forkhead box A-1

Overview
Nameforkhead box A-1 (AFJ24799.1)
Smed IDSMED30027428
Uniprot Best hitSilk gland factor 1 OS=Bombyx mori GN=SGF1 PE=2 SV=1 (E=5.36158e-65)
Length (bp)2149
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of forkhead box A-1 (SMED30027428) t-SNE clustered cells

Violin plots show distribution of expression levels for forkhead box A-1 (SMED30027428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of forkhead box A-1 (SMED30027428) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for forkhead box A-1 (SMED30027428) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA1 (forkhead box A1 [Source:HGNC Symbol;Acc:HGNC:5021])

HSP 1 Score: 215.312 bits (547), Expect = 9.908e-61
Identity = 94/118 (79.66%), Postives = 103/118 (87.29%), Query Frame = 1
Query:  832 RDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            R +     + + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK
Sbjct:  150 RSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFK 267          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA2 (forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022])

HSP 1 Score: 211.46 bits (537), Expect = 1.634e-59
Identity = 97/128 (75.78%), Postives = 106/128 (82.81%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  139 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 256          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA2 (forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022])

HSP 1 Score: 211.46 bits (537), Expect = 1.724e-59
Identity = 97/128 (75.78%), Postives = 106/128 (82.81%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  145 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 262          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXA3 (forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023])

HSP 1 Score: 203.756 bits (517), Expect = 6.206e-58
Identity = 93/121 (76.86%), Postives = 102/121 (84.30%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAAT 1230
            Y+R   HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRFK    ++ +    AAT
Sbjct:  109 YRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKL-EEKVKKGGSGAAT 228          
BLAST of forkhead box A-1 vs. Ensembl Human
Match: FOXB1 (forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799])

HSP 1 Score: 176.407 bits (446), Expect = 1.458e-48
Identity = 74/108 (68.52%), Postives = 90/108 (83.33%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+SP  M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 190.274 bits (482), Expect = 5.848e-53
Identity = 90/143 (62.94%), Postives = 108/143 (75.52%), Query Frame = 1
Query:  796 GLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            G+  G G+  + ++  +++   R +  +Y  +KPPYSYISLITMAIQ S     TLSEIY +IMD FPYY+ NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGS+WTLH   GNMFENGCYLRRQKRFK   RE  R+ + A
Sbjct:  110 GVSGGQGQELTIQEFETVTEKIRRH-GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA 251          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 191.045 bits (484), Expect = 5.919e-53
Identity = 90/143 (62.94%), Postives = 108/143 (75.52%), Query Frame = 1
Query:  796 GLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            G+  G G+  + ++  +++   R +  +Y  +KPPYSYISLITMAIQ S     TLSEIY +IMD FPYY+ NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGS+WTLH   GNMFENGCYLRRQKRFK   RE  R+ + A
Sbjct:  141 GVSGGQGQELTIQEFETVTEKIRRH-GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA 282          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 192.2 bits (487), Expect = 8.805e-53
Identity = 90/143 (62.94%), Postives = 108/143 (75.52%), Query Frame = 1
Query:  796 GLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            G+  G G+  + ++  +++   R +  +Y  +KPPYSYISLITMAIQ S     TLSEIY +IMD FPYY+ NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGS+WTLH   GNMFENGCYLRRQKRFK   RE  R+ + A
Sbjct:  205 GVSGGQGQELTIQEFETVTEKIRRH-GTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA 346          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: lin-31 (pep:known chromosome:WBcel235:II:3982573:3986944:1 gene:WBGene00003017 transcript:K10G6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 142.124 bits (357), Expect = 1.183e-37
Identity = 62/101 (61.39%), Postives = 77/101 (76.24%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYL 1164
            RP + SY   KPPYSYI L  MAIQ+S   M  L+EIY++IMD FP+YR+N QRWQNS+RH+LSFNDCF+K+ R  ++PGKGSYW +HP +  MFENG  L
Sbjct:    3 RPGKDSYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAVHPNASGMFENGSCL 103          
BLAST of forkhead box A-1 vs. Ensembl Celegans
Match: unc-130 (pep:known chromosome:WBcel235:II:11281986:11283954:1 gene:WBGene00006853 transcript:C47G2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 144.436 bits (363), Expect = 1.590e-37
Identity = 63/104 (60.58%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  874 RSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            R  +HAKPPYSYI+LI M+I NSP    TLSEI +FI++ F YY++    WQNSIRH+LS NDCFVKV+R P  PGKG+YW L P   +MF+NG +LRR+KR+K
Sbjct:  121 RKSSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYK 224          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (fork head [Source:FlyBase gene name;Acc:FBgn0000659])

