGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCP------GHKCMNGGTCVDGVN-TYNCQCPPEWTGQYCAEDVN---ECLMQPNACHNGGTCFNTIGGH-TCVCVNGWTGDDCSENIDDCATAVCFN 301          

HSP 8 Score: 80.4925 bits (197), Expect = 1.143e-14
Identity = 57/173 (32.95%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  467 PCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCES-LENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            PC+NGG C+D +     C C   +IG LCQ  +PC    C NG  C+S + NG+  F C C+ GF G+ C++ + AC   P      C N        N    C C PG+ G  C       ++   K   C NGG+C +  +GS  CEC   ++G+ C +P +       +N
Sbjct:   30 PCENGGMCLDSR-----CMCRPGYIGPLCQHLDPCHRSPCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSLID-ACATSPCANGARCTNW-------NNHYNCSCPPGFQGKNCRND----IDECRKPGKCLNGGIC-INTHGSFRCECVSGYSGRTCEVPTQPCAPSQCLN 184          

HSP 9 Score: 78.5666 bits (192), Expect = 4.481e-14
Identity = 66/213 (30.99%), Postives = 94/213 (44.13%), Query Frame = 2
Query:  350 RPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTC---IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            RPC NG  C+++     RC C  G+ G  C+ +++ C ++PC NG  C   +     QFTC C   F G  C   + C    C NG  C +  N  + C C  GF G+ C      C     +K   C N G C I  + +  C+C  GY+G  C    E+P +  C    C NGG C    + +  C C   F G NC + + +      +N
Sbjct:   29 RPCENGGMCLDS-----RCMCRPGYIGPLCQ-HLDPCHRSPCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSLIDACATSPCANGARCTNWNN-HYNCSCPPGFQGKNCRNDIDEC-----RKPGKCLNGGIC-INTHGSFRCECVSGYSGRTC----EVPTQP-CAPSQCLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCPGHKCMN 223          

HSP 10 Score: 78.1814 bits (191), Expect = 5.723e-14
Identity = 66/210 (31.43%), Postives = 96/210 (45.71%), Query Frame = 2
Query:  341 CSNRPCVNGKC----VEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C   PC+NG      V    P+F C C  G++G+ C   ++ C  +PC NG  C +  N+ + C+C   F G  C+ + + C     C NGG C +  +G F+C+C  G+ G  C V     P  P +    C N G C    + T  C C PG+ G  C+   +      C    C NGG C V    +  C+C  E+TG+ C   + E
Sbjct:   59 CHRSPCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSL-IDACATSPCANGARCTN-WNNHYNCSCPPGFQGKNCRNDIDECRKPGKCLNGGICINT-HGSFRCECVSGYSGRTCEVPTQ--PCAPSQ----CLNGGTCHQTGDHTYECACLPGFGGTNCEVNVD-----DCPGHKCMNGGTC-VDGVNTYNCQCPPEWTGQYCAEDVNE 253          

HSP 11 Score: 74.7146 bits (182), Expect = 5.919e-13
Identity = 63/221 (28.51%), Postives = 93/221 (42.08%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN------------------------------------SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNG 889
            C + PCVN          F C+C  G+ G  C+ ++++C   PC+NG  CID+ N                                    + +TCNC   + G  C+ + N C +  C+NGG C  L N  + C+C++G  G  C +    C   P +       +G C    N    C C PG+TG +C+      VE+  C S+ C NGG C   +NG
Sbjct:  449 CESNPCVNDGICRDLVNAFTCTCQTGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCQPDPCHHGTCVDGIASYTCNCVPGYTGYRCENQLNECHSNPCQNGGKCVDLVN-KYICQCQHGTSGTNCEINYDDCASNPCE-------YGMCKDGINR-YDCVCKPGFTGPQCN------VELDECSSNPCRNGGTCVDDENG 654          

HSP 12 Score: 74.3294 bits (181), Expect = 9.736e-13
Identity = 57/174 (32.76%), Postives = 76/174 (43.68%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            C+NG         FRC C  G+ G TCE     C  + C NGGTC    +  + C C   F G  C+   + C    C NGGTC    N  + C+C   + G++CA     C + P      C+N G C +     T  C C  G+TGD C +  +      C +  CFNG  C
Sbjct:  144 CLNGGICINTHGSFRCECVSGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCPGHKCMNGGTCVDGVN-TYNCQCPPEWTGQYCAEDVNECLMQPNA----CHNGGTCFNTIGGHT--CVCVNGWTGDDCSENID-----DCATAVCFNGATC 305          
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:103042072])

HSP 1 Score: 159.073 bits (401), Expect = 1.098e-38
Identity = 143/558 (25.63%), Postives = 232/558 (41.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVN-------CENGGTCESLENGMFQCKCRYGFIGEFC-------------AVQNIACPVIPKKKRELC----------NNHGECDIYPNMTLFCK----CDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC------TIPLKETRKEALI---------------NIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVV----------TVFNVTEINFNFATALL---------IKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIY 1762
            C ++PC+NG     +   + C C  G++G+ CE  +N+C  +PC+NGGTCID     + C+C    +G LC+  E+ C           C+N GTC     G ++C C  G+ G+ C             A  ++ C  +P     +C          N  G C+  P     CK    C  GYTG  C++       + C+   C+NGG C V   G+  C C+  F G  C      +   K  R   +                  K  +   E +++ +   +  + D  C     +G+CD++CN+ AC +DGGDC    +PW +C       C  VFN+  C+  CNN DCL+D  DC       +      C + Y +  CD+ CN+ +CG+DG DC  +R+      +G+           L +V++   +   +  + FLQKLSS LR  +           +   T  +      L+         + L ++   C      CF + +  + +L A +    +L  P+ L  V    +     Q +P++
Sbjct: 1006 CEDKPCLNGATCRGYVGGYTCDCMPGYEGQNCEREINECRSHPCQNGGTCIDLV-GHYICSCPPGTMGVLCEINEDDCATPTRPRGTPKCQNNGTCVDRVGG-YRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPNDYLCVCKPGFTGRGCQNRFGVCESQP-----CKNGGACSGGYTGTNCERS------MSCRELSCYNGGSCTVTSRGA-RCSCQQGFAGPQCQHRSNQSCSSKPCRNNGICIEEANFPFFSCQCMEGWKGKRCEQESRMLERPAPTCLIAD--CHGKANDGVCDKECNSMACRWDGGDCSLAANPWARCAD---PRCWRVFNNSQCDESCNNADCLYDNFDCKTKEKVCNPIYETYCMDHYADGRCDQGCNNEECGWDGLDC--ARTIPEDLADGV-----------LVIVVLLPPEELLRTGTAFLQKLSSILRTSLRFRLDQNGDAMIRPYTRRDGRPKRELMPQQEVIGSIVYLEIDNRLCSQDSNDCFPTADSAAEYLGA-LSAREMLRFPYPLKEVRGECLHL--DQVVPVW 1528          

HSP 2 Score: 104.375 bits (259), Expect = 5.549e-22
Identity = 85/249 (34.14%), Postives = 111/249 (44.58%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPE-FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGN---LCQFENPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNN----------------HGECDI---YPNM------------TLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CS+ PCV+G C E  DP+ +RC C  GW G+ C+ + NDC+ NPC+N GTCID+ N  FTC C   F G      +   PC    C N   C    +   +QC C+ G+ G  C +    C   P K R  C N                + E DI    PN             T +C C PG+TG RC       +E+  C+S  C NGG C    N S  C CK  FTG +C     +  + +  N
Sbjct:  616 CSSSPCVHGACRE--DPDGYRCECEPGWVGKNCDLDRNDCLPNPCQNAGTCIDQLNG-FTCKCRQGFRGGGPTCAEVLTPCSPNPCSNHAVCTHTPDYFGYQCNCQPGWQGHLCNIDVNECASNPCKNRGTCTNTLGGYVCSCRGGYSGPNCETDINDCLPNPCMSGGSCTDGINTFYCTCLPGFTGPRC------AIEVDECQSAPCKNGGTCTDYVN-SYTCTCKPGFTGLHCETNAMDCTESSCFN 854          

HSP 3 Score: 98.2117 bits (243), Expect = 4.883e-20
Identity = 77/277 (27.80%), Postives = 111/277 (40.07%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLNVN----------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKR--ELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +N F   CL      +       C + PC NG     +   + C+C  G+ G  CE N  DC ++ C NGGTC+DK N  F+C C   F G  CQ+E       PCLN                                    C+NGG C   +     C C  G+ G +C +  ++C +   ++   ELC+  G C +    T +CKC   YTG  C+ + +      C+   C NG  C+    G   C+C   + G+NC   + E R     N
Sbjct:  786 INTFYCTCLPGFTGPRCAIEVDECQSAPCKNGGTCTDYVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTCVDKING-FSCTCRVGFTGEHCQYEVNECDSQPCLNGGVCQDGLESFRCSCPKGYTGSRCQVRVDWCRHSNPCQNGGRCRPKDG---SCDCVGGWSGRYCDIPGVSCEMAAMQRGLYELCHRGGHC-VNTGNTHYCKCPNDYTGSYCESQVDH-----CEDKPCLNGATCRGYVGGY-TCDCMPGYEGQNCEREINECRSHPCQN 1051          

HSP 4 Score: 97.8265 bits (242), Expect = 5.314e-20
Identity = 73/202 (36.14%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C + PC N   C++    EF C C  G+ G  CE ++++C  NPC N G C D  N+ FTC C + F G +CQ + + C +  C+NG  C    NG ++C+C  GF G  C      C   P        +HG C +    +  C C PGYTG RC+ +        C S+ C NGG C  L N   IC+C+   +G NC I
Sbjct:  352 CLSMPCQNDATCLDRIG-EFTCICMPGYTGTHCEIDIDECESNPCVNDGICRDLVNA-FTCTCQTGFTGTMCQIDIDECASTPCQNGAKCIDRPNG-YECRCAEGFEGRLCESNIDNCQPDPC-------HHGTC-VDGIASYTCNCVPGYTGYRCENQLNE-----CHSNPCQNGGKCVDLVNKY-ICQCQHGTSGTNCEI 536          

HSP 5 Score: 90.1225 bits (222), Expect = 1.330e-17
Identity = 69/235 (29.36%), Postives = 119/235 (50.64%), Query Frame = 2
Query: 2243 DEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            D  YQ +SL   G   +  GE+ +H+AAR        + ++A   +  ++ D  GRTPL +++A+DA +   Q+LI  +    +++                       +TALI A +L  + M+  L+   + VN +D  G+S +HW+A  NN   +E    +       D++D ++++PLFLAA EG+ ++VK LLA+F    I   MD     P+ IA+++  ++I  L+ E
Sbjct: 1712 DLIYQGASL---GAQTDRTGETALHLAARYARADAAKRLLDA--GADANAQDNTGRTPLHAAVASDA-QGVFQILIRTRATDLDAR-------------------MYDGSTALILAARLAVEGMVEELITCHADVNAVDELGKSALHWAAAVNN---VEATVALLKNGANKDMQDLKEETPLFLAAREGSCEAVKILLAHFANREITDHMDRL---PRDIAQDRMHHDIVQLLDE 1915          

HSP 6 Score: 87.0409 bits (214), Expect = 1.278e-16
Identity = 67/214 (31.31%), Postives = 95/214 (44.39%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+  PC NG     ++  + CSC  G++G+ C  ++++C +   C NGG CI+   S F C C S + G  C+    PC    C NGGTC    +  ++C C  GF G  C V    CP         C N G C    N T  C+C P +TG  C +      E   + + C NGG C     G   C C   +TG +C+  + +       N
Sbjct:   41 CATSPCANGARCTNWNNHYNCSCPPGFQGKNCRNDIDECRKPGKCLNGGICINTHGS-FRCECVSGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCP------GHKCMNGGTCVDGVN-TYNCQCPPEWTGQYCAEDVN---ECLMQPNACHNGGTCFNTIGGH-TCVCVNGWTGDDCSENIDDCATAVCFN 242          

HSP 7 Score: 76.2554 bits (186), Expect = 2.219e-13
Identity = 65/206 (31.55%), Postives = 95/206 (46.12%), Query Frame = 2
Query:  353 PCVNGKC----VEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            PC+NG      V    P+F C C  G++G+ C   ++ C  +PC NG  C +  N+ + C+C   F G  C+ + + C     C NGG C +  +G F+C+C  G+ G  C V     P  P +    C N G C    + T  C C PG+ G  C+   +      C    C NGG C V    +  C+C  E+TG+ C   + E
Sbjct:    4 PCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSL-IDACATSPCANGARCTN-WNNHYNCSCPPGFQGKNCRNDIDECRKPGKCLNGGICINT-HGSFRCECVSGYSGRTCEVPTQ--PCAPSQ----CLNGGTCHQTGDHTYECACLPGFGGTNCEVNVD-----DCPGHKCMNGGTC-VDGVNTYNCQCPPEWTGQYCAEDVNE 194          

HSP 8 Score: 74.7146 bits (182), Expect = 6.931e-13
Identity = 63/221 (28.51%), Postives = 93/221 (42.08%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN------------------------------------SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNG 889
            C + PCVN          F C+C  G+ G  C+ ++++C   PC+NG  CID+ N                                    + +TCNC   + G  C+ + N C +  C+NGG C  L N  + C+C++G  G  C +    C   P +       +G C    N    C C PG+TG +C+      VE+  C S+ C NGG C   +NG
Sbjct:  390 CESNPCVNDGICRDLVNAFTCTCQTGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCQPDPCHHGTCVDGIASYTCNCVPGYTGYRCENQLNECHSNPCQNGGKCVDLVN-KYICQCQHGTSGTNCEINYDDCASNPCE-------YGMCKDGINR-YDCVCKPGFTGPQCN------VELDECSSNPCRNGGTCVDDENG 595          

HSP 9 Score: 73.9442 bits (180), Expect = 1.189e-12
Identity = 57/174 (32.76%), Postives = 76/174 (43.68%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVC 871
            C+NG         FRC C  G+ G TCE     C  + C NGGTC    +  + C C   F G  C+   + C    C NGGTC    N  + C+C   + G++CA     C + P      C+N G C +     T  C C  G+TGD C +  +      C +  CFNG  C
Sbjct:   85 CLNGGICINTHGSFRCECVSGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCPGHKCMNGGTCVDGVN-TYNCQCPPEWTGQYCAEDVNECLMQPNA----CHNGGTCFNTIGGHT--CVCVNGWTGDDCSENID-----DCATAVCFNGATC 246          

HSP 10 Score: 65.0846 bits (157), Expect = 5.756e-10
Identity = 53/175 (30.29%), Postives = 73/175 (41.71%), Query Frame = 2
Query:  461 QNPCKNGGTC---IDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            ++PC NG  C   +     QFTC C   F G  C   + C    C NG  C +  N  + C C  GF G+ C      C     +K   C N G C I  + +  C+C  GY+G  C    E+P +  C    C NGG C    + +  C C   F G NC + + +      +N
Sbjct:    2 RSPCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSLIDACATSPCANGARCTNWNN-HYNCSCPPGFQGKNCRNDIDEC-----RKPGKCLNGGIC-INTHGSFRCECVSGYSGRTC----EVPTQP-CAPSQCLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCPGHKCMN 164          
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.552e-22
Identity = 72/210 (34.29%), Postives = 101/210 (48.10%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRK 961
            CS  PC NG +C++     + C C  G+ G+ CE ++++C  +PC+NGG C++   S FTC+C + + G LC  + + C +  C+NGG C +   G F C C  G+ G  C      C   P      C N G C     +  F C+C PG+TG RC+          C S  C NGG C+     +  CEC   FTG  C   L    K
Sbjct:   15 CSPNPCQNGGRCIDGA-ASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGS-FTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGA-GSFTCSCLAGYTGTLCDSDVNECASSP------CLNGGRC--RDGVAAFTCECAPGFTGTRCETDVNE-----CASSPCLNGGRCRD-GVAAFTCECAPGFTGTRCETVLNPCTK 207          

HSP 2 Score: 78.9518 bits (193), Expect = 1.219e-16
Identity = 61/179 (34.08%), Postives = 81/179 (45.25%), Query Frame = 2
Query:  443 NVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +V++C  NPC+NGG CID   S +TC+C   F G  C+ + + C +  C+NGG C +   G F C C  G+ G  C      C   P      C N G+C +    +  C C  GYTG  CD          C S  C NGG C+     +  CEC   FTG  C   + E      +N
Sbjct:   11 DVDECSPNPCQNGGRCIDGAAS-YTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGA-GSFTCSCLAGYTGTLCDSDIDECTSDP------CQNGGQC-VNGAGSFTCSCLAGYTGTLCDSDVNE-----CASSPCLNGGRCRD-GVAAFTCECAPGFTGTRCETDVNECASSPCLN 174          
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 98.5969 bits (244), Expect = 5.149e-21
Identity = 82/243 (33.74%), Postives = 112/243 (46.09%), Query Frame = 2
Query:  257 ELIMIFAKGFPMNVFILGCLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            ++I       P N    G  +  V+S +C      NG+C+      F C C  G++G  C ENVNDC +  C NGGTC+D  NS F C C   + G  C+ + + C N N C NGGTC  L N  F C+C+ G+ G+ C  +      I       CNN GEC D+    T  C C  G+ G  C+    +   I C  + C NG  C V+   S  C C+  + G NCT  + +       N
Sbjct:  439 QVIDSCTVAVPSNTSESG--VAHVTSTVCG----PNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINS-FQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVND-FSCECKNGWKGKTCHSK------ISHCDEATCNNGGECFDV--GDTFRCSCPTGWEGPTCN----IAQSIACMPNPCQNGATC-VISGDSYKCICQSGWEGANCTQDINDCSSHPCYN 660          

HSP 2 Score: 88.9669 bits (219), Expect = 4.261e-18
Identity = 72/236 (30.51%), Postives = 101/236 (42.80%), Query Frame = 2
Query:  347 NRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF------ENPCLNVN--------------------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            N  C NG         ++C C  GW G  C E++++C  +PC NGGTC++  N  F C C  Q+ G+ C        +NPC++                                  C NGGTC+ L N  + C+C+ G+ G  C  +   C   P      C N G+C    + + +C C  G+ GD C    EL V++ C  + C NG  C  L NG   C C   F G NCT+
Sbjct:  207 NNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNG-FRCTCPPQWTGHTCLVDTDECDDNPCVHARSCKNLFGGYYCGCLPGWTGQNCDIDVNDCEGKCLNGGTCKDLVND-YSCECKPGYTGRRCETEVNECASHP------CLNGGQCRDAID-SYYCVCMDGFAGDSC----ELDVDL-CVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTL 428          

