forkhead box A-1

Overview
Nameforkhead box A-1 (AFJ24799.1)
Smed IDSMED30027428
Length (bp)2149
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of forkhead box A-1 (SMED30027428) t-SNE clustered cells

Violin plots show distribution of expression levels for forkhead box A-1 (SMED30027428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of forkhead box A-1 (SMED30027428) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for forkhead box A-1 (SMED30027428) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30027428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 31

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30027428SMESG000065670.1 SmedASXL_015256SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynx progenitor cellSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027428SMESG000065670.1 dd_Smed_v4_10718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027428SMESG000065670.1 dd_Smed_v6_10718_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
pharynxSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
pharynxSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
pharynxSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30027428SMESG000065670.1 SMED30027428smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30027428SMESG000065670.1 Contig49549uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30027428SMESG000065670.1 Contig49549newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30027428SMESG000065670.1 OX_Smed_1.0.21372ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:24737865
Adler et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
obsolete pharynx nerve plexusSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:24737865
Adler et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx nerve plexusSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:24737865
Adler et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx epitheliumSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:24737865
Adler et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx musculatureSMED30027428SMESG000065670.1 JX010556.1smed_ncbi_20200123PMID:24737865
Adler et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA1 (forkhead box A1 [Source:HGNC Symbol;Acc:HGNC:5021])

HSP 1 Score: 215.312 bits (547), Expect = 1.464e-61
Identity = 94/118 (79.66%), Postives = 103/118 (87.29%), Query Frame = 1
Query:  832 RDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            R +     + + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK
Sbjct:  150 RSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFK 267          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA2 (forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022])

HSP 1 Score: 211.46 bits (537), Expect = 2.573e-60
Identity = 97/128 (75.78%), Postives = 106/128 (82.81%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  139 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 256          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA2 (forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022])

HSP 1 Score: 211.46 bits (537), Expect = 2.737e-60
Identity = 97/128 (75.78%), Postives = 106/128 (82.81%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  145 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 262          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA3 (forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023])

HSP 1 Score: 203.756 bits (517), Expect = 9.884e-59
Identity = 93/121 (76.86%), Postives = 102/121 (84.30%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAAT 1230
            Y+R   HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRFK    ++ +    AAT
Sbjct:  109 YRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKL-EEKVKKGGSGAAT 228          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXB1 (forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799])

HSP 1 Score: 176.407 bits (446), Expect = 5.421e-49
Identity = 74/108 (68.52%), Postives = 90/108 (83.33%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+SP  M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 190.274 bits (482), Expect = 1.588e-53
Identity = 90/143 (62.94%), Postives = 108/143 (75.52%), Query Frame = 1
Query:  796 GLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            G+  G G+  + ++  +++   R +  +Y  +KPPYSYISLITMAIQ S     TLSEIY +IMD FPYY+ NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGS+WTLH   GNMFENGCYLRRQKRFK   RE  R+ + A
Sbjct:  110 GVSGGQGQELTIQEFETVTEKIRRH-GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA 251          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 191.045 bits (484), Expect = 1.667e-53
Identity = 90/143 (62.94%), Postives = 108/143 (75.52%), Query Frame = 1
Query:  796 GLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            G+  G G+  + ++  +++   R +  +Y  +KPPYSYISLITMAIQ S     TLSEIY +IMD FPYY+ NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGS+WTLH   GNMFENGCYLRRQKRFK   RE  R+ + A
Sbjct:  141 GVSGGQGQELTIQEFETVTEKIRRH-GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA 282          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 192.2 bits (487), Expect = 2.779e-53
Identity = 90/143 (62.94%), Postives = 108/143 (75.52%), Query Frame = 1
Query:  796 GLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            G+  G G+  + ++  +++   R +  +Y  +KPPYSYISLITMAIQ S     TLSEIY +IMD FPYY+ NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGS+WTLH   GNMFENGCYLRRQKRFK   RE  R+ + A
Sbjct:  205 GVSGGQGQELTIQEFETVTEKIRRH-GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA 346          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: lin-31 (pep chromosome:WBcel235:II:3982549:3986944:1 gene:WBGene00003017.1 transcript:K10G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 142.124 bits (357), Expect = 4.137e-38
Identity = 62/101 (61.39%), Postives = 77/101 (76.24%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYL 1164
            RP + SY   KPPYSYI L  MAIQ+S   M  L+EIY++IMD FP+YR+N QRWQNS+RH+LSFNDCF+K+ R  ++PGKGSYW +HP +  MFENG  L
Sbjct:    3 RPGKDSYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAVHPNASGMFENGSCL 103          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 144.436 bits (363), Expect = 7.480e-38
Identity = 63/104 (60.58%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  874 RSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            R  +HAKPPYSYI+LI M+I NSP    TLSEI +FI++ F YY++    WQNSIRH+LS NDCFVKV+R P  PGKG+YW L P   +MF+NG +LRR+KR+K
Sbjct:  121 RKSSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYK 224          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0300259)

HSP 1 Score: 224.172 bits (570), Expect = 7.385e-65
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0345227)

HSP 1 Score: 224.172 bits (570), Expect = 7.385e-65
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0085321)

HSP 1 Score: 224.172 bits (570), Expect = 7.385e-65
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0346765)

HSP 1 Score: 224.172 bits (570), Expect = 9.634e-65
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0330333)

HSP 1 Score: 224.942 bits (572), Expect = 1.498e-63
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa1 (forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-78])

HSP 1 Score: 221.09 bits (562), Expect = 2.437e-64
Identity = 103/141 (73.05%), Postives = 116/141 (82.27%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK------DPHREIGRQSQRAATG-PGSNVT 1251
            + +N+ ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK      D  R  G++ Q + +G P S+ T
Sbjct:  143 ARDNKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCDKKLPDGKRSEGKREQSSGSGSPASDST 283          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 212.616 bits (540), Expect = 1.758e-61
Identity = 110/193 (56.99%), Postives = 131/193 (67.88%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF-------KDPHREIGRQSQRAAT-------GPGSNVTENNHDNASQE-------ASDNAESDTKPNIKQLDLSSDLLTNQGH 1365
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRF       KDP R+       +++        P SN + N H  +  +       + D+A S T      L   + +L ++GH
Sbjct:  137 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCDKKLSKDPSRKTSEGGSNSSSESCNGNESPHSNSSSNEHKRSLSDMKSGQGLSPDHAASPTSQAQHLLAQHNSVLAHEGH 329          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa3 (forkhead box A3 [Source:ZFIN;Acc:ZDB-GENE-980526-423])

