PMP-22/EMP/MP20/Claudin tight junction

Overview
NamePMP-22/EMP/MP20/Claudin tight junction
Smed IDSMED30027451
Length (bp)970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PMP-22/EMP/MP20/Claudin tight junction (SMED30027451) t-SNE clustered cells

Violin plots show distribution of expression levels for PMP-22/EMP/MP20/Claudin tight junction (SMED30027451) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PMP-22/EMP/MP20/Claudin tight junction (SMED30027451) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PMP-22/EMP/MP20/Claudin tight junction (SMED30027451) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027451

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027451h1SMcG0003770 Contig4109GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027451h1SMcG0003770 Contig4109GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30027451h1SMcG0003770 dd_Smed_v4_2731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: kune (gene:FBgn0033032 transcript:FBtr0086037)

HSP 1 Score: 82.8037 bits (203), Expect = 5.170e-18
Identity = 72/271 (26.57%), Postives = 124/271 (45.76%), Query Frame = 2
Query:   53 LGNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYN-TFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIAL----ASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPA-----------SYFVGTGSAKKPLYVPSQMGSEIQ 817
            +G S  ++ + L  +V     + I +VI+FS+P+WLV+   + N  F  +G+W +C NN+   +   +N F+GC W++ E +YI  +  F+ P + I+VQ+  ++ F++ C+ +I + + FL          + L    + QV   VF  + V+ F    + R WM     N +G+SF   ++     LL    L LV    + +K       LNE+ N      G +  Q + P+           SYF    S  +     S   S +Q
Sbjct:    1 MGASNRILQVALCASVF----SLICFVIAFSTPYWLVTDGRLQNPRFTNLGLWEVCFNNFQDIHRFFDNSFNGCLWVFEEEYYI--IHDFLLPGFYISVQLFATLCFVM-CLVVIPLTVAFLRTSRDDDRYMVLLLAIGSCQVVGSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVL-LLPSGVLYLVEARRERYK------RLNEISNREISEYGDEYYQNQGPSAVLPTAPSPYQSYFASEPSRPRRPQQSSASNSAVQ 257          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070256)

HSP 1 Score: 82.0333 bits (201), Expect = 8.693e-18
Identity = 62/251 (24.70%), Postives = 122/251 (48.61%), Query Frame = 2
Query:   47 VKLGNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPII-----ESTIALASQVGAVV---FMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAK 775
            V+ G+     +  + GA+V  F +F   ++SF SP+W+ S++    +F  MG+W  C  ++++P      +F+GC  +++  +Y+  +  ++ P WL+AVQ  +++ FI+  V ++  +L   +   P+      E  +   S +G  +   FM + V  F   +  R WM+ P FN LG+S+  A  V+ + LL +  L L        + +  +D   E +N+  +    +   Y+ P  +   + S +
Sbjct:   17 VEKGDYPRATNGVVFGAIV-TFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYV--IREYLLPGWLMAVQGFVTMSFII--VFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALA--VVTFMLLGLAALILQR------EARQAYDARGEQKNLV-MQMEMQEPGYQPPRHHHSQSRSLQ 253          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070255)

HSP 1 Score: 82.0333 bits (201), Expect = 8.693e-18
Identity = 62/251 (24.70%), Postives = 122/251 (48.61%), Query Frame = 2
Query:   47 VKLGNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPII-----ESTIALASQVGAVV---FMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAK 775
            V+ G+     +  + GA+V  F +F   ++SF SP+W+ S++    +F  MG+W  C  ++++P      +F+GC  +++  +Y+  +  ++ P WL+AVQ  +++ FI+  V ++  +L   +   P+      E  +   S +G  +   FM + V  F   +  R WM+ P FN LG+S+  A  V+ + LL +  L L        + +  +D   E +N+  +    +   Y+ P  +   + S +
Sbjct:   17 VEKGDYPRATNGVVFGAIV-TFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYV--IREYLLPGWLMAVQGFVTMSFII--VFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALA--VVTFMLLGLAALILQR------EARQAYDARGEQKNLV-MQMEMQEPGYQPPRHHHSQSRSLQ 253          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: sinu (gene:FBgn0010894 transcript:FBtr0077136)