HSP 1 Score: 224.172 bits (570), Expect = 6.155e-64
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (fork head [Source:FlyBase gene name;Acc:FBgn0000659])

HSP 1 Score: 224.172 bits (570), Expect = 6.155e-64
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (fork head [Source:FlyBase gene name;Acc:FBgn0000659])

HSP 1 Score: 224.172 bits (570), Expect = 6.155e-64
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (fork head [Source:FlyBase gene name;Acc:FBgn0000659])

HSP 1 Score: 224.172 bits (570), Expect = 7.902e-64
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Fly
Match: fkh (fork head [Source:FlyBase gene name;Acc:FBgn0000659])

HSP 1 Score: 224.172 bits (570), Expect = 7.902e-64
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa1 (forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-78])

HSP 1 Score: 221.09 bits (562), Expect = 1.853e-63
Identity = 103/141 (73.05%), Postives = 116/141 (82.27%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK------DPHREIGRQSQRAATG-PGSNVT 1251
            + +N+ ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK      D  R  G++ Q + +G P S+ T
Sbjct:  143 ARDNKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCDKKLPDGKRSEGKREQSSGSGSPASDST 283          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa1 (forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-78])

HSP 1 Score: 215.698 bits (548), Expect = 1.366e-61
Identity = 100/132 (75.76%), Postives = 111/132 (84.09%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK------DPHREIGRQSQRAA 1227
            + +N+ ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK      D  R  G++ Q +A
Sbjct:  143 ARDNKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCDKKLPDGKRSEGKREQSSA 274          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa2 (forkhead box A2 [Source:ZFIN;Acc:ZDB-GENE-980526-404])

HSP 1 Score: 212.616 bits (540), Expect = 1.152e-60
Identity = 110/193 (56.99%), Postives = 131/193 (67.88%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF-------KDPHREIGRQSQRAAT-------GPGSNVTENNHDNASQE-------ASDNAESDTKPNIKQLDLSSDLLTNQGH 1365
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRF       KDP R+       +++        P SN + N H  +  +       + D+A S T      L   + +L ++GH
Sbjct:  137 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCDKKLSKDPSRKTSEGGSNSSSESCNGNESPHSNSSSNEHKRSLSDMKSGQGLSPDHAASPTSQAQHLLAQHNSVLAHEGH 329          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa3 (forkhead box A3 [Source:ZFIN;Acc:ZDB-GENE-980526-423])

HSP 1 Score: 211.075 bits (536), Expect = 8.079e-60
Identity = 110/192 (57.29%), Postives = 126/192 (65.62%), Query Frame = 1
Query:  826 SPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF--------------------KDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSS 1341
            SP   N      +PY+RS THAKPPYSYISLITMAIQ S   M TL+EIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRF                    K  H   G Q + + T  GS+  E+ H ++S   S + E     ++ QLD  S
Sbjct:  121 SPTSLNRTKEMPKPYRRSLTHAKPPYSYISLITMAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNMFENGCYLRRQKRFKIEEKAGKKSSSKSQDGSSTKGTHSSEGMQEEHSPTT-GSDGAESAHSDSSHAGSTSEEQQR--SLVQLDCPS 309          
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 187.578 bits (475), Expect = 1.555e-52
Identity = 83/106 (78.30%), Postives = 91/106 (85.85%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            Y+R+ +HAKPPYSYISLI MAIQ SP    TL+EIY +I   FPYYRQNQQRWQNSIRHSLSFNDCFV+V RSP+ PGKGSYW LHP SGNMFENGCY+RRQKRFK
Sbjct:   73 YRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNMFENGCYMRRQKRFK 178          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: foxa1 (forkhead box A1 [Source:Xenbase;Acc:XB-GENE-487352])