HSP 1 Score: 211.075 bits (536), Expect = 1.347e-60
Identity = 110/192 (57.29%), Postives = 126/192 (65.62%), Query Frame = 1
Query:  826 SPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF--------------------KDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSS 1341
            SP   N      +PY+RS THAKPPYSYISLITMAIQ S   M TL+EIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRF                    K  H   G Q + + T  GS+  E+ H ++S   S + E     ++ QLD  S
Sbjct:  121 SPTSLNRTKEMPKPYRRSLTHAKPPYSYISLITMAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNMFENGCYLRRQKRFKIEEKAGKKSSSKSQDGSSTKGTHSSEGMQEEHSPTT-GSDGAESAHSDSSHAGSTSEEQQR--SLVQLDCPS 309          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 188.348 bits (477), Expect = 1.873e-53
Identity = 83/106 (78.30%), Postives = 91/106 (85.85%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            Y+R+ +HAKPPYSYISLI MAIQ SP    TL+EIY +I   FPYYRQNQQRWQNSIRHSLSFNDCFV+V RSP+ PGKGSYW LHP SGNMFENGCY+RRQKRFK
Sbjct:   68 YRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNMFENGCYMRRQKRFK 173          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 187.963 bits (476), Expect = 2.366e-53
Identity = 83/106 (78.30%), Postives = 91/106 (85.85%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            Y+R+ +HAKPPYSYISLI MAIQ SP    TL+EIY +I   FPYYRQNQQRWQNSIRHSLSFNDCFV+V RSP+ PGKGSYW LHP SGNMFENGCY+RRQKRFK
Sbjct:   68 YRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNMFENGCYMRRQKRFK 173          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: xk (X-linked Kx blood group [Source:Xenbase;Acc:XB-GENE-1005584])

HSP 1 Score: 217.238 bits (552), Expect = 9.361e-63
Identity = 99/134 (73.88%), Postives = 113/134 (84.33%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQ---RAATGPGS 1242
            + + + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK   ++ G+ SQ   +  +GP S
Sbjct:  144 TRDTKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQQGGKGSQDGRKDVSGPSS 277          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:395063])

HSP 1 Score: 212.616 bits (540), Expect = 5.573e-61
Identity = 94/112 (83.93%), Postives = 102/112 (91.07%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  135 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 246          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: ventx1.2 (VENT homeobox 1, gene 2 [Source:Xenbase;Acc:XB-GENE-920868])

HSP 1 Score: 210.69 bits (535), Expect = 1.150e-60
Identity = 94/121 (77.69%), Postives = 106/121 (87.60%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            R Y+R+Y+HAKPPYSYISLITMAIQ +P  M TL+EIYQ+I+D FPYYRQNQQRWQNSIRHSLSFNDCFVKV RSPEKPGKGSYWTLHP+SGNMFENGCYLRRQKRFK    + G + ++ 
Sbjct:  109 RTYRRNYSHAKPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNMFENGCYLRRQKRFKCERSKSGEREKKV 229          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: serpinc1 (serpin peptidase inhibitor, clade C (antithrombin), member 1 [Source:Xenbase;Acc:XB-GENE-975782])

HSP 1 Score: 172.17 bits (435), Expect = 1.686e-47
Identity = 73/108 (67.59%), Postives = 89/108 (82.41%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+S   M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: FOXB2 (forkhead box B2 [Source:NCBI gene;Acc:101730239])

HSP 1 Score: 156.377 bits (394), Expect = 2.618e-42
Identity = 67/101 (66.34%), Postives = 82/101 (81.19%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYL 1164
            RP + SY+  KPPYSYISL  MAIQ+S   M  LS+IY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +L
Sbjct:    3 RPGKSSYSEQKPPYSYISLTAMAIQSSQEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFL 103          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa2 (forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476])

HSP 1 Score: 219.55 bits (558), Expect = 2.087e-63
Identity = 107/177 (60.45%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA------TGPGSNVTENNHDNASQEASDNAESDTKP 1314
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   +   +++  AA      T PGS  ++     A+  AS+       P
Sbjct:  139 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESP 305          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa2 (forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476])

HSP 1 Score: 219.164 bits (557), Expect = 2.623e-63
Identity = 107/177 (60.45%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA------TGPGSNVTENNHDNASQEASDNAESDTKP 1314
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   +   +++  AA      T PGS  ++     A+  AS+       P
Sbjct:  145 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESP 311          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa1 (forkhead box A1 [Source:MGI Symbol;Acc:MGI:1347472])

HSP 1 Score: 214.927 bits (546), Expect = 1.389e-61
Identity = 94/118 (79.66%), Postives = 103/118 (87.29%), Query Frame = 1
Query:  832 RDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            R +     + + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK
Sbjct:  150 RSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFK 267          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa3 (forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477])

HSP 1 Score: 204.142 bits (518), Expect = 6.126e-59
Identity = 90/106 (84.91%), Postives = 96/106 (90.57%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            Y+R   HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRFK
Sbjct:  111 YRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFK 216          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxb1 (forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549])