HSP 1 Score: 63.5438 bits (153), Expect = 2.309e-11
Identity = 62/195 (31.79%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  101 VCVFV-TFIFYVISFSSPFWLVS-FDTVYNTFVRMGIWSICLNNYIHPNDLKNNK-FSGCFWLY----TELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQ-----VGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLL-SIFFLTLVYCGDK 646
            V VFV  F F VI+F++P WLVS +        R+G+W  C  +    ND    + F GC W+Y    T    I+G   F+ P ++IA Q   ++ FI   V+ I V+++ L  G P  +  I L        +GA V  ++ VI FA       WM     N+ G+SF  A +     L+ S  FL+  +   K
Sbjct:   40 VGVFVFAFAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSLPDVNDDSQRRFFVGCRWVYDPFTTGYDEIRG---FLLPAFMIATQFFYTLAFIGMLVSAIGVLVFILCAG-PDQKHFITLIKSLGYVLLGAGVSAAIAVIVFAGFGNRNGWMPEHANNWFGWSFILACVGTVLTLVASTLFLSEAHVQHK 230          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0100198)

HSP 1 Score: 49.6766 bits (117), Expect = 2.746e-7
Identity = 22/82 (26.83%), Postives = 46/82 (56.10%), Query Frame = 2
Query:   47 VKLGNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTEL 292
            V+ G+     +  + GA+V  F +F   ++SF SP+W+ S++    +F  MG+W  C  ++++P      +F+GC  +++ +
Sbjct:   17 VEKGDYPRATNGVVFGAIV-TFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHV 97          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A4E0RFY9 (PMP-22/EMP/MP20/Claudin tight junction OS=Fasciola hepatica OX=6192 GN=D915_008416 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.142e-51
Identity = 90/231 (38.96%), Postives = 144/231 (62.34%), Query Frame = 2
Query:   80 MPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNK-HIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGS 769
            MP   A V   + F+F+ +SFSSP+WL S+D V+++F+ MGIWS+C + ++HP D   N  +GC+W++   F+  G+W +++P WL+AVQVLI++ FI QC  ++ ++LY LLYG+P  EST+A+  Q+   + ++V VIT+ ++ EDR+WM RPD NFL +SFGFAIL      ++  FL  V   D+  + +   F+ + +   +  +  G   +      S + GT S
Sbjct:   51 MPFYAACVATTIGFLFFFLSFSSPYWLQSYDRVHSSFLHMGIWSVCFDRFVHPQDYHANVLTGCYWIFDPFFFKIGIWQWLDPAWLVAVQVLITVAFITQCCVILILVLYHLLYGHPAAESTMAMGGQLFIGILLTVCVITYGVMCEDRVWMPRPDQNFLAWSFGFAILAAISSYIAAGFLYCVSYTDRAAQEEVERFEAVEQQYGLRSVLSGRAGTTSAIGQSLYGGTQS 281          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A504YNV7 (PMP-22/EMP/MP20/Claudin tight junction OS=Fasciola gigantica OX=46835 GN=FGIG_03072 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.109e-49
Identity = 88/211 (41.71%), Postives = 138/211 (65.40%), Query Frame = 2
Query:   80 MPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITG 712
            MP   A V   + F+F+ +SFSSP+WL S+D V+++F+ MGIWS+C + ++HP D   N  +GC+W++   F+  G+W +++P WL+AVQVLI++ FI QC  ++ ++LY LLYG+P  EST+A+  Q+   + ++V VIT+ ++ EDR+WM RPD NFL +SFGFAIL      ++  FL   YC    + ++   +E+   E V +  G