HSP 3 Score: 80.8777 bits (198), Expect = 1.352e-15
Identity = 95/367 (25.89%), Postives = 143/367 (38.96%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ------FENPCLNVN----------------------CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKS--PSLCDN-------------LCKASFENGICDQ---QCNTFACNYDGGDC---DPWRKC------YGNDLKHCKGV--FNDGVCNPECNNVDCL 1231
            C++ PC+NG +C +A D  + C C  G+ G++CE +V+ C+ NPC+NG  C++  N  + C+C+  F G  C         +PC  ++                      C   G C S   G F C C  GF G FC      C          C+N G C    N +  C C  G+ G+ C+      V+     + C NGG C  L N    CECK  + GK C   +    +    N               P  +      I ++ +  P+ C N             +C++ +E   C Q    C++  C Y+GG C     W +C       G D+  C+ +    D  C  E N   C+
Sbjct:  356 CASHPCLNGGQCRDAID-SYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDC------AEGACHNGGTCLDGIN-SFQCMCPDGWDGEFCEND----VDDCSNHNPCLNGGTCHDLVNDFS-CECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISGDSYKCICQSGWEGANCTQDINDCSSHPC-YNGGTCVDGTNWYRCECAAGFAGEDINECQSMPCAKDATCIDEINGYRCM 708          

HSP 4 Score: 77.411 bits (189), Expect = 1.521e-14
Identity = 54/166 (32.53%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  323 IVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKE 817
            +V +  C + PCV+ +  +     + C C  GW G+ C+ +VNDC +  C NGGTC D  N  ++C C   + G  C+ E N C +  C NGG C    +  + C C  GF G+ C +    C   P      C N   C   PN   FC C   + G  C   K+
Sbjct:  275 LVDTDECDDNPCVHARSCKNLFGGYYCGCLPGWTGQNCDIDVNDC-EGKCLNGGTCKDLVN-DYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYY-CVCMDGFAGDSCELDVDLCVPNP------CQNGARCVNLPNGDYFCHCSENFEGTNCTLLKD 431          

HSP 5 Score: 71.633 bits (174), Expect = 1.041e-12
Identity = 66/249 (26.51%), Postives = 99/249 (39.76%), Query Frame = 2
Query:  356 CVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCI-QNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-----------------------------------------NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CV+G C + ++    C C   W G  C++++N C    PC+NGG+C + +   + C+C   + G  C+ +                                         + C +  C NGGTC +L NG F+C C   + G  C V    C   P      C N     ++     +C C PG+TG  CD      +++      C NGG CK L N    CECK  +TG+ C   + E      +N
Sbjct:  134 CVHGGCSKPWE----CRCDTNWGGLLCDKDLNYCGNHQPCRNGGSCSNAQPDSYKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNG-FRCTCPPQWTGHTCLVDTDECDDNPCVHARSCKN-----LFGG--YYCGCLPGWTGQNCD------IDVNDCEGKCLNGGTCKDLVNDYS-CECKPGYTGRRCETEVNECASHPCLN 363          

HSP 6 Score: 69.707 bits (169), Expect = 3.943e-12
Identity = 47/154 (30.52%), Postives = 66/154 (42.86%), Query Frame = 2
Query:  323 IVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPG 784
            I  S  C   PC NG         ++C C  GW+G  C +++NDC  +PC NGGTC+D  N  + C C + F G   +  N C ++ C    TC    NG ++C C  G  G  C  +    P +   +     NH     +      C C  G
Sbjct:  609 IAQSIACMPNPCQNGATCVISGDSYKCICQSGWEGANCTQDINDCSSHPCYNGGTCVDGTN-WYRCECAAGFAG---EDINECQSMPCAKDATCIDEING-YRCMCPLGRAGRHCHDEVPTQPCVASGR-----NHSHGSSWKEECNMCHCSNG 752          
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 3.947e-20
Identity = 48/144 (33.33%), Postives = 72/144 (50.00%), Query Frame = 2
Query:  377 EAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD 805
            E  +P   C+C  G+ G  CE ++++C+  PC++GG+C +     F C C   F G  C+ + + CL   C+NGG C + + G F C C  GF G+ C V    C   P      C N+G C +       C+C  G +G RC+
Sbjct: 1510 EVLEPAV-CTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGG-FACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGG-FACDCSAGFSGKICDVTVDNCASSP------CYNNGSC-VNTATGYSCRCPFGMSGARCE 1643          

HSP 2 Score: 86.2705 bits (212), Expect = 3.701e-17
Identity = 36/110 (32.73%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC 667
            C + PC +G   +     F C C  G+ G  CE +V++C++ PC+NGG C + +   F C+C++ F G +C    + C +  C N G+C +   G + C+C +G  G  C
Sbjct: 1535 CLSTPCRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGG-FACDCSAGFSGKICDVTVDNCASSPCYNNGSCVNTATG-YSCRCPFGMSGARC 1642          

HSP 3 Score: 77.0258 bits (188), Expect = 2.946e-14
Identity = 52/189 (27.51%), Postives = 74/189 (39.15%), Query Frame = 2
Query:  443 NVNDCIQ-NPCKNGGTCIDKKNSQFT---------------------CNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            NV+ C   +PC NGG C  +     T                     C CT+ + G  C+ + + CL+  C +GG+C++L  G F C+C  GF G  C      C   P +   LC+N             C C  G++G  CD   +      C S  C+N G C     G   C C    +G  C +
Sbjct: 1470 NVDPCAAPSPCANGGHCAKRLAVGPTTTVVESASVILVSHEVLEPAVCTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGG-FACRCLPGFSGTACETDVDECLEGPCQNGGLCHN-------TQGGFACDCSAGFSGKICDVTVD-----NCASSPCYNNGSCVNTATGYS-CRCPFGMSGARCEL 1644          
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 3.953e-20
Identity = 48/144 (33.33%), Postives = 72/144 (50.00%), Query Frame = 2
Query:  377 EAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD 805
            E  +P   C+C  G+ G  CE ++++C+  PC++GG+C +     F C C   F G  C+ + + CL   C+NGG C + + G F C C  GF G+ C V    C   P      C N+G C +       C+C  G +G RC+
Sbjct: 1510 EVLEPAV-CTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGG-FACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGG-FACDCSAGFSGKICDVTVDNCASSP------CYNNGSC-VNTATGYSCRCPFGMSGARCE 1643          

HSP 2 Score: 86.2705 bits (212), Expect = 3.705e-17
Identity = 36/110 (32.73%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC 667
            C + PC +G   +     F C C  G+ G  CE +V++C++ PC+NGG C + +   F C+C++ F G +C    + C +  C N G+C +   G + C+C +G  G  C
Sbjct: 1535 CLSTPCRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGG-FACDCSAGFSGKICDVTVDNCASSPCYNNGSCVNTATG-YSCRCPFGMSGARC 1642          

HSP 3 Score: 77.0258 bits (188), Expect = 2.949e-14
Identity = 52/189 (27.51%), Postives = 74/189 (39.15%), Query Frame = 2
Query:  443 NVNDCIQ-NPCKNGGTCIDKKNSQFT---------------------CNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            NV+ C   +PC NGG C  +     T                     C CT+ + G  C+ + + CL+  C +GG+C++L  G F C+C  GF G  C      C   P +   LC+N             C C  G++G  CD   +      C S  C+N G C     G   C C    +G  C +
Sbjct: 1470 NVDPCAAPSPCANGGHCAKRLAVGPTTTVVESASVILVSHEVLEPAVCTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGG-FACRCLPGFSGTACETDVDECLEGPCQNGGLCHN-------TQGGFACDCSAGFSGKICDVTVD-----NCASSPCYNNGSCVNTATGYS-CRCPFGMSGARCEL 1644          
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002643.1 (pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 gene:ENSPMAG00000002413.1 transcript:ENSPMAT00000002643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 9.808e-18
Identity = 68/207 (32.85%), Postives = 101/207 (48.79%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICEC-KGEFTGKNCTIPLKE 952
            C++ PC++G  C+ A D  F C C  G+ G+ CE +V  C   PC N   C+D+    + C C   F G  C+ + N C +  C +GGTC +  +  + C C  GF GE C +    C   P      C+N   C +  +    C C  GYTG  C+ + +      C+S  C NGGVC  L + S  C+C +  + GK+C + + E
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGG-YKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRD-RYSCACPDGFAGERCQLDTNECASQP------CHNGATC-VDLDGKFECVCPRGYTGAMCETEVDE-----CESGPCQNGGVCIDLVD-SYTCDCLETGYEGKDCELEILE 192          

HSP 2 Score: 81.2629 bits (199), Expect = 1.085e-16
Identity = 66/233 (28.33%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKC-RYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD------------------NGSPI-CECKGEFTGKNCTIPLKETRKEALIN 976
            C++ PC++G         + C+C  G+ GE C+ + N+C   PC NG TC+D  + +F C C   + G +C+ E + C +  C+NGG C  L +  + C C   G+ G+ C ++ + C   P +    C       I   +   C C PG+ GD C++         C  + C NGG C  L                   N S   C C    TG+NC++ L E   +  +N
Sbjct:   78 CASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVD-LDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVD-SYTCDCLETGYEGKDCELEILECASNPCRHNSTC-------IEGILNFTCICWPGFAGDACEEDVNE-----CGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLN 296          

HSP 3 Score: 78.9518 bits (193), Expect = 7.732e-16
Identity = 75/223 (33.63%), Postives = 103/223 (46.19%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNC-TSQFIGNLCQFEN-PCLNVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC------DIYPNMT-------------LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDN-GSPICECKGEFTG 925
            + +  C+++PC NG      D +F C C  G+ G  CE  V++C   PC+NGG CID  +S +TC+C  + + G  C+ E   C +  C +  TC E + N  F C C  GF G+ C      C        E C N G+C      D Y  ++               C+C PG TG+ C    +      C+S  C NGG C  +DN GS  CEC   FTG
Sbjct:  111 LDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDS-YTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILN--FTCICWPGFAGDACEEDVNEC------GDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDE-----CESQPCLNGGSC--IDNIGSFSCECAPGFTG 317          
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Match: EDO46513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPI0])

HSP 1 Score: 104.375 bits (259), Expect = 9.432e-25
Identity = 77/221 (34.84%), Postives = 113/221 (51.13%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPK 991
            + CS++PC NG      +  + C+C  G+ G+ CE++VN+C +NPCKNGG C + ++  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF G+ C      C   P K   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGK C   + E  K    N  + K
Sbjct:    2 ETCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSENPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSENPCKNGGVCKNEHG--------GYSCACKAGFTGKNCEQDVNE-----CSKNPCQNGGVCK-NEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCK 206          
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Match: EDO48851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH9])

HSP 1 Score: 111.309 bits (277), Expect = 1.512e-24
Identity = 91/283 (32.16%), Postives = 135/283 (47.70%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKT---------------FNEKQLIIKKTKSP----SLCDN-------LCKASFENGICDQQCN 1099
            + CS++PC NG      +  + C+C  G+ G+ CE++VN+C +NPCKNGG C + ++  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF G+ C      C   P +   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGKNC   + E  K    N  + K                 N +Q + + +K+P     +C N        CKA F   IC+Q  N
Sbjct:  990 ETCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECNKNPCQNGGVCKN-EHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHG--------GYSCACKAGFTGKNCEQDVNE-----CSKNPCKNGGVCK-NEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVN 1256          

HSP 2 Score: 105.916 bits (263), Expect = 6.340e-23
Identity = 79/219 (36.07%), Postives = 111/219 (50.68%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPK 991
            CS  PC NG   +     + C+C  G+ G+ CE++VN+C  NPCKNGG C + ++  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF G+ C      C V P K   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGKNC   + E  K    N  + K
Sbjct:  220 CSKNPCKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKN-EHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHG--------GYSCACKAGFTGKNCEQDVNE-----CSKNPCKNGGVCK-NEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCK 422          

HSP 3 Score: 104.76 bits (260), Expect = 1.693e-22
Identity = 74/200 (37.00%), Postives = 106/200 (53.00%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            CS  PC NG   +     + C+C  G+ G+ CE++VN+C +NPCKNGG C + ++  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF+G+ C      C   P K   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGKNC
Sbjct:  372 CSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKN-EHGGYSCACKAGFMGKNCEQDVNECSKNPCKNGGVCKNEHG--------GYSCACKAGFTGKNCEQDVNE-----CSKNPCKNGGVCK-NEHGGYSCACKAGFTGKNC 555          

HSP 4 Score: 96.2857 bits (238), Expect = 5.499e-20
Identity = 72/206 (34.95%), Postives = 106/206 (51.46%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG   +     + C+C  G+ G+ CE++VN+C +NPC+NGG C + ++  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF G+ C      C   P +   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGK C   + E
Sbjct:  730 CSKNPCQNGGVCKNEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKN-EHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKN-EHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHG--------GYSCTCKAGFTGKNCEQDVNE-----CSKNPCKNGGVCK-NEHGGYSCACKAGFTGKICEQEICE 919          

HSP 5 Score: 87.0409 bits (214), Expect = 3.941e-17
Identity = 75/232 (32.33%), Postives = 107/232 (46.12%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKK-------------------------KELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC-TIPLKE 952
            CS  PC NG   +     + C+C  G+ G+ CE++VN+C +NPCKNGG C ++ +  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF G+ C      C   P K   +C N HG           C C  G+TG   +K                             P +  CK + C N G C +   GS  C C  E+TGK+C T   KE
Sbjct: 1258 CSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNE-HGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKN-EHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHG--------GYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKC-INTPGSYKCNCIDEYTGKHCETAKYKE 1478          

HSP 6 Score: 86.6557 bits (213), Expect = 4.589e-17
Identity = 71/219 (32.42%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  443 NVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQ 1093
            +VN+C +NPC+NGG C + ++  ++C C + F G +C+ + N C    C+NGG C++ E+G + C C+ GF G+ C      C   P +   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGKNC   + E  K    N  + K  +                  CKA F   IC+Q+
Sbjct:  726 DVNECSKNPCQNGGVCKN-EHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKN-EHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHG--------GYSCTCKAGFTGKNCEQDVNE-----CNKNPCQNGGVCK-NEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSC------------ACKAGFTGKICEQE 916          

HSP 7 Score: 76.6406 bits (187), Expect = 5.304e-14
Identity = 62/194 (31.96%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGE---------------------FCAVQNIACPVIPKK---KRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSD 847
            CS  PC NG   +     + C+C  G+ G+ CE++VN+C +NPCKNGG C ++ +  ++C C + F G  C+ + N C    C+NGG C++ E+G + C C+ GF G+                       A+++      P K   K   C N+G+C   P  +  C C   YTG  C+  K    E+GC  D
Sbjct: 1296 CSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNE-HGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKN-EHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKCINTPG-SYKCNCIDEYTGKHCETAKYK--ELGCYKD 1484          

HSP 8 Score: 60.4622 bits (145), Expect = 4.894e-9
Identity = 63/184 (34.24%), Postives = 89/184 (48.37%), Query Frame = 2
Query:  407 CWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELC-NNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C+H W G+TC  N    ++N    GG  + + N    C+   ++ GN  +F+ N C    C+NGG C++ E+G + C C+ GF G+ C      C V P K   +C N HG           C C  G+TG  C++         C  + C NGGVCK  ++G   C CK  FTGKNC   + E
Sbjct:  172 CYH-WSGKTCHWNNAIRVRNC---GGFYVYELNRPPVCH--LRYCGNA-EFDVNECSKNPCKNGGVCKN-EHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHG--------GYSCACKAGFTGKNCEQDVNE-----CSVNPCKNGGVCK-NEHGGYSCACKVGFTGKNCEQDVNE 333          
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Match: EDO36196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC3])

HSP 1 Score: 103.605 bits (257), Expect = 1.128e-23
Identity = 106/353 (30.03%), Postives = 143/353 (40.51%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN------------IKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACN----YDGGDCDPWRKCYGNDLKHCKG--VFNDGVCN-----------PECNNVDCLFDGEDCHKSSC-KFHKCSELYQNKIC 1306
            C++ PCVNG         F C+C  G+ G  CE ++N+C  NPC NGGTC D+ NS F+C C S + G  C+ + N C +  C NGGTC  L NG + CKC+ G+ G  C +       I +     C N G C    N    C C PGY G +C+          C+++ C NGG C    N S  C C   +TG  C   + E      +N               P  +N  +  I   +  S            G C  Q N+F+C     Y G  C+        D+  C      N G C            P  N   C  D ++C  + C     CS+L  N  C
Sbjct:    5 CASNPCVNGGTCTDLVNGFHCTCPPGYNGTKCEIDINECDSNPCANGGTCADQVNS-FSCTCVSGYTGLQCKTDINECASNPCLNGGTCNDLVNG-YNCKCQPGYNGTTCEID------INECASNQCVNGGTCTDLVNG-FNCTCPPGYNGTKCEININE-----CENNPCVNGGTCADQVN-SFSCTCVSGYTGLKCETDINECASNPCVNGGTCTDLVNGFHCTCPPGYNGTKCEIDINECES------NPCANGGTCADQVNSFSCTCVLGYTGLKCE-------TDIDECASNPCINGGTCTELVNGFKCTCVPGYNGTRCEIDIDECSSNPCLNGATCSDLLNNYTC 329          

HSP 2 Score: 83.9593 bits (206), Expect = 3.494e-17
Identity = 59/156 (37.82%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD 805
            C++ PCVNG         F C+C  G+ G  CE ++N+C  NPC NGGTC D+ NS F+C C   + G  C+ + + C +  C NGGTC  L NG F+C C  G+ G  C +    C   P      C+     D+  N T  C C  G+ G+RC+
Sbjct:  195 CASNPCVNGGTCTDLVNGFHCTCPPGYNGTKCEIDINECESNPCANGGTCADQVNS-FSCTCVLGYTGLKCETDIDECASNPCINGGTCTELVNG-FKCTCVPGYNGTRCEIDIDECSSNPCLNGATCS-----DLLNNYT--CTCASGFQGERCE 341          