HSP 1 Score: 176.407 bits (446), Expect = 4.033e-49
Identity = 74/108 (68.52%), Postives = 90/108 (83.33%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+SP  M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. UniProt/SwissProt
Match: sp|Q17241|SGF1_BOMMO (Silk gland factor 1 OS=Bombyx mori OX=7091 GN=SGF1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 5.000e-66
Identity = 102/133 (76.69%), Postives = 115/133 (86.47%), Query Frame = 1
Query:  826 SPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            SP      + N++ Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVKV R+P+KPGKGS+WTLHP SGNMFENGC+LRRQKRFKD  +E  RQ+Q+A
Sbjct:   91 SPTSALQRARNDKTYRRSYTHAKPPYSYISLITMAIQNNPSRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHPDSGNMFENGCFLRRQKRFKDEKKETLRQAQKA 223          
BLAST of forkhead box A-1 vs. UniProt/SwissProt
Match: sp|P14734|FKH_DROME (Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 7.402e-64
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. UniProt/SwissProt
Match: sp|P35583|FOXA2_MOUSE (Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.460e-62
Identity = 107/177 (60.45%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA------TGPGSNVTENNHDNASQEASDNAESDTKP 1314
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   +   +++  AA      T PGS  ++     A+  AS+       P
Sbjct:  139 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESP 305          
BLAST of forkhead box A-1 vs. UniProt/SwissProt
Match: sp|O42097|FOXA2_ORYLA (Hepatocyte nuclear factor 3-beta OS=Oryzias latipes OX=8090 GN=foxa2 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 5.632e-62
Identity = 104/162 (64.20%), Postives = 120/162 (74.07%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF--------KDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTK 1311
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TL+EIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRF        K+P R+ G      ++    N  E+ H N+S      + SD K
Sbjct:  136 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLAEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKKMSMKEPGRKGGDGGSANSSSDSCNGNESPHSNSSSGEHKRSLSDMK 297          
BLAST of forkhead box A-1 vs. UniProt/SwissProt
Match: sp|P32315|FXA1B_XENLA (Forkhead box protein A1-B OS=Xenopus laevis OX=8355 GN=foxa1-b PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.881e-61
Identity = 99/138 (71.74%), Postives = 114/138 (82.61%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQ 1218
            +G G ++  R ++S     + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCF+KVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK    + G+ +Q
Sbjct:  133 MGYGATNINRTRDS-----KTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFIKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKTQGGKGNQ 265          
BLAST of forkhead box A-1 vs. TrEMBL
Match: I1ZIE5 (Forkhead box A-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 905.975 bits (2340), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 1
Query:  571 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLXXXXXXXXXXXXXXXXXRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLXXXXXXXXXXEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKXXXXXXXXXXXXXAMSDYYKYVQNPQPGNSDMSL 2025
            MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQNQQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL
Sbjct:    1 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQNQQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL 485          
BLAST of forkhead box A-1 vs. TrEMBL
Match: Q9NDK9 (Winged helix/forkhead transcription factor DjFoxA OS=Dugesia japonica OX=6161 GN=DjFoxA PE=2 SV=1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 449/486 (92.39%), Postives = 467/486 (96.09%), Query Frame = 1
Query:  571 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLXXXXXXXXXXXXXXXXXRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLXXXXXXXXXXEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLV-AAAMGVSPHDTLYAGATGPSVDLEHMKXXXXXXXXXXXXXAMSDYYKYVQNPQPGNSDMSL 2025
            M+GKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQV TLSLNL+GIGPHSLSPMSASMSGIAAMAGGMRQGL+LGL RSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA GPGSN TENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKN+ PTS SQ+C MFHRKKENCSPVEMK+NNQ QQ  QQ+H Q+HYNPNQQFYSNQQNIFQQS+L+HY+L ASDDPLGQGMHLP GA+SVFGLYG HNL N+DQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHP LV AAAMG+SPHD+LYA ATG SVDLEHMKYYSNY+NVPPYS+AM+DYYKYVQNPQPGNSDMSL
Sbjct:    1 MIGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVPTLSLNLSGIGPHSLSPMSASMSGIAAMAGGMRQGLDLGLSRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAAAGPGSNATENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNSIPTSASQTCPMFHRKKENCSPVEMKMNNQPQQPTQQQHQQLHYNPNQQFYSNQQNIFQQSTLEHYALSASDDPLGQGMHLPQGASSVFGLYG-HNLQNEDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPSLVAAAAMGLSPHDSLYAAATGSSVDLEHMKYYSNYSNVPPYSTAMADYYKYVQNPQPGNSDMSL 485          
BLAST of forkhead box A-1 vs. TrEMBL
Match: D3J1K2 (FoxA (Fragment) OS=Schmidtea polychroa OX=50054 GN=foxA PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 8.534e-129
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 1
Query:  790 RQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLS 1338
            RQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSN+TENNHDNASQEASDNAESDTKPNIKQLDLS
Sbjct:   15 RQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNITENNHDNASQEASDNAESDTKPNIKQLDLS 197          
BLAST of forkhead box A-1 vs. TrEMBL
Match: A0A1B6CCN2 (Fork-head domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.30564 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.550e-66
Identity = 112/185 (60.54%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSI--SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLL 1350
            +LG   + SP    ++  +  ++ Y+RSYTHAKPPYSYISLITMAIQNSP+ M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVKV R+P+KPGKGS+WTLHP+SGNMFENGCYLRRQKRFKD  +E  R + ++ + PG ++  ++HD   ++  D  +   K ++  L L S +L
Sbjct:  117 DLGSADAGSPNSAAALQRARTDKSYRRSYTHAKPPYSYISLITMAIQNSPIKMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHPESGNMFENGCYLRRQKRFKDEKKEASRSTHKSVS-PGQHLHIHHHD--IEKKGDKLD---KVSVSDLGLQSSML 295          
BLAST of forkhead box A-1 vs. TrEMBL
Match: A0A224XIG3 (Putative forkhead/hnf-3-related transcription factor (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 5.234e-66
Identity = 103/144 (71.53%), Postives = 119/144 (82.64%), Query Frame = 1
Query:  808 GLGRSDSPRDKNSI---SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAAT 1230
             +G + SP    ++   +  ++ Y+RSYTHAKPPYSYISLITMAIQNSP  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVKV R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQS ++ +
Sbjct:  103 AIGETVSPSSVAALQRAARTDKSYRRSYTHAKPPYSYISLITMAIQNSPTKMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDDKKEAQRQSHKSVS 246          
BLAST of forkhead box A-1 vs. Ensembl Cavefish
Match: foxa1 (forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-78])