Sbjct:   51 MPFYAACVATTIGFLFFFLSFSSPYWLQSYDRVHSSFLHMGIWSVCFDRFVHPQDYHANVLTGCYWIFDPFFFKIGIWQWLDPAWLVAVQVLITVAFITQCCVILILVLYHLLYGHPAAESTMAMGGQLFIGILLTVCVITYGVMCEDRVWMPRPDQNFLAWSFGFAILAAISSYIAAGFL---YC--VSYTDRAAQEEVERFEAVEQQYG 256          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A1I8H825 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.701e-49
Identity = 84/241 (34.85%), Postives = 134/241 (55.60%), Query Frame = 2
Query:   56 GNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPAS-YFVGTGSAK 775
            GN I   D+P  GA      + + + ++F SP+WL S+    N F+++G+WS+C + ++HP D    +++GC+W++    + KG+W +I+P WLIAVQ +  + FI  CV+++C + +FL+ G    ES I   +Q  A VF+ + VI F +  EDR WM RPD N L +S+ FA+L  F+  +S  FL +VY  DK   N+      +     + +  GA+     A  S Y  GT   +
Sbjct:   14 GNPI--YDLPFYGAFATTLASILLHFLAFCSPYWLESYPDTKNPFLKLGLWSVCFDKFVHPKDNFGIEWTGCYWIFDWNLWNKGIWEWIDPPWLIAVQAMCGLAFICHCVSLLCSLFHFLIIGTRSAESAICCGTQGTACVFLCISVIVFGVKVEDRDWMPRPDHNHLSWSYAFAVLSCFFSAISCVFLYMVYKNDKEDDNRQ-----DGQSGFAYLQPGAQPPAMSAAGSVYAAGTARGQ 247          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267GSK8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024731g1 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.088e-49
Identity = 84/241 (34.85%), Postives = 134/241 (55.60%), Query Frame = 2
Query:   56 GNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPAS-YFVGTGSAK 775
            GN I   D+P  GA      + + + ++F SP+WL S+    N F+++G+WS+C + ++HP D    +++GC+W++    + KG+W +I+P WLIAVQ +  + FI  CV+++C + +FL+ G    ES I   +Q  A VF+ + VI F +  EDR WM RPD N L +S+ FA+L  F+  +S  FL +VY  DK   N+      +     + +  GA+     A  S Y  GT   +
Sbjct:   14 GNPI--YDLPFYGAFATTLASILLHFLAFCSPYWLESYPDTKNPFLKLGLWSVCFDKFVHPKDNFGIEWTGCYWIFDWNLWNKGIWEWIDPPWLIAVQAMCGLAFICHCVSLLCSLFHFLIIGTRSAESAICCGTQGTACVFLCISVIVFGVKVEDRDWMPRPDHNHLSWSYAFAVLSCFFSAISCVFLYMVYKNDKEDDNRQ-----DGQSGFAYLQPGAQPPAMSAAGSVYAAGTARGQ 247          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267DA83 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011460g2 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.867e-48
Identity = 83/240 (34.58%), Postives = 135/240 (56.25%), Query Frame = 2
Query:   56 GNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAK 775
            GN I   D+P  GA      + + + ++F SP+WL S+    N F+++G+WS+C + ++HP D    +++GC+W++    + KG+W +I+P WLIAVQ +  + FI  CV+++C + +FL+ G    ES I   +Q  A VF+ + VI F +  EDR WM RPD N L +S+ FA+L  F+  +S  FL +VY  DK   N+      +     + +  GA+     A  S +   G+A+
Sbjct:   14 GNPI--YDLPFYGAFATTLASILLHFLAFCSPYWLESYPDTKNPFLKLGLWSVCFDKFVHPKDNFGIEWTGCYWIFDWNLWNKGIWEWIDPPWLIAVQAMCGLAFICHCVSLLCSLFHFLIIGTRSAESAICCGTQGVACVFLCISVIVFGVKVEDRDWMPRPDHNHLSWSYAFAVLSCFFSAISCVFLYMVYKNDKEDDNRQ-----DGQSGFAYLQPGAQPPAMSAAGSVYA-AGAAR 245          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000029752.1 (SMESG000029752.1)