HSP 3 Score: 73.9442 bits (180), Expect = 7.851e-14
Identity = 65/180 (36.11%), Postives = 81/180 (45.00%), Query Frame = 2
Query:  443 NVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            ++N+C  NPC NGGTC D  N  F C C   + G  C+ + N C +  C NGGTC    N  F C C  G+ G  C      C   P      C N G C+   N    CKC PGY G  C+      ++I  C S+ C NGG C  L NG   C C   + G  C I + E      +N
Sbjct:    1 DINECASNPCVNGGTCTDLVNG-FHCTCPPGYNGTKCEIDINECDSNPCANGGTCADQVN-SFSCTCVSGYTGLQCKTDINECASNP------CLNGGTCNDLVNG-YNCKCQPGYNGTTCE------IDINECASNQCVNGGTCTDLVNGFN-CTCPPGYNGTKCEININECENNPCVN 164          

HSP 4 Score: 56.6102 bits (135), Expect = 3.200e-8
Identity = 34/95 (35.79%), Postives = 48/95 (50.53%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ 556
            +N F   C+L     K       C++ PC+NG         F+C+C  G+ G  CE ++++C  NPC NG TC D  N  +TC C S F G  C+
Sbjct:  248 VNSFSCTCVLGYTGLKCETDIDECASNPCINGGTCTELVNGFKCTCVPGYNGTRCEIDIDECSSNPCLNGATCSDLLN-NYTCTCASGFQGERCE 341          
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Match: EDO34703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM7])

HSP 1 Score: 103.99 bits (258), Expect = 2.188e-22
Identity = 74/206 (35.92%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
             C + PC NG         +RC C  G+ G+ CE   ++C  NPC NGG C+DK N  F C C S F G  C+     C    C N G C  +  G FQC C  G+ G+FC V    C      K   C N G+C    N +  C C  GY+G RC+ K       GC+ D C NG  C     G   C C   F+G  C   + E
Sbjct:  918 FCDSNPCNNGAQCNNMVDGYRCMCKSGFTGKNCEVEEDECTTNPCANGGACVDKING-FVCTCPSGFTGQFCEKATVDCKPGACRNNGKCVEIPGG-FQCLCSDGYEGDFCEVNTNEC------KSSPCLNGGKCTDGVN-SFTCNCPAGYSGGRCEDKTN-----GCRPDSCLNGATCTETSYGH-RCACVAGFSGNRCETDINE 1108          

HSP 2 Score: 80.1073 bits (196), Expect = 4.949e-15
Identity = 58/148 (39.19%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRC 802
            NGKCVE     F+C C  G++G+ CE N N+C  +PC NGG C D  NS FTCNC + + G  C+ + N C   +C NG TC     G  +C C  GF G  C      C   P      C N+G C +       C C PG++G  C
Sbjct: 1003 NGKCVE-IPGGFQCLCSDGYEGDFCEVNTNECKSSPCLNGGKCTDGVNS-FTCNCPAGYSGGRCEDKTNGCRPDSCLNGATCTETSYG-HRCACVAGFSGNRCETDINECASTP------CANNGLC-VDKEGGFTCLCKPGFSGTTC 1140          

HSP 3 Score: 70.4774 bits (171), Expect = 3.689e-12
Identity = 61/178 (34.27%), Postives = 77/178 (43.26%), Query Frame = 2
Query:  446 VNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +N C  NPC NG  C +  +  + C C S F G  C+  E+ C    C NGG C    NG F C C  GF G+FC    + C      K   C N+G+C   P     C C  GY GD C+          CKS  C NGG C    N S  C C   ++G  C       R ++ +N
Sbjct:  916 INFCDSNPCNNGAQCNNMVDG-YRCMCKSGFTGKNCEVEEDECTTNPCANGGACVDKING-FVCTCPSGFTGQFCEKATVDC------KPGACRNNGKCVEIPG-GFQCLCSDGYEGDFCEVNTNE-----CKSSPCLNGGKCTDGVN-SFTCNCPAGYSGGRCEDKTNGCRPDSCLN 1078          

HSP 4 Score: 65.4698 bits (158), Expect = 1.529e-10
Identity = 43/116 (37.07%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC 667
            V++  C + PC+NG KC +  +  F C+C  G+ G  CE+  N C  + C NG TC +       C C + F GN C+ + N C +  C N G C   E G F C C+ GF G  C
Sbjct: 1028 VNTNECKSSPCLNGGKCTDGVN-SFTCNCPAGYSGGRCEDKTNGCRPDSCLNGATCTETSYGH-RCACVAGFSGNRCETDINECASTPCANNGLCVDKEGG-FTCLCKPGFSGTTC 1140          
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Match: EDO48147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKD3])

HSP 1 Score: 97.0561 bits (240), Expect = 4.456e-22
Identity = 73/201 (36.32%), Postives = 97/201 (48.26%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT-LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C+  PC N G C   +  +F C+C  G++G+ C  ++  C +NPC+NGGTCI    S +TC CT    G  C+   + C +  C+N   C++  +  F C C  GF G+ C  +   C   P      C N G C +  N T  FC C PGYTG  C     L V+  C S  C NG  C +   G   CEC     GKNC
Sbjct:    4 CATNPCKNSGTCTSVYS-DFNCTCSSGFQGKDCSLDIEPCTKNPCQNGGTCIPSGPSVYTCTCTPGVTGANCETVADQCSSNPCQNNAECKTAGS-TFTCSCTAGFTGDLCDKELQPCVPSP------CGNGGTCRVINNGTDYFCTCAPGYTGANC----TLDVDE-CSSSPCQNGASC-IKKVGRYFCECSTAHVGKNC 190          

HSP 2 Score: 93.2041 bits (230), Expect = 1.074e-20
Identity = 77/235 (32.77%), Postives = 98/235 (41.70%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIP---------KKKRELC------------NNHGECDIYPNMT----------LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP-ICECKGEFTGKNCTI 940
            C+  PC NG  C+ +    + C+C  G  G  CE   + C  NPC+N   C     S FTC+CT+ F G+LC  E  PC+   C NGGTC  + NG  + C C  G+ G  C +    C   P         K  R  C             N  EC   P              FC+C   + G  C KK +      C S  C NGG C  + +GS   C C   +TGKNCT 
Sbjct:   42 CTKNPCQNGGTCIPSGPSVYTCTCTPGVTGANCETVADQCSSNPCQNNAEC-KTAGSTFTCSCTAGFTGDLCDKELQPCVPSPCGNGGTCRVINNGTDYFCTCAPGYTGANCTLDVDECSSSPCQNGASCIKKVGRYFCECSTAHVGKNCHKNVDECSSSPCQNGASCIKKVGRYFCECSTAHVGKNCHKKPDP-----CLSKPCANGGTCSPISSGSDYTCACAAGYTGKNCTA 270          

HSP 3 Score: 90.8929 bits (224), Expect = 7.275e-20
Identity = 65/179 (36.31%), Postives = 82/179 (45.81%), Query Frame = 2
Query:  446 VNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP-ICECKGEFTGKNCTIPLKETRKEALIN 976
            V+ C  NPCKN GTC     S F C C+S F G  C  +  PC    C+NGGTC      ++ C C  G  G  C      C   P      C N+ EC      T  C C  G+TGD CDK+ +      C    C NGG C+V++NG+   C C   +TG NCT+ + E       N
Sbjct:    1 VDKCATNPCKNSGTCTSVY-SDFNCTCSSGFQGKDCSLDIEPCTKNPCQNGGTCIPSGPSVYTCTCTPGVTGANCETVADQCSSNP------CQNNAECKTA-GSTFTCSCTAGFTGDLCDKELQP-----CVPSPCGNGGTCRVINNGTDYFCTCAPGYTGANCTLDVDECSSSPCQN 166          

HSP 4 Score: 63.1586 bits (152), Expect = 1.343e-10
Identity = 50/168 (29.76%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  335 KLCSNRPCVNGKCVEAFD--PEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECD-IYPNMTLFCKCDPGYTGDRCDKKKELPV 826
            + C   PC NG      +   ++ C+C  G+ G  C  +V++C  +PC+NG +CI KK  ++ C C++  +G  C    + C +  C+NG +C   + G + C+C    +G+ C  +   C   P      C N G C  I       C C  GYTG  C   K   V
Sbjct:  117 QPCVPSPCGNGGTCRVINNGTDYFCTCAPGYTGANCTLDVDECSSSPCQNGASCI-KKVGRYFCECSTAHVGKNCHKNVDECSSSPCQNGASCIK-KVGRYFCECSTAHVGKNCHKKPDPCLSKP------CANGGTCSPISSGSDYTCACAAGYTGKNCTAGKPRDV 276          
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Match: notch1b (notch receptor 1 [Source:NCBI gene;Acc:101161732])

HSP 1 Score: 203.371 bits (516), Expect = 2.977e-52
Identity = 247/995 (24.82%), Postives = 401/995 (40.30%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDC--IQNP------CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGT--CESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMT--LFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE---------------TRKEALINIKIPKTFNEKQLIIKKTKSPSLCDN---------------LCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSF----------FSNEGLTKCSTQTKLYELDLVLMT-------------------------------TMQNFTKYKSEFLQKLSSSLRMVVTVFNVT--EINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEY-----QIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDS--------------LESTDGIHPI------DAGL--GDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLA--DLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            C ++PC NG  C++  D  ++CSC  G +G  CE NV+DC    +P      C N G C+D+    + C C S ++G  C+ + N CL+  C+  GT  C  L N  ++C+CR G+ G+ C        V    K   C N G C +  N      C+C PG+TG  C+   +      C S  C NGG C +  + SP C C   FTG  C  P                  T +        P  FN     I     P    +                C+A   N  C+  CN   C +D GDC     DPW+ C  +    C   FNDG C+ +C+N  CL+DG DC     + +      C + Y +  CD+ CN+ +C +DG DC  +                  E L   ++ T L EL  VL T                               ++ ++ +  +E L  +  SL   V     T  E++       ++ L ++  QC     +CF S    + FL A +E    L +PF +  V + +   + +   PIY ++    +L F     +     R + G+L         W P    +T TS        G   +  LK  K  +      +P +  +GE +P TD       D++           R++   + +   L    I+ +              +   DG  P+        GL  G+         ++  D  YQ ++L       +  GE+ +H+AAR        + + A   + +   D  GRTPL +++AADA +   Q+LI  +    +++ +                     TT LI A +L ++ M+  L++  + VN +D  G+S +HW+A      +    + + + +  A  D+++N++++PLFLAA EG+ ++ K LL +F    I   MD     P+ IA+++  ++I  L+ E
Sbjct: 1187 CFSQPCQNGGTCIDLID-TYKCSCPRGTQGVHCEVNVDDCSPFTDPLTKEPKCFNKGKCVDRVGG-YHCICPSGYVGERCEGDVNECLSNPCDPRGTLSCIQLTNN-YRCECRAGYTGQRCDT------VFDGCKSRPCRNGGTCAVASNTPHGFICRCPPGFTGSTCEYDSQT-----CGSLRCRNGGTC-ISGHKSPKCLCPPSFTGPECRHPTDSACNSNPCYNGGTCELTPEAPYYRCICPFKFNGLLCHILDNGFPGGVGSSVPTLPEVTASCGIPQCEAYKHNKYCNTVCNNHECGWDNGDCSLNFDDPWKNCSAS--LQCWRYFNDGKCDSQCDNAGCLYDGFDCQNLEGQCNPLYDQYCRDHYADNHCDQGCNNAECEWDGLDCAKNLPEKLAVGRLVLVVHIRPEQLLN-TSSTFLRELSRVLRTNVLFRRDSNGEVMVYPYYGDEHELKKYNVKRSVDSWMEAPAEVLDVMKRSLYGAVGSSRRTKRELDHLQIKGSVVHLEMDNRQCFQQSSECFQSTTDAAAFLGA-LESSGKLDVPFTIEAVYSNVEPKNAQGLYPIYLVLAGVAVLAFLGVGMVAARKRRHEHGRL---------WLPEGFKTTETSKKKRREPVGEDSV-GLKPLKNSHISLMDDVPTE--WGEDEP-TDVKHFKQFDEQAALDADDQTDHRQWTQQHLDAADLRVPSIAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLH---NQTDRTGETALHLAARYARSDAAKRLLEASADANIQ--DNMGRTPLHAAVAADA-QGVFQILIRNRATDLDARMH-------------------DGTTPLILAARLAAEGMVEELINCHADVNAIDDFGKSALHWAAA-----VNNVEAAIVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMD---RLPRDIAQDRMHHDIVRLMDE 2116          

HSP 2 Score: 100.523 bits (249), Expect = 1.002e-20
Identity = 124/445 (27.87%), Postives = 165/445 (37.08%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGW------------------------------------------------KGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVI--PKKKRELCNNHGEC----------------------DIY--------PNMTLF---------CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC----DQQCNTFACNYDGGDCD-----PWRKC-----YGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDGGDC 1354
            C++ PC NG         +RC+C  GW                                                 G  CEE V++C  NPC+NG TC D     ++C C   F+G  C  E N C +  C+NGGTC  L +  ++C C  G  G  C V    C     P  K   C N G+C                      D+         P  TL          C+C  GYTG RCD      V  GCKS  C NGG C V  N +P   IC C   FTG  C     E   +   +++           I   KSP     LC  SF    C    D  CN+  C Y+GG C+     P+ +C     +   L H   + ++G      ++V  L +      +SC   +C     NK C+  CN+ +CG+D GDC
Sbjct: 1063 CNSSPCKNGGSCSQSGTTYRCNCETGWTGLYCDVPSVSCEVAAKQRGVDITQLCRNAGRCLDAGNVHRCHCQAGYTGSYCEEQVDECTPNPCQNGATCTDFLGG-YSCKCLPGFLGTNCSVEINECFSQPCQNGGTCIDLID-TYKCSCPRGTQGVHCEVNVDDCSPFTDPLTKEPKCFNKGKCVDRVGGYHCICPSGYVGERCEGDVNECLSNPCDPRGTLSCIQLTNNYRCECRAGYTGQRCDT-----VFDGCKSRPCRNGGTCAVASN-TPHGFICRCPPGFTGSTC-----EYDSQTCGSLRC----RNGGTCISGHKSPKC---LCPPSFTGPECRHPTDSACNSNPC-YNGGTCELTPEAPYYRCICPFKFNGLLCH---ILDNGFPGGVGSSVPTLPE----VTASCGIPQCEAYKHNKYCNTVCNNHECGWDNGDC 1479          

HSP 3 Score: 96.6709 bits (239), Expect = 1.272e-19
Identity = 78/249 (31.33%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC------------DIYPNMTLF------------------------CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            CS+ PC  G C +     F C C  G+ G  CE N+N+C+  PC+NGGTC D+ N+ + C+C     G  C+   + C N  C+N GTC    NG ++C C  G+ G  C +    C   P      C N G C            D Y + T F                        C CD G++G  CD          C+S+ C NGG CK + +G  +C C+  FTG NC   + E      +N
Sbjct:  570 CSSDPCHYGTCKDGL-ASFSCDCTPGYTGRLCETNINECLSLPCRNGGTCQDRPNA-YICSCPKGTGGINCEINIDDCKNNLCKN-GTCIDRING-YECACEPGYTGTMCNIDIDECAANP------CRNGGTCIDGINAFTCKCPDGYQDPTCFSQVNECLSNPCIHGHCEDKINGYKCLCDSGWSGKNCDINNNE-----CESNPCMNGGTCKDMTSGY-VCTCRMGFTGPNCQTNINECASNPCLN 802          

HSP 4 Score: 93.5893 bits (231), Expect = 1.086e-18
Identity = 68/219 (31.05%), Postives = 99/219 (45.21%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGM-FQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +++  C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC +  C++GG C   E+ + F C C  G+ G+ C V    C   P      C N          +  C C PG+TG  C+   +      CK + C NGG+CK   N   +C C   F G  C   + E       N
Sbjct:  752 INNNECESNPCMNGGTCKDMTSGYVCTCRMGFTGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCVLPYTGENCETLMAPCHSKPCKHGGVCRESEDYLSFSCACPEGWQGQTCEVDIKECVKNPCLNGATCQNT-------LGSYHCSCKPGFTGRNCEANMD-----DCKPNPCNNGGLCKDEVNDF-LCTCLLGFRGTTCEEDINECESSPCKN 956          

HSP 5 Score: 90.8929 bits (224), Expect = 8.958e-18
Identity = 72/204 (35.29%), Postives = 89/204 (43.63%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            V  K C   PC+NG   +     + CSC  G+ G  CE N++DC  NPC NGG C D+ N  F C C   F G  C+ + N C +  C+NG  C    N  + C C  GF G  C          P      C N G C    N    C C PG+TG+ C           C S  C NGG C+    G+  C C   +TG NC
Sbjct:  868 VDIKECVKNPCLNGATCQNTLGSYHCSCKPGFTGRNCEANMDDCKPNPCNNGGLCKDEVN-DFLCTCLLGFRGTTCEEDINECESSPCKNGANCTDCVNS-YTCTCPAGFSGINCENN------TPDCTESSCFNGGTCVDGIN-AFTCLCPPGFTGNYCQHDINE-----CDSKPCMNGGTCQD-SYGTYKCTCPHGYTGLNC 1056          

HSP 6 Score: 88.5817 bits (218), Expect = 4.490e-17
Identity = 74/240 (30.83%), Postives = 106/240 (44.17%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ---FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCA-----VQNIAC--------------PVIPKKKREL------------CNNHGECDIYP-NMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C+  PC+NG  C++  +  + CSC  G+ G+ C  N+NDC  + C+NGGTC+D  N+ + C C  +F G LC     E   +   C+NGGTC +   G +QC C  G+ G  C+       + AC                 PK +  L            C     CD  P     FC C PGY G  CDK  +   E     + C + G C +   GS  C+C+  + G  C + + E
Sbjct:  222 CNPSPCLNGGTCIQKGETSYECSCVPGFTGKNCSSNINDCPGHECQNGGTCVDGVNT-YNCQCKPEFTGQLCMDDVDECQLMPNACQNGGTCHNTY-GSYQCVCVNGWTGNDCSKNIDDCADAACYKGSTCHDRVASFYCECPKGRTGLLCQLDDACISNPCQKGSNCDTNPITGNHFCTCPPGYFGPSCDKDVD---ECSLGPNPCEHAGKC-LNTKGSFQCKCQRGYVGPRCEMDVNE 455          