HSP 1 Score: 216.853 bits (551), Expect = 2.891e-62
Identity = 99/134 (73.88%), Postives = 113/134 (84.33%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQ---RAATGPGS 1242
            + + + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK   ++ G+ SQ   +  +GP S
Sbjct:  145 TRDTKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQQGGKGSQDGRKDVSGPSS 278          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: foxa2 (forkhead box A2 [Source:Xenbase;Acc:XB-GENE-480476])

HSP 1 Score: 212.616 bits (540), Expect = 9.698e-61
Identity = 94/112 (83.93%), Postives = 102/112 (91.07%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  135 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 246          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: foxa2 (forkhead box A2 [Source:Xenbase;Acc:XB-GENE-480476])

HSP 1 Score: 212.616 bits (540), Expect = 1.316e-60
Identity = 94/112 (83.93%), Postives = 102/112 (91.07%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK
Sbjct:  135 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 246          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: foxa4 (forkhead box A4 [Source:Xenbase;Acc:XB-GENE-486455])

HSP 1 Score: 210.69 bits (535), Expect = 2.710e-60
Identity = 94/121 (77.69%), Postives = 106/121 (87.60%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            R Y+R+Y+HAKPPYSYISLITMAIQ +P  M TL+EIYQ+I+D FPYYRQNQQRWQNSIRHSLSFNDCFVKV RSPEKPGKGSYWTLHP+SGNMFENGCYLRRQKRFK    + G + ++ 
Sbjct:  110 RTYRRNYSHAKPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNMFENGCYLRRQKRFKCERSKSGEREKKV 230          
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Match: foxb1 (forkhead box B1 [Source:Xenbase;Acc:XB-GENE-1018255])

HSP 1 Score: 172.17 bits (435), Expect = 1.397e-47
Identity = 73/108 (67.59%), Postives = 89/108 (82.41%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+S   M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa2 (forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476])

HSP 1 Score: 219.55 bits (558), Expect = 1.521e-62
Identity = 107/177 (60.45%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA------TGPGSNVTENNHDNASQEASDNAESDTKP 1314
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   +   +++  AA      T PGS  ++     A+  AS+       P
Sbjct:  139 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESP 305          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa2 (forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476])

HSP 1 Score: 219.164 bits (557), Expect = 1.889e-62
Identity = 107/177 (60.45%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA------TGPGSNVTENNHDNASQEASDNAESDTKP 1314
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   +   +++  AA      T PGS  ++     A+  AS+       P
Sbjct:  145 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESP 311          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa1 (forkhead box A1 [Source:MGI Symbol;Acc:MGI:1347472])

HSP 1 Score: 214.927 bits (546), Expect = 8.994e-61
Identity = 94/118 (79.66%), Postives = 103/118 (87.29%), Query Frame = 1
Query:  832 RDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            R +     + + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK
Sbjct:  150 RSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFK 267          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxa3 (forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477])

HSP 1 Score: 204.142 bits (518), Expect = 3.700e-58
Identity = 90/106 (84.91%), Postives = 96/106 (90.57%), Query Frame = 1
Query:  868 YQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            Y+R   HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYR+NQQRWQNSIRHSLSFNDCFVKV+RSP+KPGKGSYW LHP SGNMFENGCYLRRQKRFK
Sbjct:  111 YRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFK 216          
BLAST of forkhead box A-1 vs. Ensembl Mouse
Match: Foxb1 (forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549])