HSP 1 Score: 216.853 bits (551), Expect = 2.668e-63
Identity = 96/112 (85.71%), Postives = 103/112 (91.96%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            + +N+ ++RSY HAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK
Sbjct:  125 ARDNKTFRRSYPHAKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFK 236          
BLAST of forkhead box A-1 vs. Ensembl Cavefish
Match: foxa3 (hepatocyte nuclear factor 3-gamma [Source:NCBI gene;Acc:103043939])

HSP 1 Score: 216.083 bits (549), Expect = 1.890e-62
Identity = 111/209 (53.11%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSN--------VTENNHDNASQEASDNAESDT----------KPNIKQLDL---SSDLLTNQGHNIKNTNPTSVSQSCSMFHRK 1425
            +PY+RS THAKPPYSYISLITMAIQ S   M TL+EIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRFK   +   +      +  G N        + E++   A  + +D+A+SD           + N+  LD    ++ L      +I ++ PTS+S + S  H +
Sbjct:  132 KPYRRSLTHAKPPYSYISLITMAIQQSGSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNMFENGCYLRRQKRFKIEDKSAKKSGSSGKSQEGGNGKNEHQDGIQEDHSPAAGSDGADSAQSDASHPGSVSEEQQRNLVPLDCPSQATSLTHGSPLSIPSSVPTSMSTASSHLHSQ 340          
BLAST of forkhead box A-1 vs. Ensembl Cavefish
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:103033433])

HSP 1 Score: 207.223 bits (526), Expect = 1.286e-59
Identity = 98/153 (64.05%), Postives = 118/153 (77.12%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNI 1320
            + Y+RSYTHAKPPYSYISLITMAIQ S   M TL+EIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   + + ++S R   G G N   +   ++  +    +E+  +P +
Sbjct:  125 KAYRRSYTHAKPPYSYISLITMAIQQSSSKMLTLNEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKC-EKLLEKESNRKE-GEGENSKGSPQPSSPTKDQKRSEAKARPAL 275          
BLAST of forkhead box A-1 vs. Ensembl Cavefish
Match: foxa (hepatocyte nuclear factor 3-gamma-like [Source:NCBI gene;Acc:103028902])

HSP 1 Score: 187.578 bits (475), Expect = 3.586e-52
Identity = 81/106 (76.42%), Postives = 93/106 (87.74%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            Y+R+++H+KPPYSYISLI MAIQ SP    TL+EIY +I   FPYYRQNQQRWQNSIRHSLSFNDCF++V RSPE PGKGS+WTLHP SGNMFENGCY+RRQKRF+
Sbjct:   94 YRRTFSHSKPPYSYISLIYMAIQQSPTKKLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFIRVPRSPESPGKGSFWTLHPDSGNMFENGCYMRRQKRFR 199          
BLAST of forkhead box A-1 vs. Ensembl Cavefish
Match: foxb1a (forkhead box B1 [Source:NCBI gene;Acc:103044512])

HSP 1 Score: 174.866 bits (442), Expect = 8.014e-49
Identity = 73/108 (67.59%), Postives = 89/108 (82.41%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+ P  M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Ensembl Sea Lamprey
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 203.371 bits (516), Expect = 2.590e-58
Identity = 97/148 (65.54%), Postives = 115/148 (77.70%), Query Frame = 1
Query:  808 GLGRSDSPRDKNSISN------NNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK-DPHREIGRQSQRAAT 1230
            G+G + SP      +N      +++ Y+R+YTHAKPPYSYISLITMAIQ S   M TL+EIY +IMD FP+YRQNQQRWQNSIRHSLSFNDCFVKV RSP+KPGKGS+W LHP SGNMFENGCYLRRQKRFK D  +++ +   R+ T
Sbjct:  127 GVGAAVSPMGGYGQANLANRARDSKVYRRNYTHAKPPYSYISLITMAIQQSTHKMMTLNEIYSWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKCDRKQKMPQDGSRSPT 274          
BLAST of forkhead box A-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005206.1 (pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 gene:ENSPMAG00000004735.1 transcript:ENSPMAT00000005206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.823 bits (499), Expect = 7.710e-58
Identity = 90/121 (74.38%), Postives = 101/121 (83.47%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAAT 1230
            Y+RSYTHAKPPYSYISLITMAIQ S   M TL+EIY +I D FP+YRQNQQRWQNSIRHSLSFNDCFVKV RSP+KPGKGS+W LHP SGNMFENGCYLRRQKRFK   +   + ++ A +
Sbjct:  147 YRRSYTHAKPPYSYISLITMAIQQSSGKMLTLNEIYSWITDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKCDKKGTPKTARSACS 267          
BLAST of forkhead box A-1 vs. Ensembl Sea Lamprey
Match: foxb2 (forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-320])