HSP 7 Score: 87.8113 bits (216), Expect = 6.346e-17
Identity = 70/211 (33.18%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  326 VSSKLCSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            +++  C+N PC+N GKC++  +  F C C  G+ G  C+ ++++C   PCKNG  C D  N ++TC CT  + G  C+ E N C +  C  G   + L +  F C C  G+ G  C      C  +P      C N G C   PN    C C  G  G  C    E+ ++  CK++ C N G C    NG   C C+  +TG  C I + E
Sbjct:  489 INTDECANGPCLNSGKCIDKIN-GFHCECPTGFTGSLCQTDIDECASTPCKNGAKCTDGPN-KYTCECTEGYAGQHCETEINECSSDPCHYGTCKDGLAS--FSCDCTPGYTGRLCETNINECLSLP------CRNGGTCQDRPN-AYICSCPKGTGGINC----EINID-DCKNNLCKN-GTCIDRINGYE-CACEPGYTGTMCNIDIDE 681          

HSP 8 Score: 83.5741 bits (205), Expect = 1.335e-15
Identity = 69/204 (33.82%), Postives = 86/204 (42.16%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDP----EFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            C+N PC NG    A       +F C+C  G+    C   +N  C  +PC+N GTC  +    + C C     G  C   +PC +  C NGG C SL    F C C   F G+ C      C + P     LC N G C I       C+C   Y G  C+ +  LP    C    C NGG C      S  C C   FTGKNC+
Sbjct:   63 CNNSPCANGGTCRAVSKGNTVDFNCTCKLGFTDRRCMTPINTACFSSPCRNEGTCEPEGLQGYRCRCPPGLAGEDCSKADPCASNPCANGGRC-SLFESFFICTCTPFFSGQTCKQDINECDIQPP----LCKNGGLC-INEVGGYRCQCPAEYNGKHCETRY-LP----CNPSPCLNGGTCIQKGETSYECSCVPGFTGKNCS 255          

HSP 9 Score: 79.7221 bits (195), Expect = 1.919e-14
Identity = 55/165 (33.33%), Postives = 73/165 (44.24%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAVQ-NIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C N G C    +    C C   ++G+ CQF +PC N  C NGGTC ++  G    F C C+ GF    C    N AC   P      C N G C+        C+C PG  G+ C K         C S+ C NGG C + ++   IC C   F+G+ C   + E
Sbjct:   30 CLNQGRCEATPDGNGECKCRDGYVGSRCQFHDPCNNSPCANGGTCRAVSKGNTVDFNCTCKLGFTDRRCMTPINTACFSSP------CRNEGTCEPEGLQGYRCRCPPGLAGEDCSKADP------CASNPCANGGRCSLFESFF-ICTCTPFFSGQTCKQDINE 181          

HSP 10 Score: 75.8702 bits (185), Expect = 3.265e-13
Identity = 77/296 (26.01%), Postives = 111/296 (37.50%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKL------CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLN--------------------------------------------------VNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            +N F+  CLL    +        C + PC NG  C +  +  + C+C  G+ G  CE N  DC ++ C NGGTC+D  N+ FTC C   F GN CQ +       PC+N                                                   NCE                   G+ G +C V +++C V  K++     +LC N G C    N+   C C  GYTG  C+++ +      C  + C NG  C     G   C+C   F G NC++ + E   +   N
Sbjct:  926 VNDFLCTCLLGFRGTTCEEDINECESSPCKNGANCTDCVN-SYTCTCPAGFSGINCENNTPDCTESSCFNGGTCVDGINA-FTCLCPPGFTGNYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYTGLNCQDLVNWCNSSPCKNGGSCSQSGTTYRCNCET------------------GWTGLYCDVPSVSCEVAAKQRGVDITQLCRNAGRCLDAGNVHR-CHCQAGYTGSYCEEQVDE-----CTPNPCQNGATCTDFLGGY-SCKCLPGFLGTNCSVEINECFSQPCQN 1194          

HSP 11 Score: 74.3294 bits (181), Expect = 8.398e-13
Identity = 60/184 (32.61%), Postives = 81/184 (44.02%), Query Frame = 2
Query:  395 FRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            +RC C   + G+ CE     C  +PC NGGTCI K  + + C+C   F G  C    N C    C+NGGTC    N  + C+C+  F G+ C      C ++P      C N G C + Y   +  C C  G+TG+ C K  +      C    C+ G  C      S  CEC    TG  C +
Sbjct:  202 YRCQCPAEYNGKHCETRYLPCNPSPCLNGGTCIQKGETSYECSCVPGFTGKNCSSNINDCPGHECQNGGTCVDGVN-TYNCQCKPEFTGQLCMDDVDECQLMPNA----CQNGGTCHNTY--GSYQCVCVNGWTGNDCSKNID-----DCADAACYKGSTCHDR-VASFYCECPKGRTGLLCQL 372          
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:101162450])

HSP 1 Score: 183.341 bits (464), Expect = 4.243e-46
Identity = 235/940 (25.00%), Postives = 380/940 (40.43%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCK--NGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKREL-CNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKC---------STQTKLYELDLVLMTT------------MQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNV-LSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHL--HGDQ--EPDNPISINNRKRKYETINRNHQALAFQLISDSLESTD-----GIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSG---------------ANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYF---VKKTTALIEAVKLDS------------KEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            NG CV+     +RC+C  G+ GE CE ++N+C+ NPC   N   CI   N  + C C   F G  CQ + + C +  C+NGG C    +    + C C+ G+IG  C  ++++C       REL C N G C +  +    C C PGY G +C  +       GC S  C NGGVC   +   P   C+C  ++ GK C                       K L+++    P L D  C     + +CD++CNTFAC +DGGDC    +PW  C       C  VFN+  C+  CNN DCL+D  DC       +      C + Y +  CDE C + +CG+DG DC          +  +            ++   L++L ++L T+            ++ +T+ +  F ++L     ++ ++               + L ++   C     +CF S E+ + +L A     N+    P + AR        ++K + P   M     L+   +    I VLL       R K + + +W P                F   K P     ++E  +    +  +  PKT +   L  H DQ  +PD P     ++ K E  +         L+SD  ++ D       H   A +    TMA      +++      ++ G       +G + + +A+    G               ANII  +     S+    D  G T L   +AA    +     +L+      ++ N  RS ++          F   ++     ++A   D             + M+  L+   + VN +D  G+S +HW+A  NN      L      + + DLK   +++PLFLAA EG+ ++VK LLA+F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1045 NGTCVDRVG-GYRCNCPPGFTGERCEGDINECLSNPCSPSNSFDCIQLPN-DYQCVCKPGFTGRRCQNKFSVCESQPCQNGGACSVSSSSPLGYTCTCQLGYIGPNCE-RSMSC-------RELSCYNGGSCTLT-SRGARCSCLPGYGGPQCQHRSTE----GCSSKPCRNGGVC-TEETSYPYFSCQCSKDWAGKRC---------------------EHKSLVLQVPTCP-LSD--CHRKANDSVCDKECNTFACRWDGGDCSLAMNPWANCTN---PMCWRVFNNSQCDEACNNEDCLYDNFDCRNKEKVCNPIYETYCLDHYADGKCDEGCFTEECGWDGMDCGGKFPEDIVDDVLVLVVLLPPDELLRTSSAFLHKLSIILRTSVRFKLDQNGKALIRPYTRREGRFKRELEPQEEVIGSI---------------VYLELDNRMCSQGSEECFPSAERAAEYLGALSAVENLRFPYPLKTAR--------AEKIQPPDVEMPTWVQLMFAGMGSLFILVLLAIGMLMTRRKREHSTLWFPE--------------GFFLKKEPSSNKNRRE-PVGQDALGMKHMPKTVEESLLGDHSDQWMDPDCP---EPKRIKVEEPS---------LLSDCEDAVDCRQWTQHHLAAADIRVPPTMALTPPQGEFESDCMDVNVRG------PDGFTPLMLASFCGGGLESEVAEEEESEECSANIISDLIYQGASLAAQTDRTGETAL--HLAARYARADAAKRLLDAGADANAQDNTGRSPLHAAVAADAQGVFQILIRNRATDLDARMYDGSTALILAARLAVEGMVEELITCHADVNSVDELGKSALHWAAAVNNVDATVALLKNGANKDMQDLK---EETPLFLAAREGSCEAVKVLLAHFANREITDHMDRL---PRDIAQERMHHDIVQLLDE 1877          

HSP 2 Score: 113.235 bits (282), Expect = 1.106e-24
Identity = 110/381 (28.87%), Postives = 159/381 (41.73%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNV---------NCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI---CECKGEFTGKN-----------------CTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCN--TFAC----NYDGGDCDPWR---KCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH-----KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDC 1354
            C ++PC NG     +   ++C C  G+ G+ CE  +N+C  +PC+NGGTCID     + C+C    +G LC+      N           C N GTC     G ++C C  GF GE C      C   P       +N  +C   PN    C C PG+TG RC  K  +     C+S  C NGG C V  + SP+   C C+  + G N                 CT+  +  R   L     P+          + +S   C +  K     G+C ++ +   F+C    ++ G  C+      +     L  C    ND VC+ ECN   C +DG DC       ++C    C  ++ N  CDE CN+  C +D  DC
Sbjct:  953 CEDKPCRNGATCRPYVGGYQCDCMPGFMGQNCEREINECQSHPCQNGGTCIDLV-GHYICSCPPGTLGVLCEINEDDCNTPVRPRNAPPKCLNNGTCVDRVGG-YRCNCPPGFTGERCEGDINECLSNPCSP----SNSFDCIQLPN-DYQCVCKPGFTGRRCQNKFSV-----CESQPCQNGGACSV-SSSSPLGYTCTCQLGYIGPNCERSMSCRELSCYNGGSCTLTSRGARCSCLPGYGGPQC---------QHRSTEGCSS--KPCRNGGVCTEETSYPYFSCQCSKDWAGKRCEHKSLVLQVPTCPLSDCHRKANDSVCDKECNTFACRWDGGDCSLAMNPWANCTNPMCWRVFNNSQCDEACNNEDCLYDNFDC 1309          

HSP 3 Score: 112.079 bits (279), Expect = 2.621e-24
Identity = 78/203 (38.42%), Postives = 101/203 (49.75%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENP-CLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C   PC++G  C +  +  + CSC  G+ G  C   +N+C  NPCKNGGTC D  NS +TC C   F G  C+   P C   +C NGGTC    NG + C CR GF G  C  +   C   P     +C +  E       +  C C  GYTG+RC    + PV+   +S  C NGG C+  D  S  CECK  ++G  C IP
Sbjct:  714 CVPNPCLSGGSCTDGVN-SYHCSCLPGFTGSRCALEINECQSNPCKNGGTCTDYVNS-YTCTCRPGFTGIHCEINIPDCTESSCFNGGTCTDKING-YSCTCRSGFTGSHCQYEVNECNSQPCLNGGVCQDGLE-------SFRCTCPKGYTGNRC----QTPVDWCRRSSPCQNGGRCRQND-ASFTCECKNGWSGHYCDIP 901          

HSP 4 Score: 107.071 bits (266), Expect = 1.027e-22
Identity = 76/201 (37.81%), Postives = 98/201 (48.76%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PCV+G C E  +  +RC C  GW G+ C+ + NDC+ +PC+N GTCIDK N  FTC C   FIGNLCQ   N C +  C N GTC       F C C   + G  CA     C   P      C NH  C    +   + C C PG+ G  C+      +++  C S+ C N G C     G  +C C+  FTG  C
Sbjct:  523 CGSSPCVHGSCREDIN-GYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCIDKLNG-FTCKCRQGFIGNLCQVNINECASNPCLNKGTCVD-GVASFTCVCELPYSGPTCAEVLTPCSPNP------CANHAVCTHTADYLGYQCNCQPGWQGQLCN------IDVNECISNPCKNRGTCTNTLGGF-VCSCRAGFTGLTC 707          

HSP 5 Score: 83.1889 bits (204), Expect = 1.845e-15
Identity = 69/214 (32.24%), Postives = 97/214 (45.33%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNV--NCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            V +  C+   C+NG  C +  D  + C+C  G++G  CE+NV+DC  + C NGG C+D  N+ + C C  ++ G  C  + N CL     C NGGTC +   G   C C  G+ G+ C+        I      +C N   C      + FC+C  G TG  C       ++  C S+ C  G VC     NG  IC C   F G  C   + E
Sbjct:   20 VPTLPCAPSQCLNGGTCRQTSDHSYECACLPGFEGHNCEKNVDDCPGHKCMNGGLCVDGVNT-YNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGG-HTCVCVNGWTGDDCSEN------IDDCATAVCFNGATCHDR-VASFFCECPVGKTGLLCH------LDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDE 218          

HSP 6 Score: 82.8037 bits (203), Expect = 2.542e-15
Identity = 66/185 (35.68%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNG 889
            C++ PC NG         F C C  G++G  CE N+N+C  +PC + GTCID   S +TCNC   + G  C+ + N C +  C+N G C  L N  + C+C++G  G  C +    C   P        ++G C    N    C C PG+TG +C+      VEI  C S  C NGG C   +NG
Sbjct:  335 CASTPCQNGAKCHDRPNGFECRCAEGYEGTLCESNINNCQPDPCHH-GTCIDGIAS-YTCNCDPGYTGYRCENQLNECHSNPCQNSGKCVDLVN-KYICQCQHGTSGTNCEINFDDCASNPC-------DYGICKDGINR-YDCVCKPGFTGPKCN------VEIDECASSPCRNGGTCVDEENG 502          

HSP 7 Score: 53.9138 bits (128), Expect = 1.556e-6
Identity = 45/143 (31.47%), Postives = 59/143 (41.26%), Query Frame = 2
Query:  512 FTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCT 937
            F C C   + G +C+    PC    C NGGTC    +  ++C C  GF G  C      CP         C N G C    N T  C+C P +TG  C +      E   + + C NGG C     G   C C   +TG +C+
Sbjct:    5 FRCQCQPGYSGRICEVPTLPCAPSQCLNGGTCRQTSDHSYECACLPGFEGHNCEKNVDDCP------GHKCMNGGLCVDGVN-TYNCQCPPEWTGQYCAEDVN---ECLMQPNACHNGGTCFNTIGGH-TCVCVNGWTGDDCS 136          
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:101162450])

HSP 1 Score: 182.956 bits (463), Expect = 5.532e-46
Identity = 235/940 (25.00%), Postives = 380/940 (40.43%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCK--NGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM--FQCKCRYGFIGEFCAVQNIACPVIPKKKREL-CNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKC---------STQTKLYELDLVLMTT------------MQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNV-LSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHL--HGDQ--EPDNPISINNRKRKYETINRNHQALAFQLISDSLESTD-----GIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSG---------------ANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYF---VKKTTALIEAVKLDS------------KEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSI--KMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            NG CV+     +RC+C  G+ GE CE ++N+C+ NPC   N   CI   N  + C C   F G  CQ + + C +  C+NGG C    +    + C C+ G+IG  C  ++++C       REL C N G C +  +    C C PGY G +C  +       GC S  C NGGVC   +   P   C+C  ++ GK C                       K L+++    P L D  C     + +CD++CNTFAC +DGGDC    +PW  C       C  VFN+  C+  CNN DCL+D  DC       +      C + Y +  CDE C + +CG+DG DC          +  +            ++   L++L ++L T+            ++ +T+ +  F ++L     ++ ++               + L ++   C     +CF S E+ + +L A     N+    P + AR        ++K + P   M     L+   +    I VLL       R K + + +W P                F   K P     ++E  +    +  +  PKT +   L  H DQ  +PD P     ++ K E  +         L+SD  ++ D       H   A +    TMA      +++      ++ G       +G + + +A+    G               ANII  +     S+    D  G T L   +AA    +     +L+      ++ N  RS ++          F   ++     ++A   D             + M+  L+   + VN +D  G+S +HW+A  NN      L      + + DLK   +++PLFLAA EG+ ++VK LLA+F    I   MD     P+ IA+E+  ++I  L+ E
Sbjct: 1168 NGTCVDRVG-GYRCNCPPGFTGERCEGDINECLSNPCSPSNSFDCIQLPN-DYQCVCKPGFTGRRCQNKFSVCESQPCQNGGACSVSSSSPLGYTCTCQLGYIGPNCE-RSMSC-------RELSCYNGGSCTLT-SRGARCSCLPGYGGPQCQHRSTE----GCSSKPCRNGGVC-TEETSYPYFSCQCSKDWAGKRC---------------------EHKSLVLQVPTCP-LSD--CHRKANDSVCDKECNTFACRWDGGDCSLAMNPWANCTN---PMCWRVFNNSQCDEACNNEDCLYDNFDCRNKEKVCNPIYETYCLDHYADGKCDEGCFTEECGWDGMDCGGKFPEDIVDDVLVLVVLLPPDELLRTSSAFLHKLSIILRTSVRFKLDQNGKALIRPYTRREGRFKRELEPQEEVIGSI---------------VYLELDNRMCSQGSEECFPSAERAAEYLGALSAVENLRFPYPLKTAR--------AEKIQPPDVEMPTWVQLMFAGMGSLFILVLLAIGMLMTRRKREHSTLWFPE--------------GFFLKKEPSSNKNRRE-PVGQDALGMKHMPKTVEESLLGDHSDQWMDPDCP---EPKRIKVEEPS---------LLSDCEDAVDCRQWTQHHLAAADIRVPPTMALTPPQGEFESDCMDVNVRG------PDGFTPLMLASFCGGGLESEVAEEEESEECSANIISDLIYQGASLAAQTDRTGETAL--HLAARYARADAAKRLLDAGADANAQDNTGRSPLHAAVAADAQGVFQILIRNRATDLDARMYDGSTALILAARLAVEGMVEELITCHADVNSVDELGKSALHWAAAVNNVDATVALLKNGANKDMQDLK---EETPLFLAAREGSCEAVKVLLAHFANREITDHMDRL---PRDIAQERMHHDIVQLLDE 2000          

