msh6

Overview
Namemsh6 (AEB20401.1)
Smed IDSMED30027419
Length (bp)3719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of msh6 (SMED30027419) t-SNE clustered cells

Violin plots show distribution of expression levels for msh6 (SMED30027419) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of msh6 (SMED30027419) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for msh6 (SMED30027419) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027419

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027419SMESG000073017.1 SmedASXL_013065SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027419SMESG000073017.1 SmedASXL_013065SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30027419SMESG000073017.1 dd_Smed_v4_15463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027419SMESG000073017.1 dd_Smed_v4_15463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027419SMESG000073017.1 dd_Smed_v4_15463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30027419SMESG000073017.1 dd_Smed_v4_15463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027419SMESG000073017.1 dd_Smed_v6_15463_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30027419SMESG000073017.1 dd_Smed_v4_15463_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027419SMESG000073017.1 SmWIOct06_014682GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027419SMESG000073017.1 SMED_15163_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30027419SMESG000073017.1 SMED_15163_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of msh6 vs. Ensembl Human
Match: MSH6 (mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 333/793 (41.99%), Postives = 484/793 (61.03%), Query Frame = 3
Query: 1200 FGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFD---NIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDK-PFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
             GK+  G+  D   C       F+ +     P ++++ KGNLSK T+ +  S L+ + +E      QF  +  TL  L+  +YF E  ++ +    LP  L    +E+D++G +  ++ ELA+S LG  ++YL KCLID+ L+S+A+F  Y P D D +   +        F      M++D+ TL NL++  N + G  +GTLLER+D   T FG+RLL QW+  PLC+   I +R  AI++L+ +   +S +   LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F     II I  E     V    +SK+L++++     +  G FPD++  ++ + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYLEKQ+  I    I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD+ LK+ M ++F  FD++Y  W   +  IA  D LL L ++SRG D GPM RP I  + P D  PFL +   R PC  KT  G +FI N I +G        N     +L+TGPNMGGKSTLMRQ  L+ +++Q+GCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE+
Sbjct:  435 LGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGA----IFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEE-----VADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGD-GPMCRPVI--LLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIG-CEEEEQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEK 1195          

HSP 2 Score: 252.292 bits (643), Expect = 7.220e-68
Identity = 138/303 (45.54%), Postives = 190/303 (62.71%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            RK+    TP     TK   SI+  TK  L +FS   N S  + ++S   +D  +  +  + H + E+LK+E  RD  RR+PDHPD+D +TL++PE F++  TPG+++WW+IK+  N + +I +KVGKFYELYHMDA+  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+          EG       E+    L S KE   EE+  G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +
Sbjct:  182 RKSSRKETP---SATKQATSISSETKNTLRAFSAPQN-SESQAHVSGGGDDSSRPTV--WYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQ-NFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV---------LEGDPS----ENYSKYLLSLKEK--EEDSSG---HTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHY 459          
BLAST of msh6 vs. Ensembl Human
Match: MSH6 (mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 331/792 (41.79%), Postives = 484/792 (61.11%), Query Frame = 3
Query: 1194 SRFGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDK-PFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            +  GK+  G+  D   C       F+ +     P ++++ KGNLSK T+ +  S L+ + +E      QF  +  TL  L+  +YF E  ++ +    LP  L    +E+D++G +  ++ ELA+S LG  ++YL KCLID+ L+S+A+F  Y P D D +   +        F      M++D+ TL NL++  N + G  +GTLLER+D   T FG+RLL QW+  PLC+   I +R  AI++L+ +   +S +   LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F  + KI        V    +SK+L++++     +  G FPD++  ++ + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYLEKQ+  I    I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD+ LK+ M ++F  FD++Y  W   +  IA  D LL L ++SRG D GPM RP I  + P D  PFL +   R PC  KT  G +FI N I +G        N     +L+TGPNMGGKSTLMRQ  L+ +++Q+GCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE+
Sbjct:  261 TSLGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGA----IFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKII--GIMEEVADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGD-GPMCRPVI--LLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGC-EEEEQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEK 1023          

HSP 2 Score: 251.906 bits (642), Expect = 3.659e-68
Identity = 138/303 (45.54%), Postives = 190/303 (62.71%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            RK+    TP     TK   SI+  TK  L +FS   N S  + ++S   +D  +  +  + H + E+LK+E  RD  RR+PDHPD+D +TL++PE F++  TPG+++WW+IK+  N + +I +KVGKFYELYHMDA+  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+          EG       E+    L S KE   EE+  G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +
Sbjct:   10 RKSSRKETP---SATKQATSISSETKNTLRAFSAPQN-SESQAHVSGGGDDSSRPTV--WYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQ-NFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV---------LEGDPS----ENYSKYLLSLKEK--EEDSSG---HTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHY 287          
BLAST of msh6 vs. Ensembl Human
Match: MSH6 (mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 331/792 (41.79%), Postives = 484/792 (61.11%), Query Frame = 3
Query: 1194 SRFGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDK-PFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            +  GK+  G+  D   C       F+ +     P ++++ KGNLSK T+ +  S L+ + +E      QF  +  TL  L+  +YF E  ++ +    LP  L    +E+D++G +  ++ ELA+S LG  ++YL KCLID+ L+S+A+F  Y P D D +   +        F      M++D+ TL NL++  N + G  +GTLLER+D   T FG+RLL QW+  PLC+   I +R  AI++L+ +   +S +   LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F  + KI        V    +SK+L++++     +  G FPD++  ++ + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYLEKQ+  I    I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD+ LK+ M ++F  FD++Y  W   +  IA  D LL L ++SRG D GPM RP I  + P D  PFL +   R PC  KT  G +FI N I +G        N     +L+TGPNMGGKSTLMRQ  L+ +++Q+GCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE+
Sbjct:  261 TSLGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGA----IFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKII--GIMEEVADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGD-GPMCRPVI--LLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGC-EEEEQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEK 1023          

HSP 2 Score: 251.906 bits (642), Expect = 3.659e-68
Identity = 138/303 (45.54%), Postives = 190/303 (62.71%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            RK+    TP     TK   SI+  TK  L +FS   N S  + ++S   +D  +  +  + H + E+LK+E  RD  RR+PDHPD+D +TL++PE F++  TPG+++WW+IK+  N + +I +KVGKFYELYHMDA+  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+          EG       E+    L S KE   EE+  G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +
Sbjct:   10 RKSSRKETP---SATKQATSISSETKNTLRAFSAPQN-SESQAHVSGGGDDSSRPTV--WYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQ-NFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV---------LEGDPS----ENYSKYLLSLKEK--EEDSSG---HTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHY 287          
BLAST of msh6 vs. Ensembl Human
Match: MSH6 (mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 333/793 (41.99%), Postives = 484/793 (61.03%), Query Frame = 3
Query: 1200 FGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFD---NIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDK-PFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
             GK+  G+  D   C       F+ +     P ++++ KGNLSK T+ +  S L+ + +E      QF  +  TL  L+  +YF E  ++ +    LP  L    +E+D++G +  ++ ELA+S LG  ++YL KCLID+ L+S+A+F  Y P D D +   +        F      M++D+ TL NL++  N + G  +GTLLER+D   T FG+RLL QW+  PLC+   I +R  AI++L+ +   +S +   LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F     II I  E     V    +SK+L++++     +  G FPD++  ++ + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYLEKQ+  I    I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD+ LK+ M ++F  FD++Y  W   +  IA  D LL L ++SRG D GPM RP I  + P D  PFL +   R PC  KT  G +FI N I +G        N     +L+TGPNMGGKSTLMRQ  L+ +++Q+GCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE+
Sbjct:  466 LGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGA----IFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEE-----VADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGD-GPMCRPVI--LLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIG-CEEEEQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEK 1226          

HSP 2 Score: 251.906 bits (642), Expect = 9.846e-68
Identity = 138/303 (45.54%), Postives = 190/303 (62.71%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            RK+    TP     TK   SI+  TK  L +FS   N S  + ++S   +D  +  +  + H + E+LK+E  RD  RR+PDHPD+D +TL++PE F++  TPG+++WW+IK+  N + +I +KVGKFYELYHMDA+  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+          EG       E+    L S KE   EE+  G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +
Sbjct:  213 RKSSRKETP---SATKQATSISSETKNTLRAFSAPQN-SESQAHVSGGGDDSSRPTV--WYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQ-NFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV---------LEGDPS----ENYSKYLLSLKEK--EEDSSG---HTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHY 490          
BLAST of msh6 vs. Ensembl Human
Match: MSH6 (mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 333/793 (41.99%), Postives = 484/793 (61.03%), Query Frame = 3
Query: 1200 FGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFD---NIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD-KPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
             GK+  G+  D   C       F+ +     P ++++ KGNLSK T+ +  S L+ + +E      QF  +  TL  L+  +YF E  ++ +    LP  L    +E+D++G +  ++ ELA+S LG  ++YL KCLID+ L+S+A+F  Y P D D +   +        F      M++D+ TL NL++  N + G  +GTLLER+D   T FG+RLL QW+  PLC+   I +R  AI++L+ +   +S +   LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F     II I  E     V    +SK+L++++     +  G FPD++  ++ + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYLEKQ+  I    I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD+ LK+ M ++F  FD++Y  W   +  IA  D LL L ++SRG D GPM RP I  + P D  PFL +   R PC  KT  G +FI N I +G        N     +L+TGPNMGGKSTLMRQ  L+ +++Q+GCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE+
Sbjct:  565 LGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGA----IFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEE-----VADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGD-GPMCRPVI--LLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIG-CEEEEQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEK 1325          