HSP 1 Score: 170.629 bits (431), Expect = 1.621e-47
Identity = 72/108 (66.67%), Postives = 89/108 (82.41%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+S   M  LSEIY+FIM+ FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSAEKMLPLSEIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPACGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 147.517 bits (371), Expect = 2.198e-41
Identity = 67/101 (66.34%), Postives = 80/101 (79.21%), Query Frame = 1
Query:  865 PYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLR 1167
            P+Q      KPPYSYI+LITMAIQ++P    TL+ IYQFIMD FP+YR+N+Q WQNSIRH+LS N+CFVKV R  +KPGKGSYW+L P S NMFENG +LR
Sbjct:   68 PHQAPKDLVKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENGSFLR 168          
BLAST of forkhead box A-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002547.1 (pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gene:ENSPMAG00000002324.1 transcript:ENSPMAT00000002547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 2.405e-37
Identity = 60/92 (65.22%), Postives = 70/92 (76.09%), Query Frame = 1
Query:  889 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYL 1164
             KPPYSYI+LI MAIQNS     TLS IYQFI   FP+YR+N+Q WQNSIRH+LS N+CFV V+R   +PGKGS+WTL P S  MFENG +L
Sbjct:   25 VKPPYSYIALIAMAIQNSAEGRATLSAIYQFIAGRFPFYRENKQGWQNSIRHNLSLNECFVTVARDDRRPGKGSFWTLDPDSHGMFENGSFL 116          
BLAST of forkhead box A-1 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 98.2117 bits (243), Expect = 6.847e-22
Identity = 63/162 (38.89%), Postives = 88/162 (54.32%), Query Frame = 1
Query:  892 KPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTK-PNIK-QLDLSSDLLTNQGHNI 1371
            KPPYSY +LI +AI  S     TLS+IY +I  HFPYY+Q    WQNSIRH+LS ND F+K  +S +  GKG +W + P +   F  G   R  +  KD  ++IG+  +  +T       E+   N      +  E   K P+I+ QL+ S  L  +Q H+I
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFFKGEN-RGYEFVKDSLQDIGKYFEIDSTLDELEQVESGEGNDDLPDEEEREEAGKFPSIEIQLNSSPILRVSQLHHI 267          
BLAST of forkhead box A-1 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 89.7373 bits (221), Expect = 5.924e-19
Identity = 38/79 (48.10%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  886 HAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTL 1122
            + KPP+SY ++IT AI +SP  + +L++IY++I  ++ YYR  +  WQNSIRH+LS N  F KV R P +PGKG  W +
Sbjct:  338 NVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRI 416          
BLAST of forkhead box A-1 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 83.1889 bits (204), Expect = 2.846e-17
Identity = 42/112 (37.50%), Postives = 66/112 (58.93%), Query Frame = 1
Query:  841 NSISNNNRPYQRSYT--------HAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFEN 1152
            N+++N N P+  + +        + KPP SY S+IT AI ++P    +L++IY+FI D++ +YR +Q  WQNS+RH+LS N  F KV +   + GKG  W +  +    F N
Sbjct:  278 NAVTNGNVPHIENPSDLSLDENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLN 389          
BLAST of forkhead box A-1 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 67.3958 bits (163), Expect = 5.059e-12
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 1
Query:  886 HAKPPYSYISLITMAIQN-SPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA 1227
              KP  SY +++T  I+  S     +LSEIY  I + FPYY+     WQ+S+RH+LS N  F KVS    K GKG  W L  +         Y+  ++R K    EI     +AA
Sbjct:  459 RTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVS----KEGKGWLWGLDEE---------YIAERERQKKKQSEIAVAKAQAA 560          
BLAST of forkhead box A-1 vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 213.386 bits (542), Expect = 8.410e-64
Identity = 97/122 (79.51%), Postives = 104/122 (85.25%), Query Frame = 1
Query:  820 SDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            S +P +     +  + Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQFIMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV RSP++PGKGSYWTLHP  GNMFENGCYLRRQKRFK
Sbjct:   16 SQNPHELKKSKDKEKAYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPDCGNMFENGCYLRRQKRFK 137          
BLAST of forkhead box A-1 vs. Ensembl Nematostella
Match: EDO39562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S5])

HSP 1 Score: 179.874 bits (455), Expect = 1.111e-51
Identity = 88/149 (59.06%), Postives = 104/149 (69.80%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDT 1308
            RP + SY  AKPPYSYISL  MAIQ+SP  M +LSEIYQFIMDHFP+YR N QRWQNS+RH+LSFNDCFVK+ R P++PGKGS W LHP  G MFENG +LRR+KRFK    E  R S+ A      + T  + D  S    ++A S T
Sbjct:    3 RPLRNSYGSAKPPYSYISLTAMAIQSSPQKMLSLSEIYQFIMDHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPDCGTMFENGSFLRRRKRFKS---ERERTSKLAKL---ISATREDEDELSPSEQESAPSPT 145          
BLAST of forkhead box A-1 vs. Ensembl Nematostella
Match: EDO39529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S2])

HSP 1 Score: 150.214 bits (378), Expect = 8.634e-43
Identity = 69/101 (68.32%), Postives = 83/101 (82.18%), Query Frame = 1
Query:  886 HAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSP-EKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
              KPP+SYI+LITM+I+ SP  M TL+EIY+FIM  FPY+R+NQQ+WQNSIRH+LS NDCFVKV RS   KPGKG+YWTLHP  G+MF +G +LRR KRFK
Sbjct:   14 EVKPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFVKVPRSIFGKPGKGNYWTLHPSCGDMFGSGSFLRRPKRFK 114          
BLAST of forkhead box A-1 vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 144.05 bits (362), Expect = 6.086e-37
Identity = 72/116 (62.07%), Postives = 86/116 (74.14%), Query Frame = 1
Query:  892 KPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYL--RRQKRFKDPHREIGRQSQRAATG 1233
            KPPYSYI+LI MAIQ++P    TLS IY FIMD FPYYR N+Q WQNSIRH+LS N+CFVKV R  +KPGKGS+W L P S NMFENG YL  R++ R KD  + +  +SQR + G
Sbjct:   79 KPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLDPDSLNMFENGSYLRRRKRFRKKDVQKSMEGESQRKSDG 194          
BLAST of forkhead box A-1 vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 123.25 bits (308), Expect = 2.076e-33
Identity = 57/89 (64.04%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  889 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENG 1155
            +KPPYSYI+LITMAI  SP    TLS+I +FI   FPYYR+    WQNSIRH+LS NDCFVK+ R P  PGKG+YWTL P S  MF+NG
Sbjct:    2 SKPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPASEGMFDNG 90          
BLAST of forkhead box A-1 vs. Ensembl Medaka
Match: ENSORLT00000024271.2 (forkhead box A1 [Source:NCBI gene;Acc:100301627])

HSP 1 Score: 217.238 bits (552), Expect = 2.723e-63
Identity = 98/128 (76.56%), Postives = 108/128 (84.38%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATG 1233
            + +N+ ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK   +  G+   R   G
Sbjct:  135 ARDNKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKKISGKADGRKEQG 262          
BLAST of forkhead box A-1 vs. Ensembl Medaka
Match: foxa2 (Me-HNF3b protein [Source:NCBI gene;Acc:100049256])