HSP 2 Score: 113.235 bits (282), Expect = 1.295e-24
Identity = 110/381 (28.87%), Postives = 159/381 (41.73%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNV---------NCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI---CECKGEFTGKN-----------------CTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCN--TFAC----NYDGGDCDPWR---KCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCH-----KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDC 1354
            C ++PC NG     +   ++C C  G+ G+ CE  +N+C  +PC+NGGTCID     + C+C    +G LC+      N           C N GTC     G ++C C  GF GE C      C   P       +N  +C   PN    C C PG+TG RC  K  +     C+S  C NGG C V  + SP+   C C+  + G N                 CT+  +  R   L     P+          + +S   C +  K     G+C ++ +   F+C    ++ G  C+      +     L  C    ND VC+ ECN   C +DG DC       ++C    C  ++ N  CDE CN+  C +D  DC
Sbjct: 1076 CEDKPCRNGATCRPYVGGYQCDCMPGFMGQNCEREINECQSHPCQNGGTCIDLV-GHYICSCPPGTLGVLCEINEDDCNTPVRPRNAPPKCLNNGTCVDRVGG-YRCNCPPGFTGERCEGDINECLSNPCSP----SNSFDCIQLPN-DYQCVCKPGFTGRRCQNKFSV-----CESQPCQNGGACSV-SSSSPLGYTCTCQLGYIGPNCERSMSCRELSCYNGGSCTLTSRGARCSCLPGYGGPQC---------QHRSTEGCSS--KPCRNGGVCTEETSYPYFSCQCSKDWAGKRCEHKSLVLQVPTCPLSDCHRKANDSVCDKECNTFACRWDGGDCSLAMNPWANCTNPMCWRVFNNSQCDEACNNEDCLYDNFDC 1432          

HSP 3 Score: 112.079 bits (279), Expect = 3.015e-24
Identity = 78/203 (38.42%), Postives = 101/203 (49.75%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENP-CLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIP 943
            C   PC++G  C +  +  + CSC  G+ G  C   +N+C  NPCKNGGTC D  NS +TC C   F G  C+   P C   +C NGGTC    NG + C CR GF G  C  +   C   P     +C +  E       +  C C  GYTG+RC    + PV+   +S  C NGG C+  D  S  CECK  ++G  C IP
Sbjct:  837 CVPNPCLSGGSCTDGVN-SYHCSCLPGFTGSRCALEINECQSNPCKNGGTCTDYVNS-YTCTCRPGFTGIHCEINIPDCTESSCFNGGTCTDKING-YSCTCRSGFTGSHCQYEVNECNSQPCLNGGVCQDGLE-------SFRCTCPKGYTGNRC----QTPVDWCRRSSPCQNGGRCRQND-ASFTCECKNGWSGHYCDIP 1024          

HSP 4 Score: 106.686 bits (265), Expect = 1.201e-22
Identity = 76/201 (37.81%), Postives = 98/201 (48.76%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            C + PCV+G C E  +  +RC C  GW G+ C+ + NDC+ +PC+N GTCIDK N  FTC C   FIGNLCQ   N C +  C N GTC       F C C   + G  CA     C   P      C NH  C    +   + C C PG+ G  C+      +++  C S+ C N G C     G  +C C+  FTG  C
Sbjct:  646 CGSSPCVHGSCREDIN-GYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCIDKLNG-FTCKCRQGFIGNLCQVNINECASNPCLNKGTCVD-GVASFTCVCELPYSGPTCAEVLTPCSPNP------CANHAVCTHTADYLGYQCNCQPGWQGQLCN------IDVNECISNPCKNRGTCTNTLGGF-VCSCRAGFTGLTC 830          

HSP 5 Score: 84.3445 bits (207), Expect = 8.492e-16
Identity = 66/214 (30.84%), Postives = 95/214 (44.39%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN-PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C+  PC NG     ++ ++ CSC  G++G+ C  ++N+C +   C N G CI+ K S F C C   + G +C+    PC    C NGGTC    +  ++C C  GF G  C      CP         C N G C    N T  C+C P +TG  C +      E   + + C NGG C     G   C C   +TG +C+  + +       N
Sbjct:   71 CATSPCANGARCVNWNDQYNCSCPPGFQGKNCHNDINECRKPGVCLNNGLCINMKGS-FRCQCQPGYSGRICEVPTLPCAPSQCLNGGTCRQTSDHSYECACLPGFEGHNCEKNVDDCP------GHKCMNGGLCVDGVN-TYNCQCPPEWTGQYCAEDVN---ECLMQPNACHNGGTCFNTIGGH-TCVCVNGWTGDDCSENIDDCATAVCFN 272          

HSP 6 Score: 82.8037 bits (203), Expect = 2.222e-15
Identity = 69/214 (32.24%), Postives = 97/214 (45.33%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNV--NCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            V +  C+   C+NG  C +  D  + C+C  G++G  CE+NV+DC  + C NGG C+D  N+ + C C  ++ G  C  + N CL     C NGGTC +   G   C C  G+ G+ C+        I      +C N   C      + FC+C  G TG  C       ++  C S+ C  G VC     NG  IC C   F G  C   + E
Sbjct:  143 VPTLPCAPSQCLNGGTCRQTSDHSYECACLPGFEGHNCEKNVDDCPGHKCMNGGLCVDGVNT-YNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGG-HTCVCVNGWTGDDCSEN------IDDCATAVCFNGATCHDR-VASFFCECPVGKTGLLCH------LDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDE 341          

HSP 7 Score: 82.4185 bits (202), Expect = 3.167e-15
Identity = 66/185 (35.68%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIG-CKSDYCFNGGVCKVLDNG 889
            C++ PC NG         F C C  G++G  CE N+N+C  +PC + GTCID   S +TCNC   + G  C+ + N C +  C+N G C  L N  + C+C++G  G  C +    C   P        ++G C    N    C C PG+TG +C+      VEI  C S  C NGG C   +NG
Sbjct:  458 CASTPCQNGAKCHDRPNGFECRCAEGYEGTLCESNINNCQPDPCHH-GTCIDGIAS-YTCNCDPGYTGYRCENQLNECHSNPCQNSGKCVDLVN-KYICQCQHGTSGTNCEINFDDCASNPC-------DYGICKDGINR-YDCVCKPGFTGPKCN------VEIDECASSPCRNGGTCVDEENG 625          

HSP 8 Score: 70.4774 bits (171), Expect = 1.434e-11
Identity = 54/171 (31.58%), Postives = 82/171 (47.95%), Query Frame = 2
Query:  446 VNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVN-CENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            ++ C  +PC NG  C++  N Q+ C+C   F G  C  + N C     C N G C +++ G F+C+C+ G+ G  C V  +  P  P +    C N G C    + +  C C PG+ G  C+K  +      C    C NGG+C V    +  C+C  E+TG+ C   + E
Sbjct:   68 IDACATSPCANGARCVN-WNDQYNCSCPPGFQGKNCHNDINECRKPGVCLNNGLCINMK-GSFRCQCQPGYSGRICEVPTL--PCAPSQ----CLNGGTCRQTSDHSYECACLPGFEGHNCEKNVD-----DCPGHKCMNGGLC-VDGVNTYNCQCPPEWTGQYCAEDVNE 224          
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Match: notch1a (neurogenic locus notch homolog protein 1 [Source:NCBI gene;Acc:101171596])

HSP 1 Score: 176.407 bits (446), Expect = 6.567e-44
Identity = 229/955 (23.98%), Postives = 371/955 (38.85%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT--CIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENG--MFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNE---------GLTKCSTQTKLYELDLVLMTTM-------------------QNFTKYK----------------SEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTD----GIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSM------------LHS-LDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYF---VKKTTALIEAVKLDSKEMISL------------LLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLA--DLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            NG+CV+     ++C C  G+ GE CE +VN+C+ +PC   G+  CI   NS + C C + + G  C +  + C    C NGGTC    N    F CKC  GF G  C   + +C  +       C N G C +  ++   C C   +TG  C    E P +  C S+ C+NGG C+   N +P   C C   F G  C I L  +          P    E    I +          C     N ICD  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CN+  CL+DG DC     + +      C + Y +  CD+ CN+ +C +DG DC  +                   + K  + + L EL  VL T +                   Q+  K+                 +  L ++  S+  VVT     E++       ++ L ++  QC     +CF S   ++ FL A    G+ L +P+  A    R    S  +  P+Y +     L L  +    +GVL+  K  +   ++     W               G+    P   + ++   E  +  K +        D +++  GD +PD         R+Y         L  Q + D  + TD        +DA    + ++A      + +      ++ G       +G + + IA+    G          +PS+            LH+  D  G T L   +AA    S     +LE       + N  R+ ++          F   ++     ++A   D    + L            L++  +  N  D  G+S +HW+A      +    + + + +  A  D++DN++++PLFLAA EG+ ++ K LL +F    I    +   P+ IA+E+  ++I  L+ E
Sbjct: 1152 NGRCVDRIG-GYQCMCPPGYVGERCEGDVNECLSDPCDPRGSYNCIQLMNS-YRCECRTGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYDSHSCGSL------NCKNGGTC-VSGHLGPRCLCPSAFTGPEC----ETPTDSLCISNPCYNGGTCQTTPN-APFFKCSCPSNFNGLLCHI-LDYSFVGGFGRDITPPPEVEVSCGIPQ----------CDEWAGNHICDSLCNNHACGWDGGDCSLNFDDPWKNCSA--ALQCWRYFNDGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCANNMPEKLADGHLVLVVHIPPEVLKNRSSSFLRELSSVLHTNVVFRRDAKGEPMIFPYYGNEQDLVKHSMLKRSADGWPEWASVPANVLDQMKESVSSVVTSRRRRELDPVQVKGSIVYLEIDNRQCYQQSSECFQSATDVAAFLGALASSGH-LKVPYIEAVTSVR-PPGSTSELYPMYII----FLGLAALGFICLGVLVSRKRRREHGQL-----W------------FPEGFKVSEPSKKKRREPLGEDSVGLKPMKNSDINLMDDNQNEWGDDDPD--------CRRYR--------LEEQAMLDLCDHTDQRKWTQQHLDAADLRIASIAPTPPQGEIENDCMDVNVRG------PDGFTPLMIASCSGGGLETGNSEEEEDPSVEIISDFIYQGANLHNQTDRTGETAL--HLAARYARSDAAKRLLESSADANVQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMAEELINSHADPNATDDSGKSALHWAAA-----VNNVEAALVLLKNGANKDMQDNKEETPLFLAAREGSYETAKVLLDHFANREITDHLD-QLPRDIAQERMHHDIVRLLDE 2026          

HSP 2 Score: 102.449 bits (254), Expect = 2.418e-21
Identity = 87/286 (30.42%), Postives = 127/286 (44.41%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE------NPCLN---------------------VNCE------------NGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKK----RELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKE------LPVEIG---------CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIK 1021
            C + PC NG  C +  +  + C+C  G+ G  CE N NDC  + C NGGTC+D  NS FTC C + F G+ CQF+       PCLN                     VNC+            NGGTC   +   + C+C+ G+ G +C + +++C V  K++     +LC N G+C +    T  C+C  GYTG  C ++ +      +P   G         C+S  C NGG C  L N +  C C     G +C + L +           PK FN  + + +
Sbjct:  878 CESNPCKNGANCTDCVN-SYTCTCPTGFSGINCEINTNDCTDSSCFNGGTCVDGINS-FTCLCLTGFTGSYCQFDINECDSKPCLNGGTCLDGYGTYKCTCPHGYTGVNCQHLVRWCDSSPCKNGGTCWQ-QGASYTCQCQTGWTGLYCDIPSVSCEVAAKQQGVEVNQLCRNSGQC-LDAGSTHHCRCQAGYTGSYCQEQVDERILSCVPGYHGVNCSKEINECQSQPCQNGGTCIDLIN-TYKCSCPRGTQGVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDR 1158          

HSP 3 Score: 102.064 bits (253), Expect = 3.391e-21
Identity = 112/351 (31.91%), Postives = 148/351 (42.17%), Query Frame = 2
Query:  404 SCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ--------FENPCLN-VNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC----DQQCNTFACNYDGGDCD-----PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFD-------GEDCH-----KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDC 1354
            SC  G+ G  C + +N+C   PC+NGGTCID  N+ + C+C     G  C+        F +P  N   C N G C     G +QC C  G++GE C      C   P      C+  G  +    M  + C+C  GYTG RCDK     V  GCK   C NGG C V  N +P   IC+C   FTG +C     ++     +N K   T     L  +          LC ++F    C    D  C +  C Y+GG C      P+ KC       C   FN  +C+        + D       G D       + SC   +C E   N ICD  CN+  CG+DGGDC
Sbjct: 1081 SCVPGYHGVNCSKEINECQSQPCQNGGTCIDLINT-YKCSCPRGTQGVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDRIGG-YQCMCPPGYVGERCEGDVNECLSDP------CDPRGSYNCIQLMNSYRCECRTGYTGQRCDK-----VFDGCKGRPCRNGGTCAVASN-TPHGFICKCPPGFTGSSCEY---DSHSCGSLNCKNGGTCVSGHLGPRC---------LCPSAFTGPECETPTDSLCISNPC-YNGGTCQTTPNAPFFKC------SCPSNFNGLLCH--------ILDYSFVGGFGRDITPPPEVEVSCGIPQCDEWAGNHICDSLCNNHACGWDGGDC 1390          

HSP 4 Score: 100.908 bits (250), Expect = 7.758e-21
Identity = 72/214 (33.64%), Postives = 103/214 (48.13%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+ + N C+   C NG  C +   G +QCKC+ GF G+ C         I   K   C+N G C  +  ++ F C C PG+ G RC++         C+S+ C NG  C    N S  C C   F+G NC I   +    +  N
Sbjct:  726 CDSNPCMNGGTCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGQTCEIDINECVKSPCWNGAFCLNTMGG-YQCKCQPGFTGQKCETD------IDDCKPNPCSNGGLC--HDGISSFTCTCLPGFRGGRCEQDINE-----CESNPCKNGANCTDCVN-SYTCTCPTGFSGINCEINTNDCTDSSCFN 923          

HSP 5 Score: 92.8189 bits (229), Expect = 2.186e-18
Identity = 76/249 (30.52%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC------------DIYPNMTLF------------------------CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C +     F C C  G+ G  CE N+N+C+  PCKNGGTC D++NS + C+C     G  C+   + C +  C+  G C    NG ++C CR G+ G  C +    C + P      C+N G C            + Y + T                          C CD G++G  CD  K       C S+ C NGG CK + +G   C C+  FTG NC   + E      +N
Sbjct:  539 CYSDPCHYGTCKDGL-ASFTCYCRPGYTGRLCETNINECLSQPCKNGGTCQDRENS-YICSCPKGTAGFNCEINLDDCKSQPCDY-GRCIDKING-YECACRPGYTGTMCNINIDDCAINP------CHNGGTCIDGINSFTCLCPEGYNDATCLSQVDECSSNPCIHGLCQDLINGYKCTCDSGWSGQNCDINKNE-----CDSNPCMNGGTCKDMTSGY-HCTCRVGFTGPNCQTNINECASNPCLN 771          

HSP 6 Score: 92.0485 bits (227), Expect = 3.816e-18
Identity = 80/265 (30.19%), Postives = 114/265 (43.02%), Query Frame = 2
Query:  341 CSNRPCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC-DIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC-----DNLCKASFENGICDQQCNTFAC 1111
            C + PC N   C++     F C C  G++G  C  + ++C   PC N G CIDK NS F C C   F GNLCQ + + C +  C NG  C    N  + C+C  G+ G+ C +    C   P        ++G C D   + T +C+  PGYTG  C+          C S  C NGG C+  +N S IC C     G NC I L + + +     +     N  +   +   + ++C     D         G C    N+F C
Sbjct:  425 CMSNPCQNDATCLDQIG-GFHCICMPGYEGVFCHIDTDECASQPCLNNGKCIDKINS-FYCECPKGFSGNLCQVDIDECASTPCRNGAKCTDGPN-KYNCECAEGYTGQHCEIDINECYSDPC-------HYGTCKDGLASFTCYCR--PGYTGRLCETNINE-----CLSQPCKNGGTCQDREN-SYICSCPKGTAGFNCEINLDDCKSQPCDYGRCIDKINGYECACRPGYTGTMCNINIDDCAINPCHNGGTCIDGINSFTC 671          

HSP 7 Score: 87.8113 bits (216), Expect = 6.290e-17
Identity = 67/241 (27.80%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ----------------------------------------NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC NG    + D  +RC+C   + G+TC+ +VN+C Q                                        +PC+NGGTC+ K ++ + C+C   F+G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P     +C N G C    + +  C C  G+TGD C K  +      C +  CF+G  C      S  CEC    TG  C +
Sbjct:  113 CASNPCANGGQCSSLDSTYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQEYTGQHCQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVN-TYNCQCPPHYTGQYCTENVDECEMMPN----VCQNGGTCHDT-HGSYHCVCVNGWTGDDCSKNID-----DCAAAACFHGATCHDR-VASFFCECPHGRTGLLCHL 341          

HSP 8 Score: 86.6557 bits (213), Expect = 1.356e-16
Identity = 66/209 (31.58%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF---ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  CV+  D  + CSC  G+ G+ CE N++DC  + C+NGG C D  N+ + C C   + G  C     E   +   C+NGGTC    +G + C C  G+ G+ C+     C          C++          + FC+C  G TG  C       ++  C S+ C  G  C     NG  IC C   +TG  C + + E
Sbjct:  191 CSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNT-YNCQCPPHYTGQYCTENVDECEMMPNVCQNGGTCHDT-HGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDR-------VASFFCECPHGRTGLLCH------LDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDE 384          

HSP 9 Score: 83.5741 bits (205), Expect = 1.217e-15
Identity = 66/203 (32.51%), Postives = 87/203 (42.86%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDP----EFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            CS  PC NG    A       +F C C  G+    C    N  C+  PC+NGGTC     + F C C   + G  CQ  NPC +  C NGG C SL++  ++C C   F G+ C +    C   P     LC N G C +    +  C+C   YTG  C         + C    C NGG C    + +  C C   F G++C
Sbjct:   32 CSPSPCRNGGRCRAVSRGNTFDFLCECPLGFTDRLCLTPTNHACMSAPCRNGGTCELIALTDFRCQCPPGWTGKSCQTPNPCASNPCANGGQCSSLDS-TYRCTCPPNFHGQTCKLDVNECAQTPY----LCLNGGIC-VNEVGSYHCRCPQEYTGQHCQTPY-----VPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHC 223          