HSP 2 Score: 252.292 bits (643), Expect = 1.199e-67
Identity = 139/312 (44.55%), Postives = 193/312 (61.86%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISK 1317
            RK+    TP     TK   SI+  TK  L +FS   N S  + ++S   +D  +  +  + H + E+LK+E  RD  RR+PDHPD+D +TL++PE F++  TPG+++WW+IK+  N + +I +KVGKFYELYHMDA+  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+          EG       E+    L S KE   EE+  G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +  ++    K
Sbjct:  312 RKSSRKETP---SATKQATSISSETKNTLRAFSAPQN-SESQAHVSGGGDDSSRPTV--WYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQ-NFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV---------LEGDPS----ENYSKYLLSLKEK--EEDSSG---HTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEK 598          
BLAST of msh6 vs. Ensembl Celegans
Match: msh-6 (MSH (MutS Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9N3T8])

HSP 1 Score: 429.483 bits (1103), Expect = 3.001e-176
Identity = 260/767 (33.90%), Postives = 433/767 (56.45%), Query Frame = 3
Query: 1299 EIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN--LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGP--MTRPEIRHINPGDKPFLIITEGRFPCKA------KTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLI 3569
            + I  +G++S  T+ + N  L +   E     KQF+++ED +  + + DY+    +        P  L   L ++  L + S+ +++LA+S  GA+ +YL   LID  ++S+ +  +Y   + + ++  Q     KE    +  ++I+D   L NL+++ N     +  +L   ++   T FGRRLL  W+  P CDP K+ +RQKAIK L+  DA+  ++     LK  PDL++L+ KIH +GL      HPDSRA+ ++ +  +++KI + +  +  F    K++ E+ ++  E     +LL +++ + +     E  ++ E I FF+  FD+  A K+GKI+P +G D +YDE++  +KE   +L +Y +   K  + +I F  +GK ++ LE+PE+  +KV S++   S+RKGF RY T + E L+  L   E ++  +  +   ++F +F      W + +  ++ FD L SL  F++     P  M  PE    N  D P+LI+ +G  PC A       TQ+  FI+N+  +G+         +  VMLLTGPNMGGKSTLMRQTA++ IL+ +G  VPA   + LTP+DR+FTR GAND I  G+ST  +E+ E  ++L   + HS LL+DELGRGT+T+DG A+A ++L++I+D  + RT FSTH+H + +      N++++HM C+++ +N           + +  ++++TFLY+L  G CPKSYGF AA+LA I  Q++ N   ++  F    +I
Sbjct:  440 QAIVERGSISSTTKSIINGILFSVPVEHLLPKKQFMTAEDVVRIVSNEDYYGSDASE------WPEVLKGMLEDSSILPKPST-DWQLALSAFGAIFWYLRDSLIDVDMLSMRNVTIY---NSNSMENDQ----KKEKIDWNGKNLILDGTALENLNIVPNGRDSHL-TSLYYVINKCSTPFGRRLLRSWLLQPTCDPKKLEQRQKAIKWLVSPDASSFMTTATATLKKIPDLDRLLQKIHTIGLKYRSEKHPDSRAIFFDTIKTNQKKIAELLAAIDGFKLCNKLRKEYIKVQKEGE-GCELLDELLGNEQ-----EMEEVDENIYFFEKMFDRSTAMKDGKIVPNAGCDEEYDEALNRVKEALNELNDYKDSVAKKYSCSIKFVDSGKVKYLLEMPEN--TKVSSSFELKSRRKGFIRYSTPDSEQLVAALDAVEKEKSKLGDDATRRVFEQFGHKNPIWLETVKLVSSFDVLTSLALFAKS---SPFEMCMPEF-DFNATD-PYLIVDKGVHPCLALQSRNEVTQTTSFIANSTTMGAS--------EAAVMLLTGPNMGGKSTLMRQTAVLAILAHIGSMVPAFS-MRLTPIDRIFTRIGANDRIMCGESTFFIELKETDIMLKNATKHSLLLVDELGRGTSTFDGTAIASAVLQKISDDLACRTFFSTHYHSICDSFTNHPNVRLAHMKCVVDKEN-----------NEDPTMEDVTFLYELESGICPKSYGFYAAKLAGIDHQVVRNAYLESNKFASNLII 1158          

HSP 2 Score: 210.69 bits (535), Expect = 3.001e-176
Identity = 105/252 (41.67%), Postives = 154/252 (61.11%), Query Frame = 1
Query:  562 ESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISK 1317
            E ++H S++FLK + IRD  +R    P+YDP TL++P  F  K TPG +QWW +K+  + +TI+ FKVGKFYE YHMDAV  V  L + +MRG+YAH+GFPE A SK ADQL+  G+KVAR+EQTET + + ER +   +K KVV RE+C+V + GTR + + +      G +       ++     L + KE    E  K       + GV +++T T    I QF DDD RS+ RTL++   ++++ + +
Sbjct:  207 ERFDHESFDFLKPDKIRDGFKRPMSDPEYDPKTLWVPPDFHQKQTPGHRQWWTMKSQ-HFDTILLFKVGKFYETYHMDAVEVVRALNIAFMRGSYAHAGFPEHAASKFADQLMNHGYKVARIEQTETPQMLEERNQKTKTKEKVVRREVCRVTSNGTRTYGVLD------GVDLGSASSTLDPTAKHLLAIKEFHNPETGKS------SYGVCMIDTTTAHIRIGQFEDDDYRSQLRTLLANVIVVQAIVER 445          
BLAST of msh6 vs. Ensembl Celegans
Match: msh-2 (MSH (MutS Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9TXR4])

HSP 1 Score: 146.747 bits (369), Expect = 1.611e-35
Identity = 161/644 (25.00%), Postives = 285/644 (44.25%), Query Frame = 3
Query: 1692 AIDDKEPFYTHQSH--MIIDSNTLTNLDLLK---NSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNN-LKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEII--SFFKTAFDQENAKKNGKI--IPESGIDADYDESVALIKEIERDLAEYLEKQ----------KKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKL--LEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQII------LNGLKK 3539
            +I +K   + + +H  M+IDS  +  L+L +   N      + TL   L+   T  G +LL  W++ PLC  D I ER   ++ L E       ++++ L   PD  +L                  +R ++ +  L   + +  F    T  + +   +++  ++   +     + R  +L S+ ++I +  +  +++   FF   +++EN +   ++  +PE        E    ++++ER +AE L K+          K   NS   F+      F++ + E K  +    +I  + +    ++   E+  +  + +    K     + ++S +  K +E       +   IA  D  +SL++F+     G  TRP   ++ P     L + + R P         FI N + L    +          ++LTG NMGGKST +R  AL I+L+Q+G +VP     I + VD +FTR GA+D    G ST   EM + + IL   + +SF++IDELGRGT+T+DG  +A +I + I +     +IF+THFH++  L E+     LQ+                     ++NN     I  LYK+  G    S+G   A++  I E +I      L GL+K
Sbjct:  255 SISEKYSIFNYGTHGNMLIDSCAVEALELFQLNYNYLEKSNNLTLYNVLNKCKTLPGEKLLRDWLSRPLCQIDHINERLDIVEALFENQTIRQKLRDSILARMPDCSQL------------------ARRLMRKCTL---QDLNRFYQAATLLETV---EMQLIQLSEAEQFAPSINR--LLKSEITEILKKVERFQVLCDEFFDFDYEKENKEIRVRVDFVPE------IQEISEKLEQMER-VAEKLRKKYSAKFECDNLKLDKNSQYGFY------FRVTLKEEKSIRKKDVHILETTKGSGVKFSVGELSDINDEFLEFHLKYTRAEEEVISMLCKKAEEFIPLIPAMAQLIATLDVFVSLSTFA-ATSSGIYTRP---NLLPLGSKRLELKQCRHPVIEGNSEKPFIPNDVVLDKCRL----------IILTGANMGGKSTYLRSAALSILLAQIGSFVPCSSATI-SVVDGIFTRVGASDKQSQGISTFMAEMLDCSAILQRATKNSFVVIDELGRGTSTFDGFGIASAIAQDILNRIQCLSIFATHFHEMGKLAEQPGAVALQMG------------------VQIENN----EIHMLYKVFEGVAQCSFGLQVAKMVGIDENVINKAAQLLEGLEK 822          
BLAST of msh6 vs. Ensembl Celegans
Match: him-14 (MutS protein homolog him-14 [Source:UniProtKB/Swiss-Prot;Acc:Q23405])

HSP 1 Score: 105.531 bits (262), Expect = 9.875e-23
Identity = 84/328 (25.61%), Postives = 149/328 (45.43%), Query Frame = 3
Query: 2685 VINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPV-DRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKS-YGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDGKNISFES----IKMWQN-RFKK 3647
             +++++  D L  L ++S   D             P   P   I++GR P      S + I+N   L           D    ++TGPNM GKST ++QTA + I++Q+GC++PA    +  P+ +R+F+R G ND +   +S    EM++AA I+ Y   +S +++DEL R T+T +G A+ ++I +++       T  +THF  +       + +   H     +                    +N T  +KL  G      YGF    L+ IP+++I +          ++L  E R  ++     ++S    IK++ N RF++
Sbjct:  521 AMDALSSIDFLCGLATYSDLRDT----------CKPTFGPSFSISQGRHPILDWDDSEKTITNDTCLTR---------DRRFGIITGPNMAGKSTYLKQTAQLAIMAQIGCFIPANYASL--PIFNRIFSRMGHNDELIRNKSAFASEMSDAAAIVQYADKNSLVVLDELARSTSTEEGIAITYAICEKVL-KLQSYTFLATHFLDIAALANYSNAIDNYHFLPQTD--------------------ENSTKKHKLLRGQYRGPLYGFELVELSTIPDEVIEHA---------QSLATELRANVEDTERDYDSERRRIKVYMNHRFRE 797          
BLAST of msh6 vs. Ensembl Celegans
Match: msh-5 (MutS protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q19272])