HSP 1 Score: 176.407 bits (446), Expect = 1.039e-48
Identity = 74/108 (68.52%), Postives = 90/108 (83.33%), Query Frame = 1
Query:  862 RPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFK 1185
            RP + +Y+  KPPYSYISL  MAIQ+SP  M  LSEIY+FIMD FPYYR+N QRWQNS+RH+LSFNDCF+K+ R P++PGKGS+W LHP  G+MFENG +LRR+KRFK
Sbjct:    3 RPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK 110          
BLAST of forkhead box A-1 vs. UniProt
Match: sp|Q17241|SGF1_BOMMO (Silk gland factor 1 OS=Bombyx mori GN=SGF1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 5.362e-65
Identity = 102/133 (76.69%), Postives = 115/133 (86.47%), Query Frame = 1
Query:  826 SPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA 1224
            SP      + N++ Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVKV R+P+KPGKGS+WTLHP SGNMFENGC+LRRQKRFKD  +E  RQ+Q+A
Sbjct:   91 SPTSALQRARNDKTYRRSYTHAKPPYSYISLITMAIQNNPSRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHPDSGNMFENGCFLRRQKRFKDEKKETLRQAQKA 223          
BLAST of forkhead box A-1 vs. UniProt
Match: sp|P14734|FKH_DROME (Protein fork head OS=Drosophila melanogaster GN=fkh PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 6.084e-63
Identity = 107/159 (67.30%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRA-------ATGPGSNVTENN 1260
            LG  R D P            Y+RSYTHAKPPYSYISLITMAIQN+P  M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVK+ R+P+KPGKGS+WTLHP SGNMFENGCYLRRQKRFKD  +E  RQ  ++       AT PG    E++
Sbjct:  191 LGRSRVDKPTT----------YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDS 339          
BLAST of forkhead box A-1 vs. UniProt
Match: sp|P35583|FOXA2_MOUSE (Hepatocyte nuclear factor 3-beta OS=Mus musculus GN=Foxa2 PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.185e-61
Identity = 107/177 (60.45%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA------TGPGSNVTENNHDNASQEASDNAESDTKP 1314
            + GL R+  P+           Y+RSYTHAKPPYSYISLITMAIQ SP  M TLSEIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRFK   +   +++  AA      T PGS  ++     A+  AS+       P
Sbjct:  139 QAGLSRARDPKT----------YRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESP 305          
BLAST of forkhead box A-1 vs. UniProt
Match: sp|O42097|FOXA2_ORYLA (Hepatocyte nuclear factor 3-beta OS=Oryzias latipes GN=foxa2 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 4.622e-61
Identity = 104/162 (64.20%), Postives = 120/162 (74.07%), Query Frame = 1
Query:  850 SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRF--------KDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTK 1311
            S + + Y+RSYTHAKPPYSYISLITMAIQ SP  M TL+EIYQ+IMD FP+YRQNQQRWQNSIRHSLSFNDCF+KV RSP+KPGKGS+WTLHP SGNMFENGCYLRRQKRF        K+P R+ G      ++    N  E+ H N+S      + SD K
Sbjct:  136 SRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLAEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKKMSMKEPGRKGGDGGSANSSSDSCNGNESPHSNSSSGEHKRSLSDMK 297          
BLAST of forkhead box A-1 vs. UniProt
Match: sp|P32315|FXA1B_XENLA (Forkhead box protein A1-B OS=Xenopus laevis GN=foxa1-b PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.241e-60
Identity = 99/138 (71.74%), Postives = 114/138 (82.61%), Query Frame = 1
Query:  805 LGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQ 1218
            +G G ++  R ++S     + ++RSY HAKPPYSYISLITMAIQ +P  M TLSEIYQ+IMD FPYYRQNQQRWQNSIRHSLSFNDCF+KVSRSP+KPGKGSYWTLHP SGNMFENGCYLRRQKRFK    + G+ +Q
Sbjct:  133 MGYGATNINRTRDS-----KTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFIKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKTQGGKGNQ 265          
BLAST of forkhead box A-1 vs. TrEMBL
Match: tr|I1ZIE5|I1ZIE5_SCHMD (Forkhead box A-1 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 1
Query:  571 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLXXXXXXXXXXXXXXXXXRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLXXXXXXXXXXEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKXXXXXXXXXXXXXAMSDYYKYVQNPQPGNSDMSL 2025
            MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQNQQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL
Sbjct:    1 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQNQQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHMKYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL 485          