HSP 10 Score: 78.1814 bits (191), Expect = 6.152e-14
Identity = 53/164 (32.32%), Postives = 72/164 (43.90%), Query Frame = 2
Query:  524 CTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAV-QNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNE 1003
            C S +IGN CQ+ +PC    C NGG C ++  G    F C+C  GF    C    N AC   P      C N G C++       C+C PG+TG  C           C S+ C NGG C  LD+ +  C C   F G+ C + + E  +   + +      NE
Sbjct:   17 CPSDYIGNRCQYPSPCSPSPCRNGGRCRAVSRGNTFDFLCECPLGFTDRLCLTPTNHACMSAP------CRNGGTCELIALTDFRCQCPPGWTGKSCQTPNP------CASNPCANGGQCSSLDS-TYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNE 167          
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Match: notch1a (neurogenic locus notch homolog protein 1 [Source:NCBI gene;Acc:101171596])

HSP 1 Score: 175.252 bits (443), Expect = 1.342e-43
Identity = 229/955 (23.98%), Postives = 371/955 (38.85%), Query Frame = 2
Query:  362 NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGT--CIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVNCENGGTCESLENG--MFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPI--CECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDC-----DPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHK-----CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNE---------GLTKCSTQTKLYELDLVLMTTM-------------------QNFTKYK----------------SEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTD----GIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSM------------LHS-LDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYF---VKKTTALIEAVKLDSKEMISL------------LLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLA--DLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQE 2941
            NG+CV+     ++C C  G+ GE CE +VN+C+ +PC   G+  CI   NS + C C + + G  C +  + C    C NGGTC    N    F CKC  GF G  C   + +C  +       C N G C +  ++   C C   +TG  C    E P +  C S+ C+NGG C+   N +P   C C   F G  C I L  +          P    E    I +          C     N ICD  CN  AC +DGGDC     DPW+ C       C   FNDG C+ +CN+  CL+DG DC     + +      C + Y +  CD+ CN+ +C +DG DC  +                   + K  + + L EL  VL T +                   Q+  K+                 +  L ++  S+  VVT     E++       ++ L ++  QC     +CF S   ++ FL A    G+ L +P+  A    R    S  +  P+Y +     L L  +    +GVL+  K  +   ++     W               G+    P   + ++   E  +  K +        D +++  GD +PD         R+Y         L  Q + D  + TD        +DA    + ++A      + +      ++ G       +G + + IA+    G          +PS+            LH+  D  G T L   +AA    S     +LE       + N  R+ ++          F   ++     ++A   D    + L            L++  +  N  D  G+S +HW+A      +    + + + +  A  D++DN++++PLFLAA EG+ ++ K LL +F    I    +   P+ IA+E+  ++I  L+ E
Sbjct: 1241 NGRCVDRIG-GYQCMCPPGYVGERCEGDVNECLSDPCDPRGSYNCIQLMNS-YRCECRTGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYDSHSCGSL------NCKNGGTC-VSGHLGPRCLCPSAFTGPEC----ETPTDSLCISNPCYNGGTCQTTPN-APFFKCSCPSNFNGLLCHI-LDYSFVGGFGRDITPPPEVEVSCGIPQ----------CDEWAGNHICDSLCNNHACGWDGGDCSLNFDDPWKNCSA--ALQCWRYFNDGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCANNMPEKLADGHLVLVVHIPPEVLKNRSSSFLRELSSVLHTNVVFRRDAKGEPMIFPYYGNEQDLVKHSMLKRSADGWPEWASVPANVLDQMKESVSSVVTSRRRRELDPVQVKGSIVYLEIDNRQCYQQSSECFQSATDVAAFLGALASSGH-LKVPYIEAVTSVR-PPGSTSELYPMYII----FLGLAALGFICLGVLVSRKRRREHGQL-----W------------FPEGFKVSEPSKKKRREPLGEDSVGLKPMKNSDINLMDDNQNEWGDDDPD--------CRRYR--------LEEQAMLDLCDHTDQRKWTQQHLDAADLRIASIAPTPPQGEIENDCMDVNVRG------PDGFTPLMIASCSGGGLETGNSEEEEDPSVEIISDFIYQGANLHNQTDRTGETAL--HLAARYARSDAAKRLLESSADANVQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMAEELINSHADPNATDDSGKSALHWAAA-----VNNVEAALVLLKNGANKDMQDNKEETPLFLAAREGSYETAKVLLDHFANREITDHLD-QLPRDIAQERMHHDIVRLLDE 2115          

HSP 2 Score: 110.923 bits (276), Expect = 6.478e-24
Identity = 118/372 (31.72%), Postives = 156/372 (41.94%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ--------FENPCLN-VNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSP---ICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGIC----DQQCNTFACNYDGGDCD-----PWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFD-------GEDCH-----KSSCKFHKCSELYQNKICDEECNSPQCGFDGGDC 1354
            CS  PC NG     +   + C C  G+ G  C + +N+C   PC+NGGTCID  N+ + C+C     G  C+        F +P  N   C N G C     G +QC C  G++GE C      C   P      C+  G  +    M  + C+C  GYTG RCDK     V  GCK   C NGG C V  N +P   IC+C   FTG +C     ++     +N K   T     L  +          LC ++F    C    D  C +  C Y+GG C      P+ KC       C   FN  +C+        + D       G D       + SC   +C E   N ICD  CN+  CG+DGGDC
Sbjct: 1149 CSPNPCQNGATCTDYLGGYSCECVPGYHGVNCSKEINECQSQPCQNGGTCIDLINT-YKCSCPRGTQGVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDRIGG-YQCMCPPGYVGERCEGDVNECLSDP------CDPRGSYNCIQLMNSYRCECRTGYTGQRCDK-----VFDGCKGRPCRNGGTCAVASN-TPHGFICKCPPGFTGSSCEY---DSHSCGSLNCKNGGTCVSGHLGPRC---------LCPSAFTGPECETPTDSLCISNPC-YNGGTCQTTPNAPFFKC------SCPSNFNGLLCH--------ILDYSFVGGFGRDITPPPEVEVSCGIPQCDEWAGNHICDSLCNNHACGWDGGDC 1479          

HSP 3 Score: 93.5893 bits (231), Expect = 1.327e-18
Identity = 69/215 (32.09%), Postives = 97/215 (45.12%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC+NG   +     + C+C  G+ G  C+ N+N+C  NPC N GTCID   + + CNC   + G  C+    PC +  C+NGG C+  E+   F C C  G+ G+ C +    C   P      C N         M  + CKC PG+TG +C+   +      CK + C NGG+C      S  C C   F G  C   + E       N
Sbjct:  757 CDSNPCMNGGTCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDV-AGYKCNCLLPYTGENCETLLAPCSSRPCKNGGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKSPCWNGAFCLN--------TMGGYQCKCQPGFTGQKCETDID-----DCKPNPCSNGGLCHD-GISSFTCTCLPGFRGGRCEQDINECESNPCKN 956          

HSP 4 Score: 92.0485 bits (227), Expect = 3.218e-18
Identity = 76/249 (30.52%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC------------DIYPNMTLF------------------------CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C + PC  G C +     F C C  G+ G  CE N+N+C+  PCKNGGTC D++NS + C+C     G  C+   + C +  C+  G C    NG ++C CR G+ G  C +    C + P      C+N G C            + Y + T                          C CD G++G  CD  K       C S+ C NGG CK + +G   C C+  FTG NC   + E      +N
Sbjct:  570 CYSDPCHYGTCKDGL-ASFTCYCRPGYTGRLCETNINECLSQPCKNGGTCQDRENS-YICSCPKGTAGFNCEINLDDCKSQPCDY-GRCIDKING-YECACRPGYTGTMCNINIDDCAINP------CHNGGTCIDGINSFTCLCPEGYNDATCLSQVDECSSNPCIHGLCQDLINGYKCTCDSGWSGQNCDINKNE-----CDSNPCMNGGTCKDMTSGY-HCTCRVGFTGPNCQTNINECASNPCLN 802          

HSP 5 Score: 89.3521 bits (220), Expect = 2.300e-17
Identity = 59/182 (32.42%), Postives = 80/182 (43.96%), Query Frame = 2
Query:  470 CKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAV-QNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNE 1003
            C NGG C+   +    C C S +IGN CQ+ +PC    C NGG C ++  G    F C+C  GF    C    N AC   P      C N G C++       C+C PG+TG  C           C S+ C NGG C  LD+ +  C C   F G+ C + + E  +   + +      NE
Sbjct:   30 CLNGGRCVATSSGNGECRCPSDYIGNRCQYPSPCSPSPCRNGGRCRAVSRGNTFDFLCECPLGFTDRLCLTPTNHACMSAP------CRNGGTCELIALTDFRCQCPPGWTGKSCQTPNP------CASNPCANGGQCSSLDS-TYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNE 198          

HSP 6 Score: 87.0409 bits (214), Expect = 1.033e-16
Identity = 67/241 (27.80%), Postives = 103/241 (42.74%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQ----------------------------------------NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C++ PC NG    + D  +RC+C   + G+TC+ +VN+C Q                                        +PC+NGGTC+ K ++ + C+C   F+G  C+   + C   NC+NGG C    N  + C+C   + G++C      C ++P     +C N G C    + +  C C  G+TGD C K  +      C +  CF+G  C      S  CEC    TG  C +
Sbjct:  144 CASNPCANGGQCSSLDSTYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQEYTGQHCQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVN-TYNCQCPPHYTGQYCTENVDECEMMPN----VCQNGGTCHDT-HGSYHCVCVNGWTGDDCSKNID-----DCAAAACFHGATCHDR-VASFFCECPHGRTGLLCHL 372          

HSP 7 Score: 86.2705 bits (212), Expect = 2.189e-16
Identity = 66/209 (31.58%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  341 CSNRPCVNG-KCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF---ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLD-NGSPICECKGEFTGKNCTIPLKE 952
            CS  PC NG  CV+  D  + CSC  G+ G+ CE N++DC  + C+NGG C D  N+ + C C   + G  C     E   +   C+NGGTC    +G + C C  G+ G+ C+     C          C++          + FC+C  G TG  C       ++  C S+ C  G  C     NG  IC C   +TG  C + + E
Sbjct:  222 CSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNT-YNCQCPPHYTGQYCTENVDECEMMPNVCQNGGTCHDT-HGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDR-------VASFFCECPHGRTGLLCH------LDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDE 415          

HSP 8 Score: 82.8037 bits (203), Expect = 2.066e-15
Identity = 66/203 (32.51%), Postives = 87/203 (42.86%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDP----EFRCSCWHGWKGETCEENVND-CIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            CS  PC NG    A       +F C C  G+    C    N  C+  PC+NGGTC     + F C C   + G  CQ  NPC +  C NGG C SL++  ++C C   F G+ C +    C   P     LC N G C +    +  C+C   YTG  C         + C    C NGG C    + +  C C   F G++C
Sbjct:   63 CSPSPCRNGGRCRAVSRGNTFDFLCECPLGFTDRLCLTPTNHACMSAPCRNGGTCELIALTDFRCQCPPGWTGKSCQTPNPCASNPCANGGQCSSLDS-TYRCTCPPNFHGQTCKLDVNECAQTPY----LCLNGGIC-VNEVGSYHCRCPQEYTGQHCQTPY-----VPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHC 254          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000066558.1 (SMESG000066558.1)

HSP 1 Score: 2038.46 bits (5280), Expect = 0.000e+0
Identity = 1074/1087 (98.80%), Postives = 1077/1087 (99.08%), Query Frame = 2
Query:  290 MNVFILGCLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMXXXXXXXXXXXXXXXXGVLLRDKWGKLRSKIKTAGVWXXXXXXXXXXXXXXXGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQETLRKVTITDRXXXXXXXXXXXXXXXIHNFDTSGNLCIIDEYKXXXXXXXXXXXXXXXGNESIDSCLLDLYSITDPMQNPQEPYSNEKSLYSSFKPVEHRYHGYQSNTSSSDMSPPXXXXXXXXXXXXXXSITHSEHLDSNYSNSIFLSPKSFIGLPDPINGSGLNKATDFQTDFYNYQASPILSEYKYYSNPVPKFPPVNCLL 3550
            MNVFILGCL VIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASF NGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMILAALLLLFFISITLIGVLLRDKWGKLRSKIKTAGVWTPSSGYSTSTSPINSGYNFGWPKLPQLKDFKKEYQI NKLIYGESQPKTDQH HLH DQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKE+ISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIK+DPNCPCPKLIAEEKGFYEIRDLIQETLRKVTITDRNEKKTKSKESKTKNKIHNFDTSGNLCIIDEYKELSSNSLENLQSSPLGNESIDSCLLDLYSITDPMQNPQEPYSNEKSLYSSFKPVEHRY GYQSNTSSSDMSPPLLNLNNQQFQNGFNSITHSEHLDSNYSNSIFLSPKSFIGLPDPINGSGLNK TDF  DFYNYQASP LSEYKY+SNPVPKFPPVNCLL
Sbjct:    1 MNVFILGCLWVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKASFGNGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYGGQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYTMILAALLLLFFISITLIGVLLRDKWGKLRSKIKTAGVWTPSSGYSTSTSPINSGYNFGWPKLPQLKDFKKEYQIQNKLIYGESQPKTDQHGHLHCDQEPDNPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTMASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEIISLLLDEGSPVNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLAYFNKSSIKIDPNCPCPKLIAEEKGFYEIRDLIQETLRKVTITDRNEKKTKSKESKTKNKIHNFDTSGNLCIIDEYKELSSNSLENLQSSPLGNESIDSCLLDLYSITDPMQNPQEPYSNEKSLYSSFKPVEHRYQGYQSNTSSSDMSPPLLNLNNQQFQNGFNSITHSEHLDSNYSNSIFLSPKSFIGLPDPINGSGLNKTTDFHADFYNYQASPTLSEYKYHSNPVPKFPPVNCLL 1087          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000063217.1 (SMESG000063217.1)

HSP 1 Score: 137.117 bits (344), Expect = 4.506e-32
Identity = 141/486 (29.01%), Postives = 202/486 (41.56%), Query Frame = 2
Query:  326 VSSKLCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN--SQFTCNCTSQFIGNLCQFE-NPC-LNVN-------------CENGGTCESLEN-GMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC------DIYPNMTLFCKCDPGYTGDRC------------------------DK---KKELPVEIG---CKSDY--------CFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCD-NLCKASFENGICDQQCNTFACNYDGGDC----------------DPWRKC--YGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKS--SCKFHK-CSELYQNKICDEECNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNFTKYKSEFLQKLSSSLRMVVTVF 1531
            V++  C +  C  GKC++  +  F C C  G  G  CE  V+ C +  C+NGG C   KN    F CNC   F G LC+ + N C  N+              C   GT E L+  G F C C+  F G++C  +   C    K     C N+G C      ++  N    C C  GY G+RC                        D+   K E P  +G   C+ DY        C+N G C V   G  IC C     G+ C I         L +I   +T+ ++          S C+ N C +  +N ICD +CN +AC +DGG+C                 PW  C    ++   C   FN+  C+P+CN   CLFDG DC  +   C     C + Y +  C  ECN+ +C FDGGDC  SR+++      L             L+ ++T +   +Y+++ LQ L+  L  VV + 
Sbjct:  983 VNTNECYSNSCNTGKCIDQIN-NFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC---KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC-VNGFGKAICHCNKGSCGEKCEITGSACN---LASIDNSQTYQDE---------ISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIIL-------------LLPVSTTEFVARYRTKLLQSLTHLLHSVVRIM 1438          

HSP 2 Score: 106.686 bits (265), Expect = 8.774e-23
Identity = 102/335 (30.45%), Postives = 140/335 (41.79%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQF-ENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDN---------LCKASFENGICD---QQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKIC 1306
            C N PC NG   +     FRC C  G+ GE CE  +N+C  NPC N   CID  N  + C C S F G  C+  +N C   +C   G C    NG F+CKC   +IG  C      C   P   +  C N       P     C C  G+TG RC+ K +      C+ + C + GVC+  D  S  C+C  E+ G+ C I   ET K   +     + F  + LI K  K    C N          C++ +    C+     C +  C  +GG+C       G  +  CK       C P    V+C  +  +C+ +SC   KC +   N  C
Sbjct:  701 CRNDPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHIN-DYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG-FECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG--YLCNCRRGFTGPRCEIKMDW-----CRGNPCGDFGVCET-DLDSFKCKCNSEYIGERCEIKKTETCKSYAV-----EKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPC-INGGECGD-----GTGMYFCK-------CQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSC 1007          

HSP 3 Score: 105.145 bits (261), Expect = 2.300e-22
Identity = 103/369 (27.91%), Postives = 158/369 (42.82%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ-FENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACP--VIPKKKRELCNNHGECDIYPNM-------TLFCKCDPGYTGDRCDKKKELPVEIGCKSDY-CFNGGVC------KVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFN-EKQLIIKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDLKHCKGVFNDGVCNPECNNVDCLFDGEDCHKSS-------------CKFHKCSELYQNKICDEECNSPQCGFDGGDC 1354
            C+++PC+NG         + C C  G++G  C+ N N+C  N C N G CID+ N+ F+C C     G  C+   + C  + C+NGG C+++  G F+C C  GF G+ C      C   +       + N HG C     +       T  C C   +TG  C+ + +   +     +  CFN G+C      +V  N +  C C   + G+ C I  K+ +     N  I + F  + ++  K    P +    C+  + N     +C      Y+ G C      +G  + HC    N G C  +C        G  C+ +S             C+ +KC+    NKICD ECN   CGFDGG+C
Sbjct:  950 CASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINN-FSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVI-GDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKC------YNNGSCVNG---FGKAICHC----NKGSCGEKCE-----ITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGEC 1297          