HSP 1 Score: 241.891 bits (616), Expect = 5.331e-81
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 2
Query:  464 VGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAKKPLYVPSQMGSEIQ 817
            VGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAKKPLYVPSQMGSEIQ
Sbjct:    1 VGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAKKPLYVPSQMGSEIQ 118          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.584e-27
Identity = 71/214 (33.18%), Postives = 116/214 (54.21%), Query Frame = 2
Query:  113 VTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLY-TELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIEST--IALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGL-----LSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQ 730
              FIF +++F SP+W+V+     + FVR+G+W  C +NYIHP D  +  + GC+++Y  E  YI+    ++NP W   VQ++ SI  +     MI V+L F+   N + ++T  +AL  Q  A     + ++   ++S+DR WM RPD N + +SF FA+L  F+ +     L I +L   +      K+K  + EL   E+ +  +G  KS Q
Sbjct:   20 AAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRD---WLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCN--SGLYKSQQ 228          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.738e-27
Identity = 71/214 (33.18%), Postives = 116/214 (54.21%), Query Frame = 2
Query:  113 VTFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLY-TELFYIKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILYFLLYGNPIIEST--IALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGL-----LSIFFLTLVYCGDKYFKNKHIFDELNEMENVSKITGGAKSSQ 730
              FIF +++F SP+W+V+     + FVR+G+W  C +NYIHP D  +  + GC+++Y  E  YI+    ++NP W   VQ++ SI  +     MI V+L F+   N + ++T  +AL  Q  A     + ++   ++S+DR WM RPD N + +SF FA+L  F+ +     L I +L   +      K+K  + EL   E+ +  +G  KS Q
Sbjct:   20 AAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRD---WLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCN--SGLYKSQQ 228          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.861e-24
Identity = 64/223 (28.70%), Postives = 109/223 (48.88%), Query Frame = 2
Query:  116 TFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFY-IKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILY-FLLYGNP---IIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIF---YGLLSIFFLTLVYCGDKYFKNKHIFDELN---EMENVSKITGGAKSSQYRAPASY 751
            T I  +I+F + +WL S+  +++ F R+G+W  CLN Y    D+K   F GC+WL+   +Y I+ L   + P W   VQ   ++ F+LQ    I +I Y F +  +P    + S I   SQ+ +++   + ++ F     D  WM RP+ N+  +S+GFAIL  F   +G  +++F+          ++K I D           +K+     +S     A+Y
Sbjct:    5 TLICVIIAFCTSYWLQSWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDL---LTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMR--------EDKQILDNEQYSFPTHASTKVVKNKATSLIAESATY 216          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.566e-24
Identity = 64/223 (28.70%), Postives = 109/223 (48.88%), Query Frame = 2
Query:  116 TFIFYVISFSSPFWLVSFDTVYNTFVRMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFY-IKGLWIFINPYWLIAVQVLISIGFILQCVTMICVILY-FLLYGNP---IIESTIALASQVGAVVFMSVGVITFAILSEDRLWMLRPDFNFLGFSFGFAILVIF---YGLLSIFFLTLVYCGDKYFKNKHIFDELN---EMENVSKITGGAKSSQYRAPASY 751
            T I  +I+F + +WL S+  +++ F R+G+W  CLN Y    D+K   F GC+WL+   +Y I+ L   + P W   VQ   ++ F+LQ    I +I Y F +  +P    + S I   SQ+ +++   + ++ F     D  WM RP+ N+  +S+GFAIL  F   +G  +++F+          ++K I D           +K+     +S     A+Y