HSP 1 Score: 91.6633 bits (226), Expect = 2.622e-18
Identity = 71/273 (26.01%), Postives = 118/273 (43.22%), Query Frame = 3
Query: 2796 DKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSI----LKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDGKN 3602
            D+P +   E   P         F+ N +  G   + ++        ++TGPN  GKS  M+   +++ LS +G +VPA    I   VDR+ TR    DS+  G ST   ++ + AL L   + +S ++IDE G+GT T  G +L  S+    + R AD C P    S+HFH L     +  N+       ++ +                     I +L+++T G    S+  + A+   IP  +I    +  K  +  TL+ E +  +   N
Sbjct:  598 DEPVIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKAS--------IITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGI-VDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRC-PHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGG-----------------KIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRACRIYKALKAGTLLKEIKAEVSNDN 843          
BLAST of msh6 vs. Ensembl Celegans
Match: msh-5 (MutS protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q19272])

HSP 1 Score: 91.2781 bits (225), Expect = 2.683e-18
Identity = 71/273 (26.01%), Postives = 118/273 (43.22%), Query Frame = 3
Query: 2796 DKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSI----LKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDGKN 3602
            D+P +   E   P         F+ N +  G   + ++        ++TGPN  GKS  M+   +++ LS +G +VPA    I   VDR+ TR    DS+  G ST   ++ + AL L   + +S ++IDE G+GT T  G +L  S+    + R AD C P    S+HFH L     +  N+       ++ +                     I +L+++T G    S+  + A+   IP  +I    +  K  +  TL+ E +  +   N
Sbjct:  152 DEPVIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKAS--------IITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGI-VDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRC-PHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGG-----------------KIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRACRIYKALKAGTLLKEIKAEVSNDN 397          
BLAST of msh6 vs. Ensembl Fly
Match: Msh6 (gene:FBgn0036486 transcript:FBtr0075646)

HSP 1 Score: 496.508 bits (1277), Expect = 7.940e-155
Identity = 292/760 (38.42%), Postives = 440/760 (57.89%), Query Frame = 3
Query: 1314 KGNLSKNTQHVFNSCLAATKKECFTNN-KQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYT---HQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVS--DHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFK---RYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMT--RPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIAD-SCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQ-NITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
            K  LS+ TQ +  + L    KE    N K   S+E TL +L++  Y+A   ++       P  L    ++ D+LG + +  Y+LA+  LG  ++++ KC ++  ++ +A + LY P       P QLA  D +P       +SHM++D+ TL+NL ++      G + +LL  LD   T FG+RLL  W+  P CD   I ERQ AI ELI +   L  ++  L   PD E+ +A+IH+ G +K +   DHPDSRA+L+E  LY+++K+  F+  L  F+++ K+   F         ++ LL++I    +    G FPD+S+ + +F TAFD + A K G I P++G+DA+YD ++  I E+E+ L  YL +Q++     I +FG+ K R+QL++PES  SK   +Y    Q KG K   RY T E   LLK + +AED R++VLK++  ++F KF  HY QW Q I+ +A  D L SL  ++    G  M    PE+  ++  D+PF+ + EG  PC     +  +I N ++LG+         + P+ LLTGPNMGGKSTLMR+  L++I++Q+G ++PA     L+ VDR+FTR GA D I +G ST  VE+NE +LIL + + HS +L+DELGRGTATYDG A+A S++  +A+  C  RT+FSTH+H L++       + + HMACM+E++            DN    Q  +TFLYK T G CPKSYGFNAA+LA +P+ II    + +K  E
Sbjct:  449 KSALSQRTQQIVRTVLGGILKEPVPGNGKHACSAEKTL-KLLAERYYAGPGSDD----NWPLVLRTMQSDMDHLGLTPNDNYKLALKALGQCIFFIHKCKLEPKVLPMARYQLYVP-------PDQLA--DAKPAVASTLRRSHMVLDATTLSNLRII------GEEHSLLSTLDHCCTKFGKRLLHHWLCAPSCDVSVIKERQDAIGELIRMPTELQEVRALLAPMPDFERNLAQIHLFG-NKQIKQMDHPDSRAILFEEKLYNKQKLQGFMAVLKGFNDLTKLPTMF------HQCKTTLLKRITQLPESG--GSFPDLSKELQYFATAFDHDAAAKTGVIAPQAGMDAEYDAAMDSIGEVEKRLKTYLVEQERHFGCRITYFGSDKKRYQLDVPESHASKANKSYTLEGQTKGKKPSRRYTTAETRALLKDMQHAEDTRNMVLKDLARRLFEKFSNHYDQWKQCIDCVANLDVLGSLAEYA----GQQMVICVPEL--VSDADQPFIQLEEGYHPC---ANASTYIPNGLELGTA-------SEAPLSLLTGPNMGGKSTLMREVGLLVIMAQIGAHIPA-ASCRLSLVDRIFTRLGAQDDILAGHSTFLVELNETSLILKHATCHSLVLLDELGRGTATYDGTAIAASVVNFLANLKC--RTLFSTHYHNLIDFFHNDKRITLGHMACMVENE------------DNADPTQETVTFLYKYTAGACPKSYGFNAAKLAGMPQGIIKRAYELSKKVE 1148          

HSP 2 Score: 218.394 bits (555), Expect = 2.188e-57
Identity = 162/484 (33.47%), Postives = 250/484 (51.65%), Query Frame = 1
Query:   55 SILSFFPKTPS-SKNKQTDILNIETANSKSK----VNKTDKIK-FKDNDSMPSTDNK--DSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRK------NVNASTPHKKKPTKDEKSIN--------------DSTKALLSSFSINANDSNIETNISQVIEDDFKNDIES----------YEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKH-ESSK-NKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISR-----FNLMKSFISKEIYQKILSMFLILVLLQP 1371
            ++L++F K+P+  K K T  +  +   SKS+     N+  K+K  K   S P+   K   SDD   + ++  KR+  +  + +S+ E  +  S +       +YE      +++   SG  +      +++  +P  KK  K  K +N              +ST  L    +      N+++N  Q   D   +DI +          + H   EFL+ + I+D + R+PDHPDYD +TL +PE F++ L+PG++QWW +K++ N + ++FFKVGKFYELYHMDA   V+ELG TYMRG +AHSGFPEI+F KM+  LV +GFKVARVEQTET + MTER K  +++K +KVV REICQ+   GT+ F  + +       + +  L  +E   G    +                   GV  ++T+ G F + +F DD   SR  TL+S      F   KS +S+   Q+I+   L  +L +P
Sbjct:   16 TLLNYFSKSPAFDKKKLTPSVKTDPDASKSEKENLQNQQPKVKDGKKEASKPAAKRKLPISDDEPASGQRKRKRI--VQPESDSEPEMEVTKSEDDFSDCASDYEPDENEASDDSVSSGAEEVSPSENDMSVDSPTPKKSRKKSKILNNNNNNEPSSKKVKLESTIQLAEGATFQEKLKNLQSNAKQ---DASYDDIVTNTSNLDEPVVWPHQKLEFLQPDKIKDKEGRRPDHPDYDKSTLHVPEKFLNGLSPGVRQWWVLKSD-NYDCVLFFKVGKFYELYHMDADVGVNELGFTYMRGEFAHSGFPEISFDKMSTILVDRGFKVARVEQTETPDMMTERCKRIKATKFDKVVAREICQITNRGTQVFGSQCKI--GPNHQPNYMLAIVEKDEGTCSRY-------------------GVCFIDTSIGDFHLGEFEDDKNCSRLLTLVSHHMPVLFLNEKSALSQRT-QQIVRTVLGGILKEP 471          
BLAST of msh6 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0344018)

HSP 1 Score: 162.925 bits (411), Expect = 2.398e-40
Identity = 145/596 (24.33%), Postives = 266/596 (44.63%), Query Frame = 3
Query: 1806 TLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIK-NNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGK----------NRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEE 3560
            ++L  LD   T  G RL+ QW+  PL   + + +R   ++ L+E    +  +  + LK  PD+  L  K     L +  ++  D   + Y+ +L + +              I+K+  E     +E  I +    K  L           D++ +    +   D E  ++      E  + A +D  +  ++++  +L   +E+ +   +  +N  G  +          + F++ + +    +    Y      KG  R+ + ++EG   +  +   + +    +I+ +I      +    T + N +AQ D L+S    +R     P  RP++  +  G +  L++ + R PC    +   FI+N++       N        + ++TGPNMGGKST +R     ++++ +G +VP     I + VD +  R GA+D+I  G ST  VEM E + I+   +  S ++IDELGRGT+TY+GC +A+SI + +A      T+F+THFH++ +  E    ++  HMA + +                     + T LY++  G   KS+G   ARLAN PE ++ N  +    FE+E
Sbjct:  326 SVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKK-----LMRRKANLQDLFRI-YQVILRTPK--------------ILKVLHELDNSTIESVICAPF--KSFL----------KDLTGLKQMVEQVVDFEAIERG-----EYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPT-PYVRPKM--LEEGARE-LVLEDVRHPCLELQEHVNFIANSVDFKKEECN--------MFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATI-SMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADA-------------------DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFEDE 852          
BLAST of msh6 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0344019)