HSP 4 Score: 102.834 bits (255), Expect = 1.311e-21
Identity = 69/214 (32.24%), Postives = 106/214 (49.53%), Query Frame = 2
Query:  296 VFILGCLLVIVSSKLCSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNC 934
            + IL    + +S   C N  C NG  C    + ++ C C +G+KG  CE+  N C   PC+NGGTC       + C C ++++G  C+F + C +  C NGG C+SLE   ++C+C   ++G  C + N      P      C  +G+C +  +  + C C+ GYTGD C    +       ++  C NGG C +   GS  C+CK  F G+ C
Sbjct:    9 ILILLFCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTC-KLIAGNYVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNP------CGVNGKCILANDGEVKCHCNKGYTGDTCSNDIDECASY--ETPLCENGGTC-INTVGSYQCKCKAGFNGERC 211          

HSP 5 Score: 82.4185 bits (202), Expect = 2.086e-15
Identity = 92/310 (29.68%), Postives = 133/310 (42.90%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLIIKKTKSPSLC---DNL--CKASFE--------NGICDQQCNTFAC----NYDGGDCD-PWRKCYGNDLKH---CKGVFNDGVC 1201
            LC  +PC NG     FD +++C C + W G+ C++  N C  NPCKN G C       + C C   F G  C+   + C  ++C NGG+C ++  G  +C C  GF G  C +    C   P      C N+ +C I  N    C C  G TG  C    E+ ++  C  + C NG  C+    G   C+C   F G  C     ET+ +    +   KT  E  L +  T+S   C   D +  CK            NG C    N   C     ++G  C+    +C+ N  +H   C+ +FND +C
Sbjct:  255 LCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGG-KCNCLPGFEGNNCEINVNECENKP------CQNNAKC-IDLNNDYTCDCPEGLTGKNC----EINID-ECTPNPCLNGARCEDRVGGF-TCQCLQGFVGLRC-----ETKSDICKQLTPCKT-EEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVNGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLC 544          

HSP 6 Score: 74.7146 bits (182), Expect = 5.334e-13
Identity = 78/261 (29.89%), Postives = 103/261 (39.46%), Query Frame = 2
Query:  335 KLCSNRPCVN-GKC----VEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQ--------------FENPCL-NVNCENGGTC-ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKE----------------------LPVEIG----------CKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETR 958
            + C + PC+N G C    V    P + C+C  G+ G  CE  ++ C  NPC + G C    +S F C C S++IG  C+              F+N  L N  C++ G C    E G F+C C+ G+ G FC V    C   P      C N GEC     M  FCKC PG+ G  C                            P  +           CK   C NGG+CK +  G   C C   F GK C   + E +
Sbjct:  813 RPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS-FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQP------CINGGECGDGTGM-YFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVI-GDFECNCPKGFAGKLCETDINECK 1064          

HSP 7 Score: 73.9442 bits (180), Expect = 7.732e-13
Identity = 72/262 (27.48%), Postives = 114/262 (43.51%), Query Frame = 2
Query: 2114 RNHQALAFQLISDSLESTDGI---HPIDAGLGDVYT----MASVKNH---------MKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQINAINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVRSGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSP----VNVLDSQGRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAIDSVKYLLA 2839
            RN +A  F  I++ L S +G+    P ++    +        +V N             +E    S +  L   V  +GE+L+H+AA+ N        + A   S  + L+  GR+ L ++I A A E       LE+Q        K   G                +T LI+AVK    E+I LLL    P    +NV D  GR+ +HW+A+   + ++  L    + +   D +DNE+ +PL+LA  EG I+  K L+A
Sbjct: 1706 RNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEA--GSDPNKLELNGRSCLMTAIDAGALEVVA--FFLEQQTFVIDLHQKGPYG----------------STCLIQAVKEAHIEIIQLLLQHIQPEECDLNVTDEYGRTALHWAAITGQAAVVHLLMSYGLNR---DAQDNEEATPLYLACKEGVIEVCKILIA 1944          

HSP 8 Score: 69.707 bits (169), Expect = 1.420e-11
Identity = 70/235 (29.79%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPG---YTGDRCDK--------KKELPV-----------EIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            C N  CVNG+CV+  + E +C C  G++G TCE  +N+C  NPC++G  C D  N  + C C   F G  C+   N C +  C   G C     G F+C+C   + G  CA +   C         +C    + D Y      C C      Y G +C+K        + +L +           +IG     C N   C +  NGS IC+C  ++ G+ C  PL   R +   N
Sbjct:  487 CKNIVCVNGQCVDVNNEE-KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFN-DYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYG-FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSY-----HCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIG----PCLNDNQC-INTNGSFICKCSSQYEGRQCEKPLNNCRNDPCRN 708          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000068721.1 (SMESG000068721.1)

HSP 1 Score: 103.605 bits (257), Expect = 6.042e-22
Identity = 77/254 (30.31%), Postives = 121/254 (47.64%), Query Frame = 2
Query:  341 CSNRPCV-NGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKN-SQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPL-KETRKEALINIKIPKTFNEKQLIIKKTKSPSLCDNLCKAS--FENGIC 1084
            C  RPC  NGKC       ++C C + + G+ C++ +N C   PC+NGG C +  N   + C C   F G  C    + C+   C NG TC  L N  + CKC+ GF G++C ++ + C  I       C N G+C + PN    C C  G+ G +C++  +      CK + C +   C  L N    C C+  + GK C IP  K T  + LI+    +  N+ ++  +  ++  + +++C       NGIC
Sbjct:  911 CMKRPCKHNGKCSLITHHNYQCDCPYPFHGKNCDKRINACFGQPCRNGGICKNIDNYGNYECVCPVGFRGPKCTINVDDCVGNLCVNGATCNDLNNS-YSCKCQSGFRGKYCDIKFLYCNDI-----NPCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTD-----DCKYNSCKHESQCVDLHNDYK-CMCRPGYIGKFCEIPAWKPTVLKTLIS---RRDINQSEMTYENLENEVISESVCAYHECLNNGIC 1149          

HSP 2 Score: 59.6918 bits (143), Expect = 1.739e-8
Identity = 49/164 (29.88%), Postives = 72/164 (43.90%), Query Frame = 2
Query:  353 PCVN-GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE--NPCL--------NVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGEC---DIYPNMTLFCKCDPGYTGDRC 802
            PC N G+C    + +++C C  GW+G+ CE N +DC  N CK+   C+D  N  + C C   +IG  C+     P +        ++N ++  T E+LEN +             CA                C N+G C   D   N   +CKC PGY+G  C
Sbjct: 1033 PCQNSGQCQLLPNNDYKCVCSKGWEGKQCERNTDDCKYNSCKHESQCVDLHND-YKCMCRPGYIGKFCEIPAWKPTVLKTLISRRDIN-QSEMTYENLENEVIS--------ESVCAYHE-------------CLNNGICINGDQNKNQKSYCKCKPGYSGHLC 1173          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000027402.1 (SMESG000027402.1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.252e-19
Identity = 77/217 (35.48%), Postives = 102/217 (47.00%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCI---DKKNSQFTCNCTSQFIGNLCQF-------ENPCLNVNCENGGTCESLE--NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C   PC NG  C+++ +  F C C +G+ G+TCEE  + CI++PC N G C+   D+  + F C C + + G LC          NPCL     NGG+C  L   NG FQC C  G+IG  C   +I     P +++ LC N G C         C C PG+ G  CD          C  + CFNGG C +    S  C C   F G NC +   E
Sbjct:  631 CKTNPCKNGGICIDSIN-NFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCL-----NGGSCSRLSTLNG-FQCHCNQGWIGTVCQFLHID--FQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTN-----ECNPNPCFNGGKC-IDKLNSYRCICAKGFYGSNCQLNYDE 832          

HSP 2 Score: 94.3597 bits (233), Expect = 4.038e-19
Identity = 66/202 (32.67%), Postives = 98/202 (48.51%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTC--ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C   PC  G C+++   EF C C   W G+ C+++ + C QN C+NGG C   +N    C C   + G+ C    PC N  C++   C  +S   G ++C C+ G+ G++C  +   C   P      C N+G C    N    C C   + G  C+      + I C++  C NGGVC+ +D G   C+CK  +TG NC I
Sbjct:  340 CFPNPCKKGTCMKS-KGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNP------CKNNGVCTDSIN-DYKCNCSTSFKGKNCE------LNIACQNQPCKNGGVCQEVDTGY-TCKCKTGYTGTNCEI 526          

HSP 3 Score: 79.7221 bits (195), Expect = 1.277e-14
Identity = 65/210 (30.95%), Postives = 97/210 (46.19%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAV-QNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            G C+     +F C C  G++G++CE +++DC  NPCKNGG CID  N+ F C C + F G  C+   + C+   C N G C    + +   F C+C+  + G  C + ++  C   P      C N G C     +  F C C+ G+ G  C +   +  +   + + C N GVC  +      C CK  F GK+C I   E       N
Sbjct:  601 GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINN-FECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNP------CLNGGSCSRLSTLNGFQCHCNQGWIGTVC-QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFN 802          

HSP 4 Score: 74.3294 bits (181), Expect = 4.800e-13
Identity = 75/254 (29.53%), Postives = 115/254 (45.28%), Query Frame = 2
Query:  398 RCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVN-CENGGTCESL--ENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI--PLKETRKEALINIKIPKT-FNEKQLIIKKTKSPSLCD--------NLCKASFENGICDQQCNTFACN 1114
             C C  GW+G  C+E    C++ P    GTC+D   S +TC+C + + G  C Q  N C   N C+NGG CE+L  E   ++C C  GF G  C +    C   P KK     + GE         +C+C   +TG  CD+   +     C  + C NGG C   +NG+  C C+  + G  C +  P + ++ +  ++ +I  T   + + + +   +   CD        N CK    NG+C    N + CN
Sbjct:  249 ECRCRAGWQGTFCDE----CMKYPGCKHGTCVD---SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKGTCMKSKGE--------FYCQCIERWTGKLCDQDTSI-----CDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCK---NNGVCTDSINDYKCN 477          

HSP 5 Score: 62.7734 bits (151), Expect = 1.895e-9
Identity = 46/123 (37.40%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC-AVQNIACPVIP 700
            LC N     G C+     +F C C  G++G+ C+ N N+C  NPC NGG CIDK NS + C C   F G+ CQ   + C +  C  G  C    +  F+C+C  G  G+ C  V+N   P  P
Sbjct:  760 LCKNE----GVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDD-FECRCPEGRDGKLCDHVKNNESPQPP 876          

HSP 6 Score: 58.9214 bits (141), Expect = 3.119e-8
Identity = 56/186 (30.11%), Postives = 74/186 (39.78%), Query Frame = 2
Query:  308 GCLLVIVSSKLCSNRPCVNGKCVEAFDP--EFRCSCWHGWKGETCE---ENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD--KKKELPVEIGC 838
            G L  +    +C + PC+NG           F+C C  GW G  C+    +   C + N CKN G CI+   + FTC+C   F G  C    N C    C NGG C    N  ++C C  GF G  C +    C   P     +C +  +          C+C  G  G  CD  K  E P    C
Sbjct:  701 GRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID-------DFECRCPEGRDGKLCDHVKNNESPQPPSC 878          
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Match: SMESG000027402.1 (SMESG000027402.1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.624e-19
Identity = 77/217 (35.48%), Postives = 102/217 (47.00%), Query Frame = 2
Query:  341 CSNRPCVNGK-CVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCI---DKKNSQFTCNCTSQFIGNLCQF-------ENPCLNVNCENGGTCESLE--NGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKE 952
            C   PC NG  C+++ +  F C C +G+ G+TCEE  + CI++PC N G C+   D+  + F C C + + G LC          NPCL     NGG+C  L   NG FQC C  G+IG  C   +I     P +++ LC N G C         C C PG+ G  CD          C  + CFNGG C +    S  C C   F G NC +   E
Sbjct:  624 CKTNPCKNGGICIDSIN-NFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCL-----NGGSCSRLSTLNG-FQCHCNQGWIGTVCQFLHID--FQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTN-----ECNPNPCFNGGKC-IDKLNSYRCICAKGFYGSNCQLNYDE 825          

HSP 2 Score: 93.9745 bits (232), Expect = 5.373e-19
Identity = 66/202 (32.67%), Postives = 98/202 (48.51%), Query Frame = 2
Query:  341 CSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFENPCLNVNCENGGTC--ESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI 940
            C   PC  G C+++   EF C C   W G+ C+++ + C QN C+NGG C   +N    C C   + G+ C    PC N  C++   C  +S   G ++C C+ G+ G++C  +   C   P      C N+G C    N    C C   + G  C+      + I C++  C NGGVC+ +D G   C+CK  +TG NC I
Sbjct:  333 CFPNPCKKGTCMKS-KGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNP------CKNNGVCTDSIN-DYKCNCSTSFKGKNCE------LNIACQNQPCKNGGVCQEVDTGY-TCKCKTGYTGTNCEI 519          

HSP 3 Score: 79.337 bits (194), Expect = 1.686e-14
Identity = 65/210 (30.95%), Postives = 97/210 (46.19%), Query Frame = 2
Query:  365 GKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGM---FQCKCRYGFIGEFCAV-QNIACPVIPKKKRELCNNHGECDIYPNMTLF-CKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALIN 976
            G C+     +F C C  G++G++CE +++DC  NPCKNGG CID  N+ F C C + F G  C+   + C+   C N G C    + +   F C+C+  + G  C + ++  C   P      C N G C     +  F C C+ G+ G  C +   +  +   + + C N GVC  +      C CK  F GK+C I   E       N
Sbjct:  594 GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINN-FECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNP------CLNGGSCSRLSTLNGFQCHCNQGWIGTVC-QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFN 795          

HSP 4 Score: 73.9442 bits (180), Expect = 6.335e-13
Identity = 75/254 (29.53%), Postives = 115/254 (45.28%), Query Frame = 2
Query:  398 RCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLC-QFENPCLNVN-CENGGTCESL--ENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGGVCKVLDNGSPICECKGEFTGKNCTI--PLKETRKEALINIKIPKT-FNEKQLIIKKTKSPSLCD--------NLCKASFENGICDQQCNTFACN 1114
             C C  GW+G  C+E    C++ P    GTC+D   S +TC+C + + G  C Q  N C   N C+NGG CE+L  E   ++C C  GF G  C +    C   P KK     + GE         +C+C   +TG  CD+   +     C  + C NGG C   +NG+  C C+  + G  C +  P + ++ +  ++ +I  T   + + + +   +   CD        N CK    NG+C    N + CN
Sbjct:  242 ECRCRAGWQGTFCDE----CMKYPGCKHGTCVD---SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKGTCMKSKGE--------FYCQCIERWTGKLCDQDTSI-----CDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCK---NNGVCTDSINDYKCN 470          

HSP 5 Score: 62.3882 bits (150), Expect = 2.318e-9
Identity = 46/123 (37.40%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  338 LCSNRPCVNGKCVEAFDPEFRCSCWHGWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFC-AVQNIACPVIP 700
            LC N     G C+     +F C C  G++G+ C+ N N+C  NPC NGG CIDK NS + C C   F G+ CQ   + C +  C  G  C    +  F+C+C  G  G+ C  V+N   P  P
Sbjct:  753 LCKNE----GVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDD-FECRCPEGRDGKLCDHVKNNESPQPP 869          