BLAST of forkhead box A-1 vs. TrEMBL
Match: tr|Q9NDK9|Q9NDK9_DUGJA (Winged helix/forkhead transcription factor DjFoxA OS=Dugesia japonica GN=DjFoxA PE=2 SV=1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 449/486 (92.39%), Postives = 467/486 (96.09%), Query Frame = 1
Query:  571 MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTGIGPHSLXXXXXXXXXXXXXXXXXRQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLXXXXXXXXXXEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHLPPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPRLV-AAAMGVSPHDTLYAGATGPSVDLEHMKXXXXXXXXXXXXXAMSDYYKYVQNPQPGNSDMSL 2025
            M+GKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQV TLSLNL+GIGPHSLSPMSASMSGIAAMAGGMRQGL+LGL RSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA GPGSN TENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKN+ PTS SQ+C MFHRKKENCSPVEMK+NNQ QQ  QQ+H Q+HYNPNQQFYSNQQNIFQQS+L+HY+L ASDDPLGQGMHLP GA+SVFGLYG HNL N+DQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHP LV AAAMG+SPHD+LYA ATG SVDLEHMKYYSNY+NVPPYS+AM+DYYKYVQNPQPGNSDMSL
Sbjct:    1 MIGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVPTLSLNLSGIGPHSLSPMSASMSGIAAMAGGMRQGLDLGLSRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAAAGPGSNATENNHDNASQEASDNAESDTKPNIKQLDLSSDLLTNQGHNIKNSIPTSASQTCPMFHRKKENCSPVEMKMNNQPQQPTQQQHQQLHYNPNQQFYSNQQNIFQQSTLEHYALSASDDPLGQGMHLPQGASSVFGLYG-HNLQNEDQISVSLPSISLSGHPYDNLSTAMAYQYEASQHNSSLLTTSNPFSIDRLMHPSLVAAAAMGLSPHDSLYAAATGSSVDLEHMKYYSNYSNVPPYSTAMADYYKYVQNPQPGNSDMSL 485          
BLAST of forkhead box A-1 vs. TrEMBL
Match: tr|D3J1K2|D3J1K2_SCHPL (FoxA (Fragment) OS=Schmidtea polychroa GN=foxA PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.636e-127
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 1
Query:  790 RQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLS 1338
            RQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSN+TENNHDNASQEASDNAESDTKPNIKQLDLS
Sbjct:   15 RQGLELGLGRSDSPRDKNSISNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNITENNHDNASQEASDNAESDTKPNIKQLDLS 197          
BLAST of forkhead box A-1 vs. TrEMBL
Match: tr|A0A1B6CCN2|A0A1B6CCN2_9HEMI (Uncharacterized protein OS=Clastoptera arizonana GN=g.30564 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 7.544e-66
Identity = 112/185 (60.54%), Postives = 141/185 (76.22%), Query Frame = 1
Query:  802 ELGLGRSDSPRDKNSI--SNNNRPYQRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNIKQLDLSSDLL 1350
            +LG   + SP    ++  +  ++ Y+RSYTHAKPPYSYISLITMAIQNSP+ M TLSEIYQFIMD FP+YRQNQQRWQNSIRHSLSFNDCFVKV R+P+KPGKGS+WTLHP+SGNMFENGCYLRRQKRFKD  +E  R + ++ + PG ++  ++HD   ++  D  +   K ++  L L S +L
Sbjct:  117 DLGSADAGSPNSAAALQRARTDKSYRRSYTHAKPPYSYISLITMAIQNSPIKMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHPESGNMFENGCYLRRQKRFKDEKKEASRSTHKSVS-PGQHLHIHHHD--IEKKGDKLD---KVSVSDLGLQSSML 295          
BLAST of forkhead box A-1 vs. TrEMBL
Match: tr|A0A183AU80|A0A183AU80_9TREM (Uncharacterized protein OS=Echinostoma caproni PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.373e-64
Identity = 101/114 (88.60%), Postives = 107/114 (93.86%), Query Frame = 1
Query:  886 HAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRRQKRFKDPHREIGRQSQRAA 1227
            HAKPPYSYISLITMAIQNSPV MCTLSEIYQFI+D FPYYRQ+QQRWQNSIRHSLSFNDCFVKVSRSP+KPGKGSYWTLHP+SGNMFENGCYLRRQKRFKDP RE  R++QR  
Sbjct:   45 HAKPPYSYISLITMAIQNSPVRMCTLSEIYQFIIDLFPYYRQHQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPESGNMFENGCYLRRQKRFKDPKREAVRRTQRGT 158          
The following BLAST results are available for this feature:
BLAST of forkhead box A-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
FOXA19.908e-6179.66forkhead box A1 [Source:HGNC Symbol;Acc:HGNC:5021][more]
FOXA21.634e-5975.78forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022][more]
FOXA21.724e-5975.78forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022][more]
FOXA36.206e-5876.86forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023][more]
FOXB11.458e-4868.52forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799][more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
pha-45.848e-5362.94Defective pharyngeal development protein 4 [Sourc... [more]