Sbjct:   28 TLICVIIAFCTSYWLQSWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDL---LTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMR--------EDKQILDNEQYSFPTHASTKVVKNKATSLIAESATY 239          
The following BLAST results are available for this feature:
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kune5.170e-1826.57gene:FBgn0033032 transcript:FBtr0086037[more]
pck8.693e-1824.70gene:FBgn0013720 transcript:FBtr0070256[more]
pck8.693e-1824.70gene:FBgn0013720 transcript:FBtr0070255[more]
sinu2.309e-1131.79gene:FBgn0010894 transcript:FBtr0077136[more]
pck2.746e-726.83gene:FBgn0013720 transcript:FBtr0100198[more]
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RFY92.142e-5138.96PMP-22/EMP/MP20/Claudin tight junction OS=Fasciola... [more]
A0A504YNV71.109e-4941.71PMP-22/EMP/MP20/Claudin tight junction OS=Fasciola... [more]
A0A1I8H8253.701e-4934.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GSK88.088e-4934.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DA831.867e-4834.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029752.15.331e-81100.00SMESG000029752.1[more]
SMESG000042798.11.584e-2733.18SMESG000042798.1[more]
SMESG000042798.11.738e-2733.18SMESG000042798.1[more]
SMESG000028931.14.861e-2428.70SMESG000028931.1[more]
SMESG000028931.17.566e-2428.70SMESG000028931.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027451 ID=SMED30027451|Name=PMP-22/EMP/MP20/Claudin tight junction|organism=Schmidtea mediterranea sexual|type=transcript|length=970bp
TTTCAAGGTAATTGTAAATAAATATTTTCCTTGTTATATTTAAATGGTTA
AACTCGGAAATTCAATAAGTGTTATTGATATGCCCCTAATGGGGGCTGTT
GTTTGTGTTTTTGTTACATTTATTTTTTATGTGATCAGTTTTTCAAGCCC
CTTTTGGTTAGTATCTTTTGATACAGTTTATAATACTTTTGTCCGAATGG
GCATTTGGTCAATTTGTCTTAATAATTATATTCACCCTAACGATTTAAAA
AACAATAAATTTTCCGGGTGTTTCTGGTTATATACGGAGTTATTCTATAT
TAAAGGTCTCTGGATTTTTATTAACCCTTATTGGCTTATAGCTGTACAAG
TACTCATATCAATAGGATTTATATTGCAATGCGTAACTATGATATGTGTG
ATTTTATATTTTCTTTTATATGGAAATCCAATAATTGAATCCACAATAGC
TTTGGCAAGTCAAGTTGGTGCAGTTGTTTTTATGTCAGTTGGAGTAATTA
CATTTGCGATTTTATCAGAAGATAGACTTTGGATGCTTAGGCCGGATTTC
AATTTTTTGGGATTTTCCTTTGGATTTGCAATTTTGGTAATCTTTTATGG
ATTGCTTTCAATTTTCTTTTTAACATTGGTATATTGCGGTGACAAATACT
TCAAGAATAAACATATCTTTGATGAATTAAATGAAATGGAAAATGTTAGT
AAAATTACTGGCGGAGCTAAAAGCAGTCAATATCGTGCACCAGCAAGCTA
TTTTGTTGGAACTGGATCGGCGAAAAAGCCATTATATGTGCCTAGCCAAA
TGGGTTCTGAAATACAATAATCATTCAAATCATTTTTTTTACATATTCAA
GCTTTATTTCGTGTTTTTATATTTGTATTGGCATTTTCTAATGACCATTG
GCTGTGGTTTTATTGATTACGAACTATTTGTATTACTTCTTCTGATAATA
TATAGAATATCGTTTTGCAA
back to top

protein sequence of SMED30027451-orf-1

>SMED30027451-orf-1 ID=SMED30027451-orf-1|Name=SMED30027451-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=259bp
MVKLGNSISVIDMPLMGAVVCVFVTFIFYVISFSSPFWLVSFDTVYNTFV
RMGIWSICLNNYIHPNDLKNNKFSGCFWLYTELFYIKGLWIFINPYWLIA
VQVLISIGFILQCVTMICVILYFLLYGNPIIESTIALASQVGAVVFMSVG
VITFAILSEDRLWMLRPDFNFLGFSFGFAILVIFYGLLSIFFLTLVYCGD
KYFKNKHIFDELNEMENVSKITGGAKSSQYRAPASYFVGTGSAKKPLYVP
SQMGSEIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004031PMP-22/EMP/MP20/Claudin superfamilyPFAMPF13903Claudin_2coord: 24..189
e-value: 2.3E-8
score: 34.0
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 14..211
e-value: 2.5E-9
score: 38.8
NoneNo IPR availablePANTHERPTHR21284FAMILY NOT NAMEDcoord: 16..197
NoneNo IPR availableTMHMMTMhelixcoord: 77..99
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 177..199
NoneNo IPR availableTMHMMTMhelixcoord: 135..157