HSP 6 Score: 58.5362 bits (140), Expect = 3.914e-8
Identity = 56/186 (30.11%), Postives = 74/186 (39.78%), Query Frame = 2
Query:  308 GCLLVIVSSKLCSNRPCVNGKCVEAFDP--EFRCSCWHGWKGETCE---ENVNDCIQ-NPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFE-NPCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRELCNNHGECDIYPNMTLFCKCDPGYTGDRCD--KKKELPVEIGC 838
            G L  +    +C + PC+NG           F+C C  GW G  C+    +   C + N CKN G CI+   + FTC+C   F G  C    N C    C NGG C    N  ++C C  GF G  C +    C   P     +C +  +          C+C  G  G  CD  K  E P    C
Sbjct:  694 GRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID-------DFECRCPEGRDGKLCDHVKNNESPQPPSC 871          
The following BLAST results are available for this feature:
BLAST of Neurogenic locus Notch protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOTCH13.261e-4824.25notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881... [more]
NOTCH24.969e-3730.39notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882... [more]
NOTCH42.679e-3227.72notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884... [more]
NOTCH46.315e-3228.19notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884... [more]
NOTCH47.293e-3228.19notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-124.974e-3628.06pep chromosome:WBcel235:III:9060096:9071760:-1 gen... [more]
glp-11.744e-3326.92pep chromosome:WBcel235:III:9092241:9099698:1 gene... [more]
slt-16.036e-1934.31Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
clec-781.735e-1630.24C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
crb-12.746e-1530.30Drosophila CRumBs homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
N3.068e-2726.38gene:FBgn0004647 transcript:FBtr0304659[more]
N3.068e-2726.38gene:FBgn0004647 transcript:FBtr0070507[more]
eys7.508e-2733.50gene:FBgn0031414 transcript:FBtr0344662[more]
eys7.508e-2733.50gene:FBgn0031414 transcript:FBtr0344663[more]
LRP15.538e-2031.96gene:FBgn0053087 transcript:FBtr0344894[more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch1b2.153e-5424.65notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415... [more]
notch1b2.962e-5424.65notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415... [more]
notch1a3.501e-3824.21notch receptor 1a [Source:NCBI gene;Acc:30718][more]
notch32.270e-3725.91notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
notch32.878e-3725.91notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch17.553e-4128.57notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch11.560e-4028.86notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch16.779e-3928.35notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch19.236e-3928.35notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch11.125e-3828.35notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Notch12.835e-5023.40notch 1 [Source:MGI Symbol;Acc:MGI:97363][more]
Notch21.076e-3730.99notch 2 [Source:MGI Symbol;Acc:MGI:97364][more]
Notch32.962e-3028.26notch 3 [Source:MGI Symbol;Acc:MGI:99460][more]
Notch49.790e-2627.69notch 4 [Source:MGI Symbol;Acc:MGI:107471][more]
Sned13.234e-2237.31sushi, nidogen and EGF-like domains 1 [Source:MGI ... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G3I6Z6|NOTC1_CRIGR1.158e-5023.30Neurogenic locus notch homolog protein 1 OS=Cricet... [more]
sp|Q01705|NOTC1_MOUSE1.983e-4923.40Neurogenic locus notch homolog protein 1 OS=Mus mu... [more]
sp|Q07008|NOTC1_RAT4.316e-4923.30Neurogenic locus notch homolog protein 1 OS=Rattus... [more]
sp|P21783|NOTC1_XENLA5.219e-4824.71Neurogenic locus notch homolog protein 1 OS=Xenopu... [more]
sp|P46531|NOTC1_HUMAN1.566e-4724.25Neurogenic locus notch homolog protein 1 OS=Homo s... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QVN91.460e-6824.93Uncharacterized protein OS=Mesocestoides corti OX=... [more]
V4BGJ21.272e-5626.28Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A3B3BFS62.949e-5625.37Notch receptor 2 OS=Oryzias melastigma OX=30732 PE... [more]
H2V8L99.104e-5625.82Notch receptor 2 OS=Takifugu rubripes OX=31033 GN=... [more]
A0A1A9W9771.572e-5524.95Uncharacterized protein OS=Glossina brevipalpis OX... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch1b4.085e-5224.16neurogenic locus notch homolog protein 1-like [Sou... [more]
notch1b4.085e-5224.16neurogenic locus notch homolog protein 1-like [Sou... [more]
notch1b4.936e-5224.16neurogenic locus notch homolog protein 1-like [Sou... [more]
notch31.414e-3925.40neurogenic locus notch homolog protein 2 [Source:N... [more]
notch31.098e-3825.63neurogenic locus notch homolog protein 2 [Source:N... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002014.11.552e-2234.29pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
JAG15.149e-2133.74jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
ENSPMAT00000004043.13.947e-2033.33pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.13.953e-2033.33pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000002643.19.808e-1832.85pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 g... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465139.432e-2534.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488511.512e-2432.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361961.128e-2330.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347032.188e-2235.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481474.456e-2236.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch1b2.977e-5224.82notch receptor 1 [Source:NCBI gene;Acc:101161732][more]
notch34.243e-4625.00neurogenic locus notch homolog protein 2 [Source:N... [more]
notch35.532e-4625.00neurogenic locus notch homolog protein 2 [Source:N... [more]
notch1a6.567e-4423.98neurogenic locus notch homolog protein 1 [Source:N... [more]
notch1a1.342e-4323.98neurogenic locus notch homolog protein 1 [Source:N... [more]
back to top
BLAST of Neurogenic locus Notch protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066558.10.000e+098.80SMESG000066558.1[more]
SMESG000063217.14.506e-3229.01SMESG000063217.1[more]
SMESG000068721.16.042e-2230.31SMESG000068721.1[more]
SMESG000027402.11.252e-1935.48SMESG000027402.1[more]
SMESG000027402.11.624e-1935.48SMESG000027402.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027457 ID=SMED30027457|Name=Neurogenic locus Notch protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3768bp
CGAAAATTGAAAACGAAATTGAATCAGAATTGTTCGCATTCAAATTCAGA
GACTTTAAAAAGACCTGCATTTGTTTTTATTTATTGCTCTTGTTGATTAA
ACGATAGAAATTAAATTTTTATACGCACGATTAATCGTTCAAACGTGGTC
AATTAATAAGCATTAAACAGCCAGTTGCAAAGCCTGCTCATTCACCTGTG
ACATTATTAGTTCTCACAACTTCATTAAAATCATCTTCAATCATCAGTTC
CAGTCAGAACTTATTATGATTTTTGCCAAAGGATTTCCAATGAACGTTTT
CATTTTAGGATGTCTGTTGGTCATTGTGTCCAGCAAATTGTGCTCAAATC
GTCCATGTGTCAATGGAAAATGTGTAGAAGCATTCGATCCGGAATTCCGC
TGTTCATGTTGGCATGGTTGGAAAGGAGAAACTTGTGAAGAAAATGTTAA
TGATTGCATTCAAAATCCGTGCAAAAATGGTGGAACATGCATTGATAAAA
AAAATAGTCAATTCACGTGTAATTGCACATCTCAATTTATCGGTAATCTT
TGTCAATTTGAAAATCCATGTTTAAATGTAAATTGTGAAAACGGCGGTAC
TTGTGAGTCGTTAGAAAATGGAATGTTTCAATGCAAATGTAGATATGGGT
TTATTGGAGAATTTTGCGCAGTTCAAAATATCGCTTGCCCTGTAATACCA
AAGAAAAAGAGGGAGCTTTGTAATAATCACGGAGAATGTGATATTTATCC
AAATATGACATTGTTTTGTAAATGCGATCCAGGATATACAGGTGACAGGT
GCGACAAAAAGAAAGAACTTCCAGTAGAAATCGGATGTAAAAGTGATTAC
TGTTTTAATGGTGGTGTTTGTAAAGTATTAGACAATGGATCTCCCATTTG
TGAATGTAAAGGAGAATTTACCGGGAAAAATTGCACAATTCCTTTGAAGG
AGACCAGAAAAGAAGCTCTTATCAACATAAAAATACCTAAAACTTTCAAT
GAAAAACAATTGATAATAAAAAAAACAAAATCACCAAGTCTGTGTGATAA
TCTATGTAAAGCCTCTTTTGAGAATGGAATTTGTGATCAACAGTGCAATA
CATTTGCATGTAATTACGACGGAGGAGACTGTGACCCATGGCGAAAGTGT
TATGGAAATGATTTAAAGCACTGCAAAGGAGTTTTTAATGATGGGGTTTG
TAATCCTGAATGTAACAATGTTGATTGCCTGTTCGATGGAGAAGATTGCC
ACAAATCTTCCTGTAAATTTCACAAGTGCTCAGAATTATACCAAAATAAA
ATTTGCGATGAAGAATGCAATAGTCCGCAGTGTGGATTTGATGGAGGCGA
TTGTCACACAAGTCGAAGTAATTCTTTCTTTAGCAATGAAGGCCTGACAA
AATGTTCGACTCAAACCAAATTATATGAATTGGATCTTGTTTTAATGACA
ACGATGCAAAATTTCACAAAGTATAAATCCGAGTTTCTTCAAAAATTAAG
TTCTTCTCTTCGGATGGTGGTCACGGTTTTTAATGTTACAGAAATAAATT
TCAACTTTGCAACTGCATTATTAATAAAATTGCATGTCAACTACACTCAA
TGTGTATTATATGGTGGGCAATGTTTCAGTTCATTAGAACAAATTTCGAA
CTTTTTAAAGGCTGGCATTGAAAAGGGAAATGTTTTATCTTTACCGTTTC
GTTTGGCAAGAGTCGACACAAGAATAATTTCAGCCTCTAAAAAACAAGAA
CTTCCCATTTACACGATGATTCTAGCGGCGCTTCTGTTGCTTTTTTTTAT
TTCCATAACTTTGATTGGAGTACTTCTAAGAGATAAATGGGGAAAACTGC
GATCTAAAATCAAGACTGCTGGAGTGTGGACTCCATCAAGCGGGTACTCG
ACTTCAACCTCACCAATAAACAGCGGGTACAACTTTGGATGGCCGAAATT
ACCACAATTAAAAGATTTCAAAAAAGAATATCAAATCCCAAACAAGTTGA
TTTATGGAGAAAGCCAACCTAAGACCGACCAACACAGGCATCTGCACGGT
GATCAGGAGCCGGATAATCCTATCAGTATTAATAACAGGAAGCGAAAATA
TGAAACAATTAACAGAAATCACCAAGCACTGGCCTTTCAGCTCATATCCG
ATTCATTAGAAAGCACTGATGGAATCCATCCGATTGACGCAGGACTCGGA
GACGTATACACAATGGCATCTGTCAAAAACCACATGAAATACGATGAGAA
ATATCAAACTTCATCTTTAGAAGGTCTTGGAGAATATGTAAATGAAAATG
GAGAGAGTCTAATGCACATTGCTGCGAGAATGAATTCCGGAGCAAATATT
ATTAAACAGATAAATGCAATTAATCCATCTATGCTTCACAGTTTAGATGA
ATGGGGTAGGACACCTTTAGCATCCTCAATAGCTGCAGATGCAACAGAAA
GCACTGAACAATTATTAATCCTTGAGAAACAACTCCGTAAAGAATCTAAA
CAAAACAAAGTACGTTCTGGAATAAATGGAATCAATTTAGGAACGCCTTG
TGAATATTTTGTAAAGAAAACCACTGCATTGATTGAGGCTGTAAAACTAG
ATTCTAAAGAAATGATCAGCTTATTGCTTGACGAAGGAAGCCCAGTTAAT
GTGTTAGACTCACAAGGACGAAGTGTTGTTCACTGGTCAGCCATGTTTAA
TAATTCTGGTTTACTCGAGCGATTAAGCCATATGAAAATCTTTCAAAAAC
TCGCTGATCTTAAAGACAACGAAGATAAAAGTCCATTATTTTTGGCAGCA
AATGAAGGAGCGATCGATTCGGTGAAATATTTGCTCGCCTATTTCAATAA
ATCTTCGATTAAAATGGATCCAAATTGCCCATGTCCAAAGTTAATTGCTG
AAGAGAAAGGCTTTTACGAGATTAGAGACCTCATTCAAGAAACCCTAAGA
AAAGTGACTATTACCGATAGAAATGAAAAGAAAACCAAATCGAAAGAATC
TAAAACCAAAAACAAAATACACAATTTCGACACTTCCGGCAACCTGTGCA
TTATCGACGAATATAAAGAATTATCGAGTAATTCGCTTGAAAATCTGCAA
AGTTCCCCTTTAGGCAATGAATCAATTGATTCATGTTTATTGGACCTTTA
TTCAATTACGGATCCCATGCAAAATCCACAAGAACCATATTCAAATGAAA
AAAGTTTATATAGCTCCTTTAAGCCAGTGGAGCATCGATATCATGGATAT
CAATCAAACACGTCAAGCTCTGATATGTCACCCCCGTTATTGAATTTGAA
CAATCAACAATTTCAAAATGGCTTTAATTCGATTACGCATTCTGAGCACT
TGGATTCCAATTATTCGAATTCGATATTCTTGAGTCCGAAAAGTTTTATT
GGTTTACCAGACCCTATCAATGGATCTGGTCTAAATAAGGCAACAGACTT
CCAAACAGACTTTTATAACTATCAAGCATCACCAATTCTCTCTGAATATA
AATACTATTCTAATCCGGTTCCAAAATTTCCTCCCGTCAACTGTCTGTTA
TAGAATGTCTTTATCAATTGGAAGTTTCAGAATTAAATTAAAGTTTGTCC
AGGAAACTTCCCAATTTCTGACAGATTTATCATTTGCTTTTTGTAAATAA
CTTTTGAGCTGTGTACGTTTATTATTTTATTACATACACGATTCATTTGT
AAATAGATTAAATTATTGTAAAGTTTTATTGCAATTGTATTTTATATTTT
AAATGCGGTAGTAAAATC
back to top

protein sequence of SMED30027457-orf-1

>SMED30027457-orf-1 ID=SMED30027457-orf-1|Name=SMED30027457-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1096bp
MIFAKGFPMNVFILGCLLVIVSSKLCSNRPCVNGKCVEAFDPEFRCSCWH
GWKGETCEENVNDCIQNPCKNGGTCIDKKNSQFTCNCTSQFIGNLCQFEN
PCLNVNCENGGTCESLENGMFQCKCRYGFIGEFCAVQNIACPVIPKKKRE
LCNNHGECDIYPNMTLFCKCDPGYTGDRCDKKKELPVEIGCKSDYCFNGG
VCKVLDNGSPICECKGEFTGKNCTIPLKETRKEALINIKIPKTFNEKQLI
IKKTKSPSLCDNLCKASFENGICDQQCNTFACNYDGGDCDPWRKCYGNDL
KHCKGVFNDGVCNPECNNVDCLFDGEDCHKSSCKFHKCSELYQNKICDEE
CNSPQCGFDGGDCHTSRSNSFFSNEGLTKCSTQTKLYELDLVLMTTMQNF
TKYKSEFLQKLSSSLRMVVTVFNVTEINFNFATALLIKLHVNYTQCVLYG
GQCFSSLEQISNFLKAGIEKGNVLSLPFRLARVDTRIISASKKQELPIYT
MILAALLLLFFISITLIGVLLRDKWGKLRSKIKTAGVWTPSSGYSTSTSP
INSGYNFGWPKLPQLKDFKKEYQIPNKLIYGESQPKTDQHRHLHGDQEPD
NPISINNRKRKYETINRNHQALAFQLISDSLESTDGIHPIDAGLGDVYTM
ASVKNHMKYDEKYQTSSLEGLGEYVNENGESLMHIAARMNSGANIIKQIN
AINPSMLHSLDEWGRTPLASSIAADATESTEQLLILEKQLRKESKQNKVR
SGINGINLGTPCEYFVKKTTALIEAVKLDSKEMISLLLDEGSPVNVLDSQ
GRSVVHWSAMFNNSGLLERLSHMKIFQKLADLKDNEDKSPLFLAANEGAI
DSVKYLLAYFNKSSIKMDPNCPCPKLIAEEKGFYEIRDLIQETLRKVTIT
DRNEKKTKSKESKTKNKIHNFDTSGNLCIIDEYKELSSNSLENLQSSPLG
NESIDSCLLDLYSITDPMQNPQEPYSNEKSLYSSFKPVEHRYHGYQSNTS
SSDMSPPLLNLNNQQFQNGFNSITHSEHLDSNYSNSIFLSPKSFIGLPDP
INGSGLNKATDFQTDFYNYQASPILSEYKYYSNPVPKFPPVNCLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR035993Notch-like_dom_sf
IPR000800Notch_dom
IPR000742EGF-like_dom
IPR002110Ankyrin_rpt
IPR001881EGF-like_Ca-bd_dom
IPR013111EGF_extracell
IPR020683Ankyrin_rpt-contain_dom
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000800Notch domainPRINTSPR01452LNOTCHREPEATcoord: 351..363
score: 61.87
coord: 277..290
score: 60.87
IPR000800Notch domainSMARTSM00004NL_2coord: 253..290
e-value: 2.8E-9
score: 46.8
coord: 291..329
e-value: 9.4E-4
score: 25.3
coord: 331..364
e-value: 3.8E-5
score: 33.1
IPR000800Notch domainPFAMPF00066Notchcoord: 331..363
e-value: 5.0E-10
score: 39.7
coord: 260..290
e-value: 4.5E-9
score: 36.6
coord: 292..328
e-value: 8.8E-9
score: 35.7
IPR000800Notch domainPROSITEPS50258LNRcoord: 255..289
score: 12.519
IPR000800Notch domainPROSITEPS50258LNRcoord: 295..327
score: 9.892
IPR000800Notch domainPROSITEPS50258LNRcoord: 328..363
score: 12.616
NoneNo IPR availablePRINTSPR01983NOTCHcoord: 826..855
score: 37.89
coord: 36..64
score: 31.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 138..183
e-value: 7.4E-7
score: 30.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 189..236
e-value: 1.1E-7
score: 33.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 99..136
e-value: 2.7E-7
score: 32.6
NoneNo IPR availableGENE3DG3DSA:3.30.300.240coord: 257..330
e-value: 1.8E-16
score: 62.1
coord: 331..386
e-value: 1.6E-7
score: 33.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 60..98
e-value: 1.7E-10
score: 42.6
NoneNo IPR availableGENE3DG3DSA:3.30.70.3310coord: 387..494
e-value: 2.0E-6
score: 29.7
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 21..59
e-value: 1.4E-6
score: 30.2
NoneNo IPR availablePANTHERPTHR22804AGGRECAN/VERSICAN PROTEOGLYCANcoord: 150..419
coord: 80..225
coord: 674..863
NoneNo IPR availablePANTHERPTHR22804:SF50NEUROGENIC LOCUS NOTCH PROTEINcoord: 80..225
NoneNo IPR availablePANTHERPTHR22804:SF50NEUROGENIC LOCUS NOTCH PROTEINcoord: 150..419
coord: 21..91
coord: 674..863
NoneNo IPR availablePANTHERPTHR22804AGGRECAN/VERSICAN PROTEOGLYCANcoord: 21..91
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..16
score: 5.0
NoneNo IPR availableCDDcd00054EGF_CAcoord: 60..97
e-value: 9.48041E-6
score: 41.4682
NoneNo IPR availableCDDcd00054EGF_CAcoord: 100..134
e-value: 6.63937E-4
score: 36.0754
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.826
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 60..99
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 190..228
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 20..64
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 148..181
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 100..145
NoneNo IPR availableTMHMMTMhelixcoord: 496..518
NoneNo IPR availableTMHMMTMhelixcoord: 417..439
IPR000742EGF-like domainSMARTSM00181egf_5coord: 140..180
e-value: 0.16
score: 21.1
coord: 25..58
e-value: 0.0034
score: 26.6
coord: 190..224
e-value: 0.21
score: 20.7
coord: 63..97
e-value: 6.5E-4
score: 29.0
coord: 101..135
e-value: 1.7E-4
score: 30.9
IPR000742EGF-like domainPFAMPF00008EGFcoord: 64..94
e-value: 7.9E-5
score: 22.9
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 137..180
score: 11.677
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 60..97
score: 19.895
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 187..224
score: 16.111
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 22..58
score: 12.542
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 98..135
score: 17.043
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 60..97
e-value: 5.2E-4
score: 28.3
coord: 26..58
e-value: 0.21
score: 7.3
coord: 104..135
e-value: 0.16
score: 8.1
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 767..796
e-value: 7.9
score: 15.4
coord: 836..867
e-value: 6.8
score: 15.6
coord: 800..831
e-value: 2100.0
score: 2.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 767..799
score: 9.03
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 772..859
e-value: 2.2E-7
score: 31.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 767..857
score: 15.937
IPR013111EGF-like domain, extracellularPFAMPF07974EGF_2coord: 150..179
e-value: 3.7E-5
score: 24.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 649..898
e-value: 5.6E-21
score: 76.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 667..891
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 123..134
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 46..57
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 46..57
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 168..179
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 123..134
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 212..223
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 168..179
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 85..96
IPR035993Notch-like domain superfamilySUPERFAMILYSSF90193Notch domaincoord: 300..328
IPR035993Notch-like domain superfamilySUPERFAMILYSSF90193Notch domaincoord: 333..363
IPR035993Notch-like domain superfamilySUPERFAMILYSSF90193Notch domaincoord: 260..289