pha-45.919e-5362.94Defective pharyngeal development protein 4 [Sourc... [more]
pha-48.805e-5362.94Defective pharyngeal development protein 4 [Sourc... [more]
lin-311.183e-3761.39pep:known chromosome:WBcel235:II:3982573:3986944:1... [more]
unc-1301.590e-3760.58pep:known chromosome:WBcel235:II:11281986:11283954... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
fkh6.155e-6467.30fork head [Source:FlyBase gene name;Acc:FBgn000065... [more]
fkh6.155e-6467.30fork head [Source:FlyBase gene name;Acc:FBgn000065... [more]
fkh6.155e-6467.30fork head [Source:FlyBase gene name;Acc:FBgn000065... [more]
fkh7.902e-6467.30fork head [Source:FlyBase gene name;Acc:FBgn000065... [more]
fkh7.902e-6467.30fork head [Source:FlyBase gene name;Acc:FBgn000065... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
foxa11.853e-6373.05forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-7... [more]
foxa11.366e-6175.76forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-7... [more]
foxa21.152e-6056.99forkhead box A2 [Source:ZFIN;Acc:ZDB-GENE-980526-4... [more]
foxa38.079e-6057.29forkhead box A3 [Source:ZFIN;Acc:ZDB-GENE-980526-4... [more]
foxa1.555e-5278.30forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
foxa12.891e-6273.88forkhead box A1 [Source:Xenbase;Acc:XB-GENE-487352... [more]
foxa29.698e-6183.93forkhead box A2 [Source:Xenbase;Acc:XB-GENE-480476... [more]
foxa21.316e-6083.93forkhead box A2 [Source:Xenbase;Acc:XB-GENE-480476... [more]
foxa42.710e-6077.69forkhead box A4 [Source:Xenbase;Acc:XB-GENE-486455... [more]
foxb11.397e-4767.59forkhead box B1 [Source:Xenbase;Acc:XB-GENE-101825... [more]
back to top
BLAST of forkhead box A-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Foxa21.521e-6260.45forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476... [more]
Foxa21.889e-6260.45forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476... [more]
Foxa18.994e-6179.66forkhead box A1 [Source:MGI Symbol;Acc:MGI:1347472... [more]
Foxa33.700e-5884.91forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477... [more]
Foxb11.039e-4868.52forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549... [more]
back to top
BLAST of forkhead box A-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17241|SGF1_BOMMO5.362e-6576.69Silk gland factor 1 OS=Bombyx mori GN=SGF1 PE=2 SV... [more]
sp|P14734|FKH_DROME6.084e-6367.30Protein fork head OS=Drosophila melanogaster GN=fk... [more]
sp|P35583|FOXA2_MOUSE1.185e-6160.45Hepatocyte nuclear factor 3-beta OS=Mus musculus G... [more]
sp|O42097|FOXA2_ORYLA4.622e-6164.20Hepatocyte nuclear factor 3-beta OS=Oryzias latipe... [more]
sp|P32315|FXA1B_XENLA2.241e-6071.74Forkhead box protein A1-B OS=Xenopus laevis GN=fox... [more]
back to top
BLAST of forkhead box A-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|I1ZIE5|I1ZIE5_SCHMD0.000e+0100.00Forkhead box A-1 OS=Schmidtea mediterranea PE=2 SV... [more]
tr|Q9NDK9|Q9NDK9_DUGJA0.000e+092.39Winged helix/forkhead transcription factor DjFoxA ... [more]
tr|D3J1K2|D3J1K2_SCHPL1.636e-12799.45FoxA (Fragment) OS=Schmidtea polychroa GN=foxA PE=... [more]
tr|A0A1B6CCN2|A0A1B6CCN2_9HEMI7.544e-6660.54Uncharacterized protein OS=Clastoptera arizonana G... [more]
tr|A0A183AU80|A0A183AU80_9TREM1.373e-6488.60Uncharacterized protein OS=Echinostoma caproni PE=... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 20..37
NoneNo IPR availableTMHMMTMhelixcoord: 10..27
NoneNo IPR availableTMHMMTMhelixcoord: 6..28
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 152..169
score: 78.22
coord: 108..121
score: 78.17
coord: 129..146
score: 60.98
IPR001766Fork head domainSMARTSM00339forkneu4coord: 106..196
e-value: 2.6E-58
score: 209.7
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 108..193
e-value: 6.9E-37
score: 125.5
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 108..202
score: 38.52
IPR011991Winged helix-turn-helix DNA-binding domainGENE3DG3DSA:1.10.10.10coord: 100..195
e-value: 9.8E-41
score: 137.3
IPR011991Winged helix-turn-helix DNA-binding domainSUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 107..202
IPR013638Fork-head N-terminalPFAMPF08430Forkhead_Ncoord: 7..107
e-value: 1.3E-6
score: 29.0
IPR018122Fork head domain conserved site1PROSITEPS00657FORK_HEAD_1coord: 108..121
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 152..158