HSP 1 Score: 216.468 bits (550), Expect = 6.283e-63
Identity = 104/162 (64.20%), Postives = 120/162 (74.07%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF--------KDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTK 1311
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TL+EIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRF        K+P R+ G      ++    N  E+ H N+S      + SD K
Sbjct:  136 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLAEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKKMSMKEPGRKGGDGGSANSSSDSCNGNESPHSNSSSGEHKRSLSDMK 297          
BLAST of forkhead box A-1 vs. Ensembl Medaka
Match: foxa3 (forkhead box A3 [Source:NCBI gene;Acc:100049257])

HSP 1 Score: 215.312 bits (547), Expect = 3.960e-62
Identity = 107/154 (69.48%), Postives = 122/154 (79.22%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK--DPHREIGRQSQRAATGPGS----NVTENNHDNASQEASDNAESD 1305
            +PY+RS THAKPPYSYISLITMAIQ S   M TL+EIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHPQSGNMFENGCYLRRQKRFK  D   + G ++Q   +G GS    ++ EN+      E  D+A SD
Sbjct:  140 KPYRRSLTHAKPPYSYISLITMAIQQSGSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKIEDKASKKGSKNQEGGSGKGSHSGDHLVENHSPAGGSEGPDSAHSD 293          
BLAST of forkhead box A-1 vs. Ensembl Medaka
Match: ENSORLT00000045293.1 (forkhead box A [Source:NCBI gene;Acc:100301602])

HSP 1 Score: 204.142 bits (518), Expect = 3.428e-59
Identity = 94/126 (74.60%), Postives = 106/126 (84.13%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA 1227
            +  ++PY+RSYTHAKPPYSYISLITMAIQ S   M TL+EIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RS +KPGKGS+W LHP SGNMFENGCYLRRQKRFK  +R  G   + AA
Sbjct:  102 TRESKPYRRSYTHAKPPYSYISLITMAIQQSDNKMLTLNEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFIKVPRSSDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKCKNRSGGGDGEPAA 227          
BLAST of forkhead box A-1 vs. Ensembl Medaka
Match: foxb1 (forkhead box B1 [Source:NCBI gene;Acc:100301603])

HSP 1 Score: 174.481 bits (441), Expect = 1.317e-48
Identity = 73/108 (67.59%), Postives = 89/108 (82.41%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+ P  M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPNCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Planmine SMEST
Match: SMESG000065670.1 (SMESG000065670.1)

HSP 1 Score: 905.975 bits (2340), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 1
Query:  571 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLXXXXXXXXXXXXXXXXXRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLXXXXXXXXXXEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKXXXXXXXXXXXXXAMSDYYKYVQNPQPGNSDMSL 2025
            MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQNQQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL
Sbjct:    1 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQNQQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL 485          
BLAST of forkhead box A-1 vs. Planmine SMEST
Match: SMESG000067799.1 (SMESG000067799.1)

HSP 1 Score: 202.216 bits (513), Expect = 1.382e-59
Identity = 90/115 (78.26%), Postives = 100/115 (86.96%), Query Frame = 1
Query:  889 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHRE----IGRQSQR 1221
            +KPPYSYISLITMAIQNSP  MCTLSEIYQFIMD FPYY+QNQQRWQNSIRHSLSFNDCF+K SR  EKPGKGS+W LHP SGNMFENGC+LRRQKRFKDP +     +G+ S++
Sbjct:   45 SKPPYSYISLITMAIQNSPQKMCTLSEIYQFIMDSFPYYQQNQQRWQNSIRHSLSFNDCFIKASRCTEKPGKGSFWVLHPDSGNMFENGCFLRRQKRFKDPRKHKLILLGKDSEK 159          
BLAST of forkhead box A-1 vs. Planmine SMEST
Match: SMESG000015673.1 (SMESG000015673.1)

HSP 1 Score: 159.073 bits (401), Expect = 5.035e-42
Identity = 67/99 (67.68%), Postives = 81/99 (81.82%), Query Frame = 1
Query:  889 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
             KPPYSYI+LITMA+   P    TLS IYQFIM+ FPYYR+N+Q WQNSIRH+LS N+CF+K+ R  +KPGKGSYW LHPQ+ NMFENG +LRR++RFK
Sbjct:   72 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFK 170          
BLAST of forkhead box A-1 vs. Planmine SMEST
Match: SMESG000004239.1 (SMESG000004239.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.479e-40
Identity = 77/149 (51.68%), Postives = 103/149 (69.13%), Query Frame = 1
Query:  832 RDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQ 1278
             ++N+I   N+   RS    KPPYSYI+LITMAI + P +  TL+ IYQFI + FPYYR+N+Q WQNSIRH+LS N+CF+KVSR  ++ GKGSYWTLHP + NMFENG +LRR++RFK     I  +    AT   S++  +N D+  +
Sbjct:  128 ENQNNIKIENKNDNRSL--VKPPYSYIALITMAITSQPDHRITLNGIYQFISERFPYYRENKQGWQNSIRHNLSLNECFIKVSRGDQRSGKGSYWTLHPNAYNMFENGSFLRRRRRFKYKDDTISAE----ATATNSDIIISNSDDLEK 270          
BLAST of forkhead box A-1 vs. Planmine SMEST
Match: SMESG000077075.1 (SMESG000077075.1)