HSP 1 Score: 162.925 bits (411), Expect = 2.398e-40
Identity = 145/596 (24.33%), Postives = 266/596 (44.63%), Query Frame = 3
Query: 1806 TLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIK-NNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGK----------NRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEE 3560
            ++L  LD   T  G RL+ QW+  PL   + + +R   ++ L+E    +  +  + LK  PD+  L  K     L +  ++  D   + Y+ +L + +              I+K+  E     +E  I +    K  L           D++ +    +   D E  ++      E  + A +D  +  ++++  +L   +E+ +   +  +N  G  +          + F++ + +    +    Y      KG  R+ + ++EG   +  +   + +    +I+ +I      +    T + N +AQ D L+S    +R     P  RP++  +  G +  L++ + R PC    +   FI+N++       N        + ++TGPNMGGKST +R     ++++ +G +VP     I + VD +  R GA+D+I  G ST  VEM E + I+   +  S ++IDELGRGT+TY+GC +A+SI + +A      T+F+THFH++ +  E    ++  HMA + +                     + T LY++  G   KS+G   ARLAN PE ++ N  +    FE+E
Sbjct:  326 SVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKK-----LMRRKANLQDLFRI-YQVILRTPK--------------ILKVLHELDNSTIESVICAPF--KSFL----------KDLTGLKQMVEQVVDFEAIERG-----EYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPT-PYVRPKM--LEEGARE-LVLEDVRHPCLELQEHVNFIANSVDFKKEECN--------MFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATI-SMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADA-------------------DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFEDE 852          
BLAST of msh6 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0080630)

HSP 1 Score: 162.925 bits (411), Expect = 2.398e-40
Identity = 145/596 (24.33%), Postives = 266/596 (44.63%), Query Frame = 3
Query: 1806 TLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIK-NNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGK----------NRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEE 3560
            ++L  LD   T  G RL+ QW+  PL   + + +R   ++ L+E    +  +  + LK  PD+  L  K     L +  ++  D   + Y+ +L + +              I+K+  E     +E  I +    K  L           D++ +    +   D E  ++      E  + A +D  +  ++++  +L   +E+ +   +  +N  G  +          + F++ + +    +    Y      KG  R+ + ++EG   +  +   + +    +I+ +I      +    T + N +AQ D L+S    +R     P  RP++  +  G +  L++ + R PC    +   FI+N++       N        + ++TGPNMGGKST +R     ++++ +G +VP     I + VD +  R GA+D+I  G ST  VEM E + I+   +  S ++IDELGRGT+TY+GC +A+SI + +A      T+F+THFH++ +  E    ++  HMA + +                     + T LY++  G   KS+G   ARLAN PE ++ N  +    FE+E
Sbjct:  326 SVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKK-----LMRRKANLQDLFRI-YQVILRTPK--------------ILKVLHELDNSTIESVICAPF--KSFL----------KDLTGLKQMVEQVVDFEAIERG-----EYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPT-PYVRPKM--LEEGARE-LVLEDVRHPCLELQEHVNFIANSVDFKKEECN--------MFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATI-SMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADA-------------------DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFEDE 852          
BLAST of msh6 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0309281)

HSP 1 Score: 162.925 bits (411), Expect = 2.398e-40
Identity = 145/596 (24.33%), Postives = 266/596 (44.63%), Query Frame = 3
Query: 1806 TLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIK-NNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGK----------NRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEE 3560
            ++L  LD   T  G RL+ QW+  PL   + + +R   ++ L+E    +  +  + LK  PD+  L  K     L +  ++  D   + Y+ +L + +              I+K+  E     +E  I +    K  L           D++ +    +   D E  ++      E  + A +D  +  ++++  +L   +E+ +   +  +N  G  +          + F++ + +    +    Y      KG  R+ + ++EG   +  +   + +    +I+ +I      +    T + N +AQ D L+S    +R     P  RP++  +  G +  L++ + R PC    +   FI+N++       N        + ++TGPNMGGKST +R     ++++ +G +VP     I + VD +  R GA+D+I  G ST  VEM E + I+   +  S ++IDELGRGT+TY+GC +A+SI + +A      T+F+THFH++ +  E    ++  HMA + +                     + T LY++  G   KS+G   ARLAN PE ++ N  +    FE+E
Sbjct:  326 SVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKK-----LMRRKANLQDLFRI-YQVILRTPK--------------ILKVLHELDNSTIESVICAPF--KSFL----------KDLTGLKQMVEQVVDFEAIERG-----EYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPT-PYVRPKM--LEEGARE-LVLEDVRHPCLELQEHVNFIANSVDFKKEECN--------MFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATI-SMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADA-------------------DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFEDE 852          
BLAST of msh6 vs. Ensembl Zebrafish
Match: msh6 (mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-020905-3])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 340/779 (43.65%), Postives = 482/779 (61.87%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRM--HVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD----KPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDN----PVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            P ++I+ KGN S  T  +F + +A++ +E      QF  ++ TL  L   DYF E+  +      LP  L    +E D L  +    YELA+S LG  ++YL KCL+D+ L S+ +F  Y P D +  Q    +      F      M++D  TL NL++L+NSS GG +GTLLERLD   T FG+RLL QWI  PLC+P  I +R  A+++L+   +  S + + LK  PDLE+L++KIH +G      DHPDSRA+LYE ++YS+RKI DF+  L  F    K+  E   +   V ++++SKLLR+++L   +++ G FPD+S  +  + TAFD + A+  G I P++G D +YD+++  IKE ERDL +YL++QKK +   N++++GTG+NR+QLE+PES   + +P  Y   S +KG+KRY T +IE +  +L + EDKRD  LK+ M ++F  FD++Y  W   +  +A  D LLS+  +S+  DG  M RPE+    PGD     PFL +   R PC  KT  G +FI N I +G          D     P +L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPAE  + LTPVDR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++K +++    RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLANIPE +I +G KKA+ FE  T+ +   K L
Sbjct:  591 PAQVIFEKGNPSIETLKIFKAIVASSLQEGLNAGSQFWDAQKTLKVLAEEDYFKESKDDNKKASVLPPALKAMTSECDALSLTPKTGYELALSALGGCMFYLKKCLVDQELFSMGNFEEYVPVDVEMEQAGGASCF----FAKTNQRMVLDGVTLANLEILQNSSTGGPEGTLLERLDTCCTPFGKRLLKQWICAPLCNPSSIGDRLDALEDLMGAPSQTSEVTDLLKKLPDLERLLSKIHSMGTPLKGQDHPDSRAILYEEVVYSKRKIADFLAALEGF----KVMKEIVSIMEPVGEDLKSKLLRQVVLLKTENEDGLFPDLSPELKRWDTAFDHQKARTTGVITPKAGFDPEYDQALNGIKECERDLQDYLDRQKKRLGCKNLSYWGTGRNRYQLEVPESVSERSLPEEYEVRSTKKGWKRYSTKDIERMFSELQSWEDKRDAALKDCMRRLFYNFDKNYKDWQTAVECMAVLDVLLSMCRYSQSADGS-MARPEM--ALPGDGSYSAPFLDLRGSRHPCVTKTFFGDDFIPNDIFIGCPGDEEEAQDDTKALAPCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPAES-LRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILLHATNHSLVLLDELGRGTATYDGTAIASAVVKELSEKICCRTLFSTHYHSLVEDHVQDPAVRLGHMACMVE---------NECE---DPSQETITFLYKFIRGACPKSYGFNAARLANIPEDVIQSGHKKARDFERSTVSLRIFKKL 1345          