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR013638Fork-head_N
IPR018122TF_fork_head_CS_1
IPR030456TF_fork_head_CS_2
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0019904protein domain specific binding
GO:0008134transcription factor binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000003Stage 3
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000049digestive system
PLANA:0000110definitive pharynx progenitor
PLANA:0000016definitive pharynx
PLANA:0000023temporary embryonic pharynx
PLANA:0000058embryonic digestive system
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027428 ID=SMED30027428|Name=forkhead box A-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2149bp
ATCACTTGGTGCTGCTTTTTGCCCCGATAAATCTCTCGGTGCTCCAAAAT
TTGTGTAAGCGAGCAAAAGATGATTGGGCAATTTCTAGCACGTCATTCGG
CAACGATGTTTACAAGTTTCTCTGATTGGATGATAAAGTAGAAACTTTCC
GAAAATGAAACTTCTCCGAACATGCGCATACCGACTGAAAATTAACTCTA
AGCCAGCCAATGGAATTGAAGCAAAATTCAAGAGAATATTAATTGACTTC
GCGAATGAACTCAAATTTTCTATTGGCGTATTGTGTGTGCCTCATTGTGA
GTGGTTGCGATCGCATCTCAAATTATTTACACACAAAAAAATAACGCACA
CAGACATTGAATAGATATATTTGATCAAGTCAATATCACAATGTCAATAT
TAGCTTTTTCTGAAGAAAGAAGACGAACTAGAAGAAAAACAACAACGAAA
TAGATTCGATAAGGCTACTGAGCGATTTTCATAATCTAAATATTATTTTA
TTATTGATACGGACAAAAATTGGTCTTTTACCAAGTACTACTAGATTGTT
GATAAAGAGAGGTTATTTAGATGCTTGGAAAAAATCCTTATGAAACTGCA
ATGAGCAACGTGTATTCTCTACCTCCGGGAGGTTCTATTTACAATATGAA
CCCGATGAGTATATCATCAGCTGGCTACAACTCTCAACAAGTATCAACAC
TATCGTTGAACTTGACCGGAATCGGACCTCATTCATTAAGCCCAATGAGT
GCAAGCATGTCGGGTATAGCTGCAATGGCCGGTGGAATGAGACAAGGTCT
TGAGTTGGGTCTTGGTAGAAGTGATAGTCCAAGAGATAAAAATTCAATTT
CCAATAACAACCGACCATATCAAAGAAGTTACACTCATGCCAAGCCTCCA
TACAGTTATATAAGTTTGATAACAATGGCGATTCAAAATTCTCCAGTAAA
CATGTGCACTCTATCGGAGATCTATCAATTCATTATGGATCATTTTCCAT
ACTATCGTCAAAATCAACAGCGATGGCAGAATTCGATTCGACATTCTTTG
TCCTTCAACGATTGCTTTGTTAAGGTTAGTAGAAGCCCAGAAAAACCAGG
TAAAGGCTCATATTGGACCTTGCATCCTCAATCAGGTAACATGTTTGAAA
ACGGTTGTTATCTCAGAAGACAAAAGCGATTCAAAGATCCACACAGAGAA
ATCGGCAGACAGAGTCAAAGAGCTGCCACTGGTCCTGGATCAAATGTCAC
AGAAAACAATCACGACAACGCATCGCAAGAAGCTAGTGATAACGCAGAAA
GTGATACGAAACCCAACATCAAGCAACTTGATTTATCAAGCGATCTCTTA
ACTAATCAAGGTCATAATATTAAAAATACTAATCCAACTTCTGTTAGTCA
GAGTTGTTCGATGTTTCATCGGAAAAAGGAAAACTGCTCACCAGTAGAAA
TGAAATTGAATAACCAAAACCAACAATCAAACCAGCAAGAACATCCACAA
ATCCATTACAATCCCAATCAGCAATTCTACTCAAATCAGCAAAACATTTT
CCAACAAAGTTCTCTTGATCATTACAGTCTATTAGCATCCGATGATCCTC
TTGGTCAAGGTATGCACTTGCCACCAGGTGCAAATAGTGTTTTCGGACTT
TACGGGGCACATAACTTACCAAACGATGATCAAATTTCAGTGTCATTACC
ATCGATATCCTTATCCGGACATCCGTATGACAATTTATCAACAGCAATGG
CATATCAATATGAAGCATCTCAACACAATTCTTCATTACTAACGACAAGT
AATCCGTTCTCAATAGATCGTTTGATGCATCCAAGACTAGTCGCTGCAGC
GATGGGGGTCAGTCCCCATGATACTCTATACGCAGGAGCTACCGGCCCAT
CAGTTGATCTAGAACACATGAAATACTACTCAAACTACAACAATGTGCCT
CCTTATTCCTCTGCAATGTCTGACTACTACAAATATGTACAAAATCCTCA
GCCGGGCAACAGCGACATGAGTCTTTGAATTGAGTCCATTGAAGTCTACG
GCAGTTTCCTCGAAATTTCACATTCAACCAGATGTTTATCGCCTAATATA
AAGCTGTGTTTTTTTATTTATTTACAATTAAATCTTTGTACAAGAGATC
back to top