HSP 1 Score: 139.428 bits (350), Expect = 3.116e-35
Identity = 62/99 (62.63%), Postives = 75/99 (75.76%), Query Frame = 1
Query:  889 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
             KPPYSYI+LITMAI  SP    TLS I +FIM  FPYY+     WQNSIRH+LS NDCF+K+ R P  PGKG+YWTL P+S +MF+NG +LRR+KR+K
Sbjct:  150 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 248          
The following BLAST results are available for this feature:
BLAST of forkhead box A-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXA11.464e-6179.66forkhead box A1 [Source:HGNC Symbol;Acc:HGNC:5021][more]
FOXA22.573e-6075.78forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022][more]
FOXA22.737e-6075.78forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022][more]
FOXA39.884e-5976.86forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023][more]
FOXB15.421e-4968.52forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799][more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pha-41.588e-5362.94Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.667e-5362.94Defective pharyngeal development protein 4 [Sourc... [more]
pha-42.779e-5362.94Defective pharyngeal development protein 4 [Sourc... [more]
lin-314.137e-3861.39pep chromosome:WBcel235:II:3982549:3986944:1 gene:... [more]
unc-1307.480e-3860.58pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh7.385e-6567.30gene:FBgn0000659 transcript:FBtr0300259[more]
fkh7.385e-6567.30gene:FBgn0000659 transcript:FBtr0345227[more]
fkh7.385e-6567.30gene:FBgn0000659 transcript:FBtr0085321[more]
fkh9.634e-6567.30gene:FBgn0000659 transcript:FBtr0346765[more]
fkh1.498e-6367.30gene:FBgn0000659 transcript:FBtr0330333[more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa12.437e-6473.05forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-7... [more]
foxa21.758e-6156.99forkhead box A2 [Source:NCBI gene;Acc:30126][more]
foxa31.347e-6057.29forkhead box A3 [Source:ZFIN;Acc:ZDB-GENE-980526-4... [more]
foxa1.873e-5378.30forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
foxa2.366e-5378.30forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xk9.361e-6373.88X-linked Kx blood group [Source:Xenbase;Acc:XB-GEN... [more]
foxa25.573e-6183.93forkhead box A2 [Source:NCBI gene;Acc:395063][more]
ventx1.21.150e-6077.69VENT homeobox 1, gene 2 [Source:Xenbase;Acc:XB-GEN... [more]
serpinc11.686e-4767.59serpin peptidase inhibitor, clade C (antithrombin)... [more]
FOXB22.618e-4266.34forkhead box B2 [Source:NCBI gene;Acc:101730239][more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxa22.087e-6360.45forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476... [more]
Foxa22.623e-6360.45forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476... [more]
Foxa11.389e-6179.66forkhead box A1 [Source:MGI Symbol;Acc:MGI:1347472... [more]
Foxa36.126e-5984.91forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477... [more]
Foxb14.033e-4968.52forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549... [more]
back to top
BLAST of forkhead box A-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17241|SGF1_BOMMO5.000e-6676.69Silk gland factor 1 OS=Bombyx mori OX=7091 GN=SGF1... [more]
sp|P14734|FKH_DROME7.402e-6467.30Protein fork head OS=Drosophila melanogaster OX=72... [more]
sp|P35583|FOXA2_MOUSE1.460e-6260.45Hepatocyte nuclear factor 3-beta OS=Mus musculus O... [more]
sp|O42097|FOXA2_ORYLA5.632e-6264.20Hepatocyte nuclear factor 3-beta OS=Oryzias latipe... [more]
sp|P32315|FXA1B_XENLA2.881e-6171.74Forkhead box protein A1-B OS=Xenopus laevis OX=835... [more]
back to top
BLAST of forkhead box A-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIE50.000e+0100.00Forkhead box A-1 OS=Schmidtea mediterranea OX=7932... [more]
Q9NDK90.000e+092.39Winged helix/forkhead transcription factor DjFoxA ... [more]
D3J1K28.534e-12999.45FoxA (Fragment) OS=Schmidtea polychroa OX=50054 GN... [more]
A0A1B6CCN21.550e-6660.54Fork-head domain-containing protein OS=Clastoptera... [more]
A0A224XIG35.234e-6671.53Putative forkhead/hnf-3-related transcription fact... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa12.668e-6385.71forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-7... [more]
foxa31.890e-6253.11hepatocyte nuclear factor 3-gamma [Source:NCBI gen... [more]
foxa21.286e-5964.05forkhead box A2 [Source:NCBI gene;Acc:103033433][more]
foxa3.586e-5276.42hepatocyte nuclear factor 3-gamma-like [Source:NCB... [more]
foxb1a8.014e-4967.59forkhead box B1 [Source:NCBI gene;Acc:103044512][more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa22.590e-5865.54forkhead box A2 [Source:NCBI gene;Acc:30126][more]
ENSPMAT00000005206.17.710e-5874.38pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 ge... [more]
foxb21.621e-4766.67forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
FOXC22.198e-4166.34forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
ENSPMAT00000002547.12.405e-3765.22pep scaffold:Pmarinus_7.0:GL485262:1354:7435:1 gen... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM16.847e-2238.89Forkhead transcription factor; drives S-phase acti... [more]
FKH25.924e-1948.10Forkhead family transcription factor; rate-limitin... [more]
FKH12.846e-1737.50Forkhead family transcription factor; rate-limitin... [more]
FHL15.059e-1236.52Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424928.410e-6479.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395621.111e-5159.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395298.634e-4368.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339006.086e-3762.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451052.076e-3364.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000024271.22.723e-6376.56forkhead box A1 [Source:NCBI gene;Acc:100301627][more]
foxa26.283e-6364.20Me-HNF3b protein [Source:NCBI gene;Acc:100049256][more]
foxa33.960e-6269.48forkhead box A3 [Source:NCBI gene;Acc:100049257][more]
ENSORLT00000045293.13.428e-5974.60forkhead box A [Source:NCBI gene;Acc:100301602][more]
foxb11.317e-4867.59forkhead box B1 [Source:NCBI gene;Acc:100301603][more]
back to top
BLAST of forkhead box A-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065670.10.000e+0100.00SMESG000065670.1[more]
SMESG000067799.11.382e-5978.26SMESG000067799.1[more]
SMESG000015673.15.035e-4267.68SMESG000015673.1[more]
SMESG000004239.12.479e-4051.68SMESG000004239.1[more]
SMESG000077075.13.116e-3562.63SMESG000077075.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027428
GenBankAFJ24799.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027428 ID=SMED30027428|Name=forkhead box A-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2149bp
ATCACTTGGTGCTGCTTTTTGCCCCGATAAATCTCTCGGTGCTCCAAAAT
TTGTGTAAGCGAGCAAAAGATGATTGGGCAATTTCTAGCACGTCATTCGG
CAACGATGTTTACAAGTTTCTCTGATTGGATGATAAAGTAGAAACTTTCC
GAAAATGAAACTTCTCCGAACATGCGCATACCGACTGAAAATTAACTCTA
AGCCAGCCAATGGAATTGAAGCAAAATTCAAGAGAATATTAATTGACTTC
GCGAATGAACTCAAATTTTCTATTGGCGTATTGTGTGTGCCTCATTGTGA
GTGGTTGCGATCGCATCTCAAATTATTTACACACAAAAAAATAACGCACA
CAGACATTGAATAGATATATTTGATCAAGTCAATATCACAATGTCAATAT
TAGCTTTTTCTGAAGAAAGAAGACGAACTAGAAGAAAAACAACAACGAAA
TAGATTCGATAAGGCTACTGAGCGATTTTCATAATCTAAATATTATTTTA
TTATTGATACGGACAAAAATTGGTCTTTTACCAAGTACTACTAGATTGTT
GATAAAGAGAGGTTATTTAGATGCTTGGAAAAAATCCTTATGAAACTGCA
ATGAGCAACGTGTATTCTCTACCTCCGGGAGGTTCTATTTACAATATGAA
CCCGATGAGTATATCATCAGCTGGCTACAACTCTCAACAAGTATCAACAC
TATCGTTGAACTTGACCGGAATCGGACCTCATTCATTAAGCCCAATGAGT
GCAAGCATGTCGGGTATAGCTGCAATGGCCGGTGGAATGAGACAAGGTCT
TGAGTTGGGTCTTGGTAGAAGTGATAGTCCAAGAGATAAAAATTCAATTT
CCAATAACAACCGACCATATCAAAGAAGTTACACTCATGCCAAGCCTCCA
TACAGTTATATAAGTTTGATAACAATGGCGATTCAAAATTCTCCAGTAAA
CATGTGCACTCTATCGGAGATCTATCAATTCATTATGGATCATTTTCCAT
ACTATCGTCAAAATCAACAGCGATGGCAGAATTCGATTCGACATTCTTTG
TCCTTCAACGATTGCTTTGTTAAGGTTAGTAGAAGCCCAGAAAAACCAGG
TAAAGGCTCATATTGGACCTTGCATCCTCAATCAGGTAACATGTTTGAAA
ACGGTTGTTATCTCAGAAGACAAAAGCGATTCAAAGATCCACACAGAGAA
ATCGGCAGACAGAGTCAAAGAGCTGCCACTGGTCCTGGATCAAATGTCAC
AGAAAACAATCACGACAACGCATCGCAAGAAGCTAGTGATAACGCAGAAA
GTGATACGAAACCCAACATCAAGCAACTTGATTTATCAAGCGATCTCTTA
ACTAATCAAGGTCATAATATTAAAAATACTAATCCAACTTCTGTTAGTCA
GAGTTGTTCGATGTTTCATCGGAAAAAGGAAAACTGCTCACCAGTAGAAA
TGAAATTGAATAACCAAAACCAACAATCAAACCAGCAAGAACATCCACAA
ATCCATTACAATCCCAATCAGCAATTCTACTCAAATCAGCAAAACATTTT
CCAACAAAGTTCTCTTGATCATTACAGTCTATTAGCATCCGATGATCCTC
TTGGTCAAGGTATGCACTTGCCACCAGGTGCAAATAGTGTTTTCGGACTT
TACGGGGCACATAACTTACCAAACGATGATCAAATTTCAGTGTCATTACC
ATCGATATCCTTATCCGGACATCCGTATGACAATTTATCAACAGCAATGG
CATATCAATATGAAGCATCTCAACACAATTCTTCATTACTAACGACAAGT
AATCCGTTCTCAATAGATCGTTTGATGCATCCAAGACTAGTCGCTGCAGC
GATGGGGGTCAGTCCCCATGATACTCTATACGCAGGAGCTACCGGCCCAT
CAGTTGATCTAGAACACATGAAATACTACTCAAACTACAACAATGTGCCT
CCTTATTCCTCTGCAATGTCTGACTACTACAAATATGTACAAAATCCTCA
GCCGGGCAACAGCGACATGAGTCTTTGAATTGAGTCCATTGAAGTCTACG
GCAGTTTCCTCGAAATTTCACATTCAACCAGATGTTTATCGCCTAATATA
AAGCTGTGTTTTTTTATTTATTTACAATTAAATCTTTGTACAAGAGATC
back to top