HSP 2 Score: 216.853 bits (551), Expect = 0.000e+0
Identity = 129/333 (38.74%), Postives = 190/333 (57.06%), Query Frame = 1
Query:  307 STNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINAN-DSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSK---NKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFN 1293
            S  K IK K   E P  +K++ E      K   A+ P          S++   K+ LS+FS   N DS    N ++            ++H   E+L+    +DAQR++    +YDPTTL++PE F+++ TPG+++WW++K+    +T++F+KVGKFYELYHMDAV  V+EL LT+M+G +AHSGFPEI F + +D LV KG+KVARVEQTET + M  R K  +     +KVV RE+C++IT GT+ +S+ +    ET  +              L S KE   EE+  G   +    GV  ++T+ G+F I QF DD   SR RTL++ ++
Sbjct:  297 SPVKPIKRKRPTEKPTKSKSKPE----TPKRAPAALP----------SVSTDAKSRLSAFSAPDNFDSQNSANGTE-------GGSTVWDHEKLEWLQDGKRKDAQRKRQSDENYDPTTLYVPEDFLNRTTPGMRRWWQLKSE-MFDTVLFYKVGKFYELYHMDAVIGVNELNLTFMKGTWAHSGFPEIGFGRFSDVLVQKGYKVARVEQTETPDMMEARCKKLARPTKFDKVVKREVCRIITRGTQTYSVLDGAPSETQSK-------------YLLSIKEK-SEEDSTG---HGHIYGVCFIDTSVGRFHIGQFQDDRHCSRLRTLVAHYS 590          
BLAST of msh6 vs. Ensembl Zebrafish
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 232.261 bits (591), Expect = 6.515e-62
Identity = 192/706 (27.20%), Postives = 336/706 (47.59%), Query Frame = 3
Query: 1566 VSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGID-ADYDESVALIKEIERDLAEYLEKQKKII----NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQ--SGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPA-EGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL----DGKN-ISFESIKMWQNR 3638
            + CLG ++ YL +  ++K L+  + F     SD D                    HM++ + T+ NL++L N + G + G+LL  LD + T FG+RLL +W++ PL     I  RQ+A+ E++  +++ L +I++ L   PDLE+ +  I                        Y +R+    +++L+  +    ++L+     ++  + S LL+ ++L +        P +      F    +++ AK   K   E  +D  D+       +EIE  L + +E ++++     N ++++      +F +E+  S  S VP+ ++  S  K F RY T  I    ++L    ++  +   +        F +HY+   + +  +A  D L SL   ++        RPE+      +K  ++IT G+ P          +++ N   L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA E  V +  VD ++ R GA+D+I  G+ST   E+ E + +L+  +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E E     ++   HMA ++ +             +   + + ITFLY+L  G   +SYG N ARLA IPE I+     K+K  E E L+   RK +    D  + I  E++  W+ R
Sbjct:  459 ICCLGPVIQYLTEFKLEKILLCSSSFK-RLSSDPD--------------------HMLLSAATMKNLEILCNQTTGSVKGSLLWVLDHTQTLFGKRLLRKWVSQPLKSVIDIQARQEAVAEILSSESSVLPSIQSLLTRLPDLERGLCSI------------------------YHKREFYLIISSLSRLN----VELQALMPAIQSQLSSPLLKTLLLDT--------PQLLSPAHNFLKVLNEKAAKTGNKT--EMFVDLTDFPVIRKTKEEIESVLLDIMEHRREVRLLLKNPSLDYTTVSGQQFLIEVKNSMLSIVPADWVKISSTKVFGRYHTPFIVEKHRRLQQLREQLVIDCNHEWINFLQLFGDHYYILRKAVCHLATMDCLFSLAQVAKE---NNYCRPEVLE----EKSQILITAGKHPVITSLMGDQDQYVPNDTHLQG---DGKR-----AMIITGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASVGI--VDGIYVRMGASDNISRGRSTFMEELLETSDVLACATSRSLVILDELGRGTSTHDGIAIAYATLESFIREVGCMTLFVTHYPPLCELEHLYPQHVGNYHMAFLLNEPESTSD-------EEEAQPEFITFLYQLIEGAAARSYGLNVARLAEIPESILRTAAFKSK--ELEALVNSRRKMVRLLSDAWSIIDTETLLDWRKR 1079          
BLAST of msh6 vs. Ensembl Zebrafish
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 231.876 bits (590), Expect = 9.226e-62
Identity = 192/706 (27.20%), Postives = 336/706 (47.59%), Query Frame = 3
Query: 1566 VSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGID-ADYDESVALIKEIERDLAEYLEKQKKII----NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQ--SGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPA-EGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL----DGKN-ISFESIKMWQNR 3638
            + CLG ++ YL +  ++K L+  + F     SD D                    HM++ + T+ NL++L N + G + G+LL  LD + T FG+RLL +W++ PL     I  RQ+A+ E++  +++ L +I++ L   PDLE+ +  I                        Y +R+    +++L+  +    ++L+     ++  + S LL+ ++L +        P +      F    +++ AK   K   E  +D  D+       +EIE  L + +E ++++     N ++++      +F +E+  S  S VP+ ++  S  K F RY T  I    ++L    ++  +   +        F +HY+   + +  +A  D L SL   ++        RPE+      +K  ++IT G+ P          +++ N   L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA E  V +  VD ++ R GA+D+I  G+ST   E+ E + +L+  +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E E     ++   HMA ++ +             +   + + ITFLY+L  G   +SYG N ARLA IPE I+     K+K  E E L+   RK +    D  + I  E++  W+ R
Sbjct:  459 ICCLGPVIQYLTEFKLEKILLCSSSFK-RLSSDPD--------------------HMLLSAATMKNLEILCNQTTGSVKGSLLWVLDHTQTLFGKRLLRKWVSQPLKSVIDIQARQEAVAEILSSESSVLPSIQSLLTRLPDLERGLCSI------------------------YHKREFYLIISSLSRLN----VELQALMPAIQSQLSSPLLKTLLLDT--------PQLLSPAHNFLKVLNEKAAKTGNKT--EMFVDLTDFPVIRKTKEEIESVLLDIMEHRREVRLLLKNPSLDYTTVSGQQFLIEVKNSMLSIVPADWVKISSTKVFGRYHTPFIVEKHRRLQQLREQLVIDCNHEWINFLQLFGDHYYILRKAVCHLATMDCLFSLAQVAKE---NNYCRPEVLE----EKSQILITAGKHPVITSLMGDQDQYVPNDTHLQG---DGKR-----AMIITGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASVGI--VDGIYVRMGASDNISRGRSTFMEELLETSDVLACATSRSLVILDELGRGTSTHDGIAIAYATLESFIREVRCMTLFVTHYPPLCELEHLYPQHVGNYHMAFLLNEPESTSD-------EEEAQPEFITFLYQLIEGAAARSYGLNVARLAEIPESILRTAAFKSK--ELEALVNSRRKMVRLLSDAWSIIDTETLLDWRKR 1079          
BLAST of msh6 vs. Ensembl Zebrafish
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 230.335 bits (586), Expect = 2.678e-61
Identity = 191/706 (27.05%), Postives = 335/706 (47.45%), Query Frame = 3
Query: 1566 VSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGID-ADYDESVALIKEIERDLAEYLEKQKKII----NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQ--SGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPA-EGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL----DGKN-ISFESIKMWQNR 3638
            + CLG ++ YL +  ++K L+  + F     SD D                    HM++ + T+ NL++L N + G + G+LL  LD + T FG+RLL +W++ PL     I  RQ+A+ E++  +++ L +I++ L   PDLE+ +  I+                       + R    +F   +++   +  ++L+     ++  + S LL+ ++L +        P +      F    +++ AK   K   E  +D  D+       +EIE  L + +E ++++     N ++++      +F +E+  S  S VP+ ++  S  K F RY T  I    ++L    ++  +   +        F +HY+   + +  +A  D L SL   ++        RPE+      +K  ++IT G+ P          +++ N   L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA E  V +  VD ++ R GA+D+I  G+ST   E+ E + +L+  +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E E     ++   HMA ++ +             +   + + ITFLY+L  G   +SYG N ARLA IPE I+     K+K  E E L+   RK +    D  + I  E++  W+ R
Sbjct:  459 ICCLGPVIQYLTEFKLEKILLCSSSFK-RLSSDPD--------------------HMLLSAATMKNLEILCNQTTGSVKGSLLWVLDHTQTLFGKRLLRKWVSQPLKSVIDIQARQEAVAEILSSESSVLPSIQSLLTRLPDLERGLCSIY-----------------------HKRCSTQEFYLIISSLSRL-NVELQALMPAIQSQLSSPLLKTLLLDT--------PQLLSPAHNFLKVLNEKAAKTGNKT--EMFVDLTDFPVIRKTKEEIESVLLDIMEHRREVRLLLKNPSLDYTTVSGQQFLIEVKNSMLSIVPADWVKISSTKVFGRYHTPFIVEKHRRLQQLREQLVIDCNHEWINFLQLFGDHYYILRKAVCHLATMDCLFSLAQVAKE---NNYCRPEVLE----EKSQILITAGKHPVITSLMGDQDQYVPNDTHLQG---DGKR-----AMIITGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASVGI--VDGIYVRMGASDNISRGRSTFMEELLETSDVLACATSRSLVILDELGRGTSTHDGIAIAYATLESFIREVRCMTLFVTHYPPLCELEHLYPQHVGNYHMAFLLNEPESTSD-------EEEAQPEFITFLYQLIEGAAARSYGLNVARLAEIPESILRTAAFKSK--ELEALVNSRRKMVRLLSDAWSIIDTETLLDWRKR 1083          
BLAST of msh6 vs. Ensembl Zebrafish
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 229.565 bits (584), Expect = 4.723e-61
Identity = 183/673 (27.19%), Postives = 322/673 (47.85%), Query Frame = 3
Query: 1566 VSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGID-ADYDESVALIKEIERDLAEYLEKQKKII----NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQ--SGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPA-EGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
            + CLG ++ YL +  ++K L+  + F     SD D                    HM++ + T+ NL++L N + G + G+LL  LD + T FG+RLL +W++ PL     I  RQ+A+ E++  +++ L +I++ L   PDLE+ +  I                        Y +R+    +++L+  +    ++L+     ++  + S LL+ ++L +        P +      F    +++ AK   K   E  +D  D+       +EIE  L + +E ++++     N ++++      +F +E+  S  S VP+ ++  S  K F RY T  I    ++L    ++  +   +        F +HY+   + +  +A  D L SL   ++  +     RPE+      +K  ++IT G+ P          +++ N   L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA E  V +  VD ++ R GA+D+I  G+ST   E+ E + +L+  +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E E     ++   HMA ++ +             +   + + ITFLY+L  G   +SYG N ARLA IPE I+     K+K  E
Sbjct:  459 ICCLGPVIQYLTEFKLEKILLCSSSFK-RLSSDPD--------------------HMLLSAATMKNLEILCNQTTGSVKGSLLWVLDHTQTLFGKRLLRKWVSQPLKSVIDIQARQEAVAEILSSESSVLPSIQSLLTRLPDLERGLCSI------------------------YHKREFYLIISSLSRLN----VELQALMPAIQSQLSSPLLKTLLLDT--------PQLLSPAHNFLKVLNEKAAKTGNKT--EMFVDLTDFPVIRKTKEEIESVLLDIMEHRREVRLLLKNPSLDYTTVSGQQFLIEVKNSMLSIVPADWVKISSTKVFGRYHTPFIVEKHRRLQQLREQLVIDCNHEWINFLQLFGDHYYILRKAVCHLATMDCLFSLAQVAKENN---YCRPEVLE----EKSQILITAGKHPVITSLMGDQDQYVPNDTHLQG---DGKR-----AMIITGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASVGI--VDGIYVRMGASDNISRGRSTFMEELLETSDVLACATSRSLVILDELGRGTSTHDGIAIAYATLESFIREVGCMTLFVTHYPPLCELEHLYPQHVGNYHMAFLLNEPESTSD-------EEEAQPEFITFLYQLIEGAAARSYGLNVARLAEIPESILRTAAFKSKELE 1048          
BLAST of msh6 vs. Ensembl Xenopus
Match: MSH6 (mutS homolog 6 [Source:NCBI gene;Acc:100145639])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 336/803 (41.84%), Postives = 489/803 (60.90%), Query Frame = 3
Query: 1203 GKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAE--TPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSH-MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRM--HVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNP-VMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIME-FR 3581
            GK+  G+  D   C       F+ +     P +I++ KGN S +T+ V  SCL+ + +E      QF  +  TL  L    YF +   P +      LP  L    +E D+L  +  ++ ELA+S LGA +YYL KCLID+ L+S+A+F  Y P D   I+  Q +      F+   S  M++D  TLTNL++L+N + G  +GTLLE+LD   T FG+RLL QW+  PLC+P  I +R  A+++L++L   +S +   LK  PDLE+L++KIH +G      +HPDSRAV+YE + YS++KI DF++ L  F    K+  E   +      N +S +L++I+     +  G FPD+S  +  + T+FD E A+K G I P+ G D DYDE++  IK  E+DL EYL+KQ+K ++   + ++GT KNR+Q+EIPES   + +P  Y   S +KG+KRY T  IE +   L NAE++RD  LK+ M ++F  FD++Y +W   +   A  D L+SL+ +S+G D GP+ RP I  +     PFL +   R PC  KT  G +FI N I +G    +S+ + D    +L+TGPNMGGKSTL+RQ  L ++++QLGCYVPAE    LTPVDR+FTR GA+D I +G+ST  VE++E + IL + + HS +L+DELGRGTAT+DG A+A +++K ++ S   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLA+IP++II  G +KA+ FE  T+ +  FR
Sbjct:  492 GKFHVGQFEDDRHCS-----RFRTLVAHFPPIQILFEKGNPSSDTKKVLKSCLSTSIQESLQPTSQFWDAFKTLKTLAEEAYFEKDFQPGSG----NLPTVLKNLTSENDSLALTPGEKSELALSALGACIYYLKKCLIDQELLSMANFEEYIPVDTG-IEKAQAS----SSFFAKTSQRMVLDGVTLTNLEILQNGTNGSTEGTLLEKLDTCSTPFGKRLLKQWLCAPLCNPFSINDRLNAVEDLMDLPDKVSEVSELLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAVMYEEIAYSKKKIADFLSALEGF----KVMREVISILEDAAANFKSSILKQIVSIKGKTPQGHFPDLSAELKRWDTSFDHEKARKTGVITPKVGFDPDYDEALKDIKTTEQDLNEYLDKQRKRLSCKTVVYWGTAKNRYQMEIPESVTERNLPEEYELKSTKKGYKRYWTKAIEKMFGDLANAEERRDAALKDCMRRLFYNFDKNYKEWQTAVECFAVLDVLISLSQYSQGGD-GPVCRPVIV-LQDNHLPFLELKGSRHPCITKTFFGDDFIPNDILIGCKEEDSDDSSDEAHCVLVTGPNMGGKSTLLRQAGLQVVMAQLGCYVPAES-CRLTPVDRVFTRLGASDRIMAGESTFFVELSETSSILQHATEHSLVLLDELGRGTATFDGTAIASAVVKELSQSVKCRTLFSTHYHSLVEDYSHSQAVRLGHMACMVE---------NEC---EDPSQETITFLYKFIKGACPKSYGFNAARLAHIPDEIIQVGHQKAREFESITVSLRLFR 1261          

HSP 2 Score: 234.572 bits (597), Expect = 3.474e-62
Identity = 132/346 (38.15%), Postives = 202/346 (58.38%), Query Frame = 1
Query:  262 LSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            LSE D   +E+S +    K+ +  P+  + P  + ++E     ++  N S   K K               LSSFS   +  + +TN            +  ++H  +++L+    +D +R+K +  DYDP+TL++P+ F++K TPG+++WW++K+  N +T+IF+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R K   H S  ++VV REIC++IT GT+ +S+ +    E+  +              L  FKE + + + + ++      GV+ V+T+ GKF + QF DD   SRFRTL++ F
Sbjct:  211 LSEPDSETEEDSPVKVPLKRKRGNPDKPTGPKKRLQDELSETPKRASNVSAEAKLK---------------LSSFSAPESFES-QTNAGGT------GSVSVWDHEKFDWLQDGRRKDLKRKKQNDADYDPSTLYVPDDFLNKCTPGMRKWWQLKSQ-NFDTVIFYKVGKFYELYHMDAVIGVNELGLTFMKGAWAHSGFPEIAFGRFSDVLVQKGYKVARVEQTETPEMMEVRCKSMSHPSKFDRVVRREICRIITKGTQTYSVLDGNPSESHSK-------------YLLCFKEKMDDSSGQRRI-----YGVSFVDTSVGKFHVGQFEDDRHCSRFRTLVAHF 515          
BLAST of msh6 vs. Ensembl Xenopus
Match: MSH6 (mutS homolog 6 [Source:NCBI gene;Acc:100145639])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 334/805 (41.49%), Postives = 489/805 (60.75%), Query Frame = 3
Query: 1203 GKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAE--TPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSH-MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRM--HVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLG-SLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIME-FRKF 3587
            GK+  G+  D   C       F+ +     P +I++ KGN S +T+ V  SCL+ + +E      QF  +  TL  L    YF +   P +      LP  L    +E D+L  +  ++ ELA+S LGA +YYL KCLID+ L+S+A+F  Y P D   I+  Q +      F+   S  M++D  TLTNL++L+N + G  +GTLLE+LD   T FG+RLL QW+  PLC+P  I +R  A+++L++L   +S +   LK  PDLE+L++KIH +G      +HPDSRAV+YE + YS++KI DF++ L  F    K+  E   +      N +S +L++I+     +  G FPD+S  +  + T+FD E A+K G I P+ G D DYDE++  IK  E+DL EYL+KQ+K ++   + ++GT KNR+Q+EIPES   + +P  Y   S +KG+KRY T  IE +   L NAE++RD  LK+ M ++F  FD++Y +W   +   A  D L+SL+ +S+G D GP+ RP I  +     PFL +   R PC  KT  G +FI N I +G     + + + +   +L+TGPNMGGKSTL+RQ  L ++++QLGCYVPAE    LTPVDR+FTR GA+D I +G+ST  VE++E + IL + + HS +L+DELGRGTAT+DG A+A +++K ++ S   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLA+IP++II  G +KA+ FE  T+ +  FR+ 
Sbjct:  547 GKFHVGQFEDDRHCS-----RFRTLVAHFPPIQILFEKGNPSSDTKKVLKSCLSTSIQESLQPTSQFWDAFKTLKTLAEEAYFEKDFQPGSG----NLPTVLKNLTSENDSLALTPGEKSELALSALGACIYYLKKCLIDQELLSMANFEEYIPVDTG-IEKAQAS----SSFFAKTSQRMVLDGVTLTNLEILQNGTNGSTEGTLLEKLDTCSTPFGKRLLKQWLCAPLCNPFSINDRLNAVEDLMDLPDKVSEVSELLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAVMYEEIAYSKKKIADFLSALEGF----KVMREVISILEDAAANFKSSILKQIVSIKGKTPQGHFPDLSAELKRWDTSFDHEKARKTGVITPKVGFDPDYDEALKDIKTTEQDLNEYLDKQRKRLSCKTVVYWGTAKNRYQMEIPESVTERNLPEEYELKSTKKGYKRYWTKAIEKMFGDLANAEERRDAALKDCMRRLFYNFDKNYKEWQTAVECFAVLDVLISLSQYSQGGD-GPVCRPVIV-LQDNHLPFLELKGSRHPCITKTFFGDDFIPNDILIGCKEEDSDDSSDEAHCVLVTGPNMGGKSTLLRQAGLQVVMAQLGCYVPAES-CRLTPVDRVFTRLGASDRIMAGESTFFVELSETSSILQHATEHSLVLLDELGRGTATFDGTAIASAVVKELSQSVKCRTLFSTHYHSLVEDYSHSQAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLAHIPDEIIQVGHQKAREFESITVSLRLFREL 1318          

HSP 2 Score: 234.958 bits (598), Expect = 3.497e-62
Identity = 132/346 (38.15%), Postives = 202/346 (58.38%), Query Frame = 1
Query:  262 LSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            LSE D   +E+S +    K+ +  P+  + P  + ++E     ++  N S   K K               LSSFS   +  + +TN            +  ++H  +++L+    +D +R+K +  DYDP+TL++P+ F++K TPG+++WW++K+  N +T+IF+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R K   H S  ++VV REIC++IT GT+ +S+ +    E+  +              L  FKE + + + + ++      GV+ V+T+ GKF + QF DD   SRFRTL++ F
Sbjct:  266 LSEPDSETEEDSPVKVPLKRKRGNPDKPTGPKKRLQDELSETPKRASNVSAEAKLK---------------LSSFSAPESFES-QTNAGGT------GSVSVWDHEKFDWLQDGRRKDLKRKKQNDADYDPSTLYVPDDFLNKCTPGMRKWWQLKSQ-NFDTVIFYKVGKFYELYHMDAVIGVNELGLTFMKGAWAHSGFPEIAFGRFSDVLVQKGYKVARVEQTETPEMMEVRCKSMSHPSKFDRVVRREICRIITKGTQTYSVLDGNPSESHSK-------------YLLCFKEKMDDSSGQRRI-----YGVSFVDTSVGKFHVGQFEDDRHCSRFRTLVAHF 570          
BLAST of msh6 vs. Ensembl Xenopus
Match: MSH6 (mutS homolog 6 [Source:NCBI gene;Acc:100145639])

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 334/803 (41.59%), Postives = 488/803 (60.77%), Query Frame = 3
Query: 1203 GKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAE--TPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSH-MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRM--HVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLG-SLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIME-FR 3581
            GK+  G+  D   C       F+ +     P +I++ KGN S +T+ V  SCL+ + +E      QF  +  TL  L    YF +   P +      LP  L    +E D+L  +  ++ ELA+S LGA +YYL KCLID+ L+S+A+F  Y P D   I+  Q +      F+   S  M++D  TLTNL++L+N + G  +GTLLE+LD   T FG+RLL QW+  PLC+P  I +R  A+++L++L   +S +   LK  PDLE+L++KIH +G      +HPDSRAV+YE + YS++KI DF++ L  F    K+  E   +      N +S +L++I+     +  G FPD+S  +  + T+FD E A+K G I P+ G D DYDE++  IK  E+DL EYL+KQ+K ++   + ++GT KNR+Q+EIPES   + +P  Y   S +KG+KRY T  IE +   L NAE++RD  LK+ M ++F  FD++Y +W   +   A  D L+SL+ +S+G D GP+ RP I  +     PFL +   R PC  KT  G +FI N I +G     + + + +   +L+TGPNMGGKSTL+RQ  L ++++QLGCYVPAE    LTPVDR+FTR GA+D I +G+ST  VE++E + IL + + HS +L+DELGRGTAT+DG A+A +++K ++ S   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLA+IP++II  G +KA+ FE  T+ +  FR
Sbjct:  495 GKFHVGQFEDDRHCS-----RFRTLVAHFPPIQILFEKGNPSSDTKKVLKSCLSTSIQESLQPTSQFWDAFKTLKTLAEEAYFEKDFQPGSG----NLPTVLKNLTSENDSLALTPGEKSELALSALGACIYYLKKCLIDQELLSMANFEEYIPVDTG-IEKAQAS----SSFFAKTSQRMVLDGVTLTNLEILQNGTNGSTEGTLLEKLDTCSTPFGKRLLKQWLCAPLCNPFSINDRLNAVEDLMDLPDKVSEVSELLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAVMYEEIAYSKKKIADFLSALEGF----KVMREVISILEDAAANFKSSILKQIVSIKGKTPQGHFPDLSAELKRWDTSFDHEKARKTGVITPKVGFDPDYDEALKDIKTTEQDLNEYLDKQRKRLSCKTVVYWGTAKNRYQMEIPESVTERNLPEEYELKSTKKGYKRYWTKAIEKMFGDLANAEERRDAALKDCMRRLFYNFDKNYKEWQTAVECFAVLDVLISLSQYSQGGD-GPVCRPVIV-LQDNHLPFLELKGSRHPCITKTFFGDDFIPNDILIGCKEEDSDDSSDEAHCVLVTGPNMGGKSTLLRQAGLQVVMAQLGCYVPAES-CRLTPVDRVFTRLGASDRIMAGESTFFVELSETSSILQHATEHSLVLLDELGRGTATFDGTAIASAVVKELSQSVKCRTLFSTHYHSLVEDYSHSQAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLAHIPDEIIQVGHQKAREFESITVSLRLFR 1264          

HSP 2 Score: 234.572 bits (597), Expect = 3.598e-62
Identity = 132/346 (38.15%), Postives = 202/346 (58.38%), Query Frame = 1
Query:  262 LSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            LSE D   +E+S +    K+ +  P+  + P  + ++E     ++  N S   K K               LSSFS   +  + +TN            +  ++H  +++L+    +D +R+K +  DYDP+TL++P+ F++K TPG+++WW++K+  N +T+IF+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R K   H S  ++VV REIC++IT GT+ +S+ +    E+  +              L  FKE + + + + ++      GV+ V+T+ GKF + QF DD   SRFRTL++ F
Sbjct:  214 LSEPDSETEEDSPVKVPLKRKRGNPDKPTGPKKRLQDELSETPKRASNVSAEAKLK---------------LSSFSAPESFES-QTNAGGT------GSVSVWDHEKFDWLQDGRRKDLKRKKQNDADYDPSTLYVPDDFLNKCTPGMRKWWQLKSQ-NFDTVIFYKVGKFYELYHMDAVIGVNELGLTFMKGAWAHSGFPEIAFGRFSDVLVQKGYKVARVEQTETPEMMEVRCKSMSHPSKFDRVVRREICRIITKGTQTYSVLDGNPSESHSK-------------YLLCFKEKMDDSSGQRRI-----YGVSFVDTSVGKFHVGQFEDDRHCSRFRTLVAHF 518          
BLAST of msh6 vs. Ensembl Xenopus
Match: MSH3 (mutS homolog 3 [Source:NCBI gene;Acc:100486354])

HSP 1 Score: 228.409 bits (581), Expect = 4.165e-61
Identity = 184/614 (29.97%), Postives = 299/614 (48.70%), Query Frame = 3
Query: 1740 IDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANL-SNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVAL---IKEIERDLAEYLEKQKKII-NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            ++  TL NL++L+N +     G+L+  LD + T FGRR + QW+  PL +  +I  R +A+ E++  D+++ + ++++L   PDLE+ V  I+          H             S ++    V+TL    N     +E     ++  ++S LL+ I          E P + E +  F    ++  A+   K      +  D+ +  A    I+E+   L  +L   +KI+ N   ++       F +E+  S  S VP  +I  S  K   R+ +  I    + L    +K  L           KF E+Y    + IN +A  D + SL   ++                 G    +II  GR P       +  +F+ N+    SL+ +  R     VM++TGPNMGGKS+ ++Q ALI I++Q+G YVPAE  V +  VD +FTR GA D+I  G+ST   E+ + A IL   +P S +++DELGRGT+T+DG A+A+S L+ I  S +  T+F TH+  L E EK   + +   HMA  ++++ D D G  +       + Q++TFLY++T G   +SYG N A+LA+IP  ++     K+K  EE
Sbjct:  351 MNGTTLKNLEILQNQTDLKTKGSLIWVLDHTRTCFGRRKIKQWVTQPLVNTREINARLEAVSEVLLSDSSVFTQVRSHLSKLPDLERGVCSIY----------HKKC----------STQEFFLIVSTLCNISN----NMEALIPAIKSQVKSPLLQTIF--------AEIPQMLEPMHKFLNVLNESAARTGNKTELFKDL-TDFPKISARKLEIQEMLLKLEAHLGDIRKILKNPAASYTSVYGQEFLIEVKNSLGSVVPPDWITVSSTKAVSRFHSPFIVENYRHLNQLREKLVLDCNTEWLHFLDKFGENYHSVCKSINHLATADCIFSLAEVAK---------------QDGYCSEIIIKNGRHPVIDLLLEEQSQFVPNST---SLMADKER-----VMIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEA-VTVGIVDGIFTRMGAADNIYKGRSTFMDELLDTAEILKNATPRSLVILDELGRGTSTHDGIAIAYSTLEYIIKSVTSLTLFVTHYPSLCELEKAYAEQVGNYHMAFFVDEEEDTDSGFLQ-------QPQHVTFLYQITQGIAARSYGLNVAKLADIPHSVVTRAACKSKALEE 900          
BLAST of msh6 vs. Ensembl Xenopus
Match: MSH3 (mutS homolog 3 [Source:NCBI gene;Acc:100486354])

HSP 1 Score: 224.557 bits (571), Expect = 2.300e-59
Identity = 206/708 (29.10%), Postives = 334/708 (47.18%), Query Frame = 3
Query: 1554 YELAVSC-LGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANL-SNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKI--------IPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE--ETLIMEFRKFLDGKNI-SFESIKMW 3629
            ++ +V C L A + YL +  ++K L + ++F     S  +C++                    ++  TL NL++L+N +     G+L+  LD + T FGRR + QW+  PL +  +I  R +A+ E++  D+++ + ++++L   PDLE+ V  I+              +    E  L         V+TL    N     +E     ++  ++S LL+ I          E P + E +  F    ++  A+   K          P+  I A   E   ++ ++E  L +  +  K    S  + +G       L       S V ST  +S   K   R+ +  I    + L    +K  L           KF E+Y    + IN +A  D + SL   ++  DG    RP +   + G +  +II  GR P       +  +F+ N+    SL+ N  R     VM++TGPNMGGKS+ ++Q ALI I++Q+G YVPAE  V +  VD +FTR GA D+I  G+ST   E+ + A IL   +P S +++DELGRGT+T+DG A+A+S L+ I  S +  T+F TH+  L E EK   + +   HMA  ++++ D D G          + Q++TFLY++T G   +SYG N A+LA+IP  ++     K+K  EE  E    + + F    NI S E +K W
Sbjct:  435 FDKSVICSLAATIKYLKEFHLEKILYNSSNFT-QMSSKNECLR--------------------MNGTTLKNLEILQNQTDLKTKGSLIWVLDHTRTCFGRRKIKQWVTQPLVNTREINARLEAVSEVLLSDSSVFTQVRSHLSKLPDLERGVCSIY------------HKKCSTQEFFL--------IVSTLCNISN----NMEALIPAIKSQVKSPLLQTIF--------AEIPQMLEPMHKFLNVLNESAARTGNKTELFKDLTDFPK--ISARKLEIQEMLLKLEAHLGDIRKILKNPAASYTSVYGQENENITL------ISCVLST--SSYSTKAVSRFHSPFIVENYRHLNQLREKLVLDCNTEWLHFLDKFGENYHSVCKSINHLATADCIFSLAEVAKQ-DG--YCRPAVH--DSGSE--IIIKNGRHPVIDLLLEEQSQFVPNST---SLMANKER-----VMIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEA-VTVGIVDGIFTRMGAADNIYKGRSTFMDELLDTAEILKNATPRSLVILDELGRGTSTHDGIAIAYSTLEYIIKSVTSLTLFVTHYPSLCELEKAYAEQVGNYHMAFFVDEEEDTDSGAESLQ-----QPQHVTFLYQITQGIAARSYGLNVAKLADIPHSVVTRAACKSKALEELVEMKRKKLKAFQSAWNINSSEELKEW 1058          
BLAST of msh6 vs. Ensembl Mouse
Match: Msh6 (mutS homolog 6 [Source:MGI Symbol;Acc:MGI:1343961])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 332/792 (41.92%), Postives = 481/792 (60.73%), Query Frame = 3
Query: 1200 FGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQ--LEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD--KPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
             GK+  G+  D   C       F+ +     P +I++ KGNLS  T+ V    L++  +E      QF  +  TL  L+   YF     N  S   LP  L    +E+D++G +  +E ELA+S LG +++YL KCLID+ L+S+A+F  Y+P D D +      +     F      M++D+ TL NL++  N + G  +GTLLERLD   T FG+RLL QW+  PLC P  I +R  A+++L+ +   ++ + + LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F  + K+   LE     V     SK L++++     S  G FPD++  +  + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYL+KQ+  +   +I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD  LK+ M ++F  FD+++  W   +  IA  D LL L ++S+G D GPM RPEI  + PG+   PFL     R PC  KT  G +FI N I +G     +  +     +L+TGPNMGGKSTL+RQ  L+ +++QLGCYVPAE    LTPVDR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE
Sbjct:  564 LGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSSCLQEGLIPGSQFWDATKTLRTLLEGGYFT---GNGDSSTVLPLVLKGMTSESDSVGLTPGEESELALSALGGIVFYLKKCLIDQELLSMANFEEYFPLDSDTVS----TVKPGAVFTKASQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPSAISDRLDAVEDLMAVPDKVTEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKVSGLLE----EVAGGFTSKTLKQVVTLQSKSPKGRFPDLTAELQRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRLGCKSIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDTSLKDCMRRLFCNFDKNHKDWQSAVECIAVLDVLLCLANYSQGGD-GPMCRPEI--VLPGEDTHPFLEFKGSRHPCITKTFFGDDFIPNDILIG-CEEEAEEHGKAYCVLVTGPNMGGKSTLIRQAGLLAVMAQLGCYVPAE-KCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSKSVCVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE 1322          

HSP 2 Score: 250.751 bits (639), Expect = 2.202e-67
Identity = 138/303 (45.54%), Postives = 189/303 (62.38%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            RK++   T   K+ T     I   TK+ LS+FS   N S  +T++S    D     +  + H + E+LK E  RD  RR+PDHP+++PTTL++PE F++  TPG+++WW++K+  N + +IF+KVGKFYELYHMDAV  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+ +         G     Y       L S KE   EE   G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +
Sbjct:  312 RKSLKKETGSAKRAT----PILSETKSTLSAFSAPQN-SESQTHVSGGGNDSSGPTV--WYHETLEWLKPEKRRDEHRRRPDHPEFNPTTLYVPEEFLNSCTPGMRKWWQLKSQ-NFDLVIFYKVGKFYELYHMDAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVVRREICRIITKGTQTYSVLD---------GDPSENYSR----YLLSLKEK--EEETSG---HTRVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHY 588          
BLAST of msh6 vs. Ensembl Mouse
Match: Msh3 (mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519])

HSP 1 Score: 213.386 bits (542), Expect = 6.679e-56
Identity = 175/633 (27.65%), Postives = 299/633 (47.24%), Query Frame = 3
Query: 1734 MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANL-SNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKI--------IPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLD 3593
            M I+  TL NL++L+N +     G+LL  LD + T+FGRR L  W+  PL    +I  R  A+ +++  ++++   I+N L+  PD+E+ +  I+                       + +    +F   + +   + K +L+     V  ++QS LLR +++        E P++   +  +    +   AK   K          P   I    +E   +I  I+  L E+    +KI+   ++ +       F +EI  S  S +P+ ++     K   R+    I    ++L    ++  L            F EHY    + ++ +A  D + SL   ++    G   RP ++     ++  +II  GR P       +  +F+ N+    SL  +S R     VM++TGPNMGGKS+ ++Q AL+ I++Q+G YVPAE   I   VD +FTR GA D+I  G+ST   E+ + A I+   SP S +++DELGRGT+T+DG A+A++ L+         T+F TH+  + E EK   + +   HM  ++ +D            D      ++TFLY++T G   +SYG N A+LA++P +++     K+K  E E L+   RK L+
Sbjct:  493 MRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQPLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIY-----------------------HKKCSTQEFFLIVKSLCQL-KSELQALMPAVNSHVQSDLLRALIV--------EAPELLSPVEHYLKVLNGPAAKVGDKTELFKDLSDFP--LIKKRKNEIQEVIHSIQMRLQEF----RKILKLPSLQYVTVSGQEFMIEIKNSAVSCIPADWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCNAEWLGFLENFGEHYHTLCKAVDHLATVDCIFSLAKVAKQ---GNYCRPTLQ-----EEKKIIIKNGRHPMIDVLLGEQDQFVPNST---SLSQDSER-----VMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGI-VDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSG-----DMEQMPDSVTFLYQITRGIAARSYGLNVAKLADVPREVLQKAAHKSK--ELEGLVSLRRKRLE 1063          
BLAST of msh6 vs. Ensembl Mouse
Match: Msh3 (mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519])

HSP 1 Score: 212.616 bits (540), Expect = 1.286e-55
Identity = 174/633 (27.49%), Postives = 298/633 (47.08%), Query Frame = 3
Query: 1734 MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANL-SNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKI--------IPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLD 3593
            M I+  TL NL++L+N +     G+LL  LD + T+FGRR L  W+  PL    +I  R  A+ +++  ++++   I+N L+  PD+E+ +  I+                       + +    +F   + +   + K +L+     V  ++QS LLR +++        E P++   +  +    +   AK   K          P   I    +E   +I  I+  L E+    +KI+   ++ +       F +EI  S  S +P+ ++     K   R+    I    ++L    ++  L            F EHY    + ++ +A  D + SL   ++    G   RP ++     ++  +II  GR P       +  +F+ N+  L     +S R     VM++TGPNMGGKS+ ++Q AL+ I++Q+G YVPAE   I   VD +FTR GA D+I  G+ST   E+ + A I+   SP S +++DELGRGT+T+DG A+A++ L+         T+F TH+  + E EK   + +   HM  ++ +D            D      ++TFLY++T G   +SYG N A+LA++P +++     K+K  E E L+   RK L+
Sbjct:  493 MRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQPLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIY-----------------------HKKCSTQEFFLIVKSLCQL-KSELQALMPAVNSHVQSDLLRALIV--------EAPELLSPVEHYLKVLNGPAAKVGDKTELFKDLSDFP--LIKKRKNEIQEVIHSIQMRLQEF----RKILKLPSLQYVTVSGQEFMIEIKNSAVSCIPADWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCNAEWLGFLENFGEHYHTLCKAVDHLATVDCIFSLAKVAKQ---GNYCRPTLQ-----EEKKIIIKNGRHPMIDVLLGEQDQFVPNSTSLS----DSER-----VMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGI-VDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSG-----DMEQMPDSVTFLYQITRGIAARSYGLNVAKLADVPREVLQKAAHKSK--ELEGLVSLRRKRLE 1062          
BLAST of msh6 vs. Ensembl Mouse
Match: Msh2 (mutS homolog 2 [Source:MGI Symbol;Acc:MGI:101816])

HSP 1 Score: 162.54 bits (410), Expect = 4.429e-40
Identity = 159/595 (26.72%), Postives = 267/595 (44.87%), Query Frame = 