protein sequence of SMED30027428-orf-1

>SMED30027428-orf-1 ID=SMED30027428-orf-1|Name=SMED30027428-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=486bp
MLGKNPYETAMSNVYSLPPGGSIYNMNPMSISSAGYNSQQVSTLSLNLTG
IGPHSLSPMSASMSGIAAMAGGMRQGLELGLGRSDSPRDKNSISNNNRPY
QRSYTHAKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQ
RWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNMFENGCYLRR
QKRFKDPHREIGRQSQRAATGPGSNVTENNHDNASQEASDNAESDTKPNI
KQLDLSSDLLTNQGHNIKNTNPTSVSQSCSMFHRKKENCSPVEMKLNNQN
QQSNQQEHPQIHYNPNQQFYSNQQNIFQQSSLDHYSLLASDDPLGQGMHL
PPGANSVFGLYGAHNLPNDDQISVSLPSISLSGHPYDNLSTAMAYQYEAS
QHNSSLLTTSNPFSIDRLMHPRLVAAAMGVSPHDTLYAGATGPSVDLEHM
KYYSNYNNVPPYSSAMSDYYKYVQNPQPGNSDMSL*
back to top
Aliases
The feature 'forkhead box A-1' has the following synonyms
Synonym
foxA1
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027428
GenBankAFJ24799.1