protein sequence of SMED30027428-orf-1

>SMED30027428-orf-1 ID=SMED30027428-orf-1|Name=SMED30027428-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=486bp
MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTG
IGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPY
QRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQ
RWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRR
QKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNI
KQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQN
QQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHL
PPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEAS
QHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHM
KYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL*
back to top
Aliases
The feature 'forkhead box A-1' has the following synonyms
Synonym
foxA1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000465pharynx nerve plexus
PLANA:0000478pharynx musculature
PLANA:0002142parenchyma
PLANA:0004528pharynx epithelium
PLANA:0000049digestive system
PLANA:0000058embryonic digestive system
PLANA:0000110pharynx progenitor cell
PLANA:0000016pharynx
PLANA:0000023embryonic pharynx
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR013638Fork-head_N
IPR018122TF_fork_head_CS_1
IPR030456TF_fork_head_CS_2
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0019904protein domain specific binding
GO:0008134transcription factor binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000004Stage 4
PLANA:0000007Stage 7
PLANA:0000008Stage 8
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 108..121
score: 78.17
coord: 152..169
score: 78.22
coord: 129..146
score: 60.98
IPR001766Fork head domainSMARTSM00339forkneu4coord: 106..196
e-value: 2.6E-58
score: 209.7
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 108..193
e-value: 8.7E-38
score: 128.5
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 108..202
score: 38.52
IPR001766Fork head domainCDDcd00059FHcoord: 108..185
e-value: 1.7863E-47
score: 156.56
IPR013638Fork-head N-terminalPFAMPF08430Forkhead_Ncoord: 7..107
e-value: 1.4E-6
score: 29.0
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 106..206
e-value: 2.1E-46
score: 158.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..248
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..101
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..248
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..101
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 20..478
NoneNo IPR availablePANTHERPTHR11829:SF353PROTEIN FORK HEADcoord: 20..478
IPR018122Fork head domain conserved site1PROSITEPS00657FORK_HEAD_1coord: 108..121
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 152..158
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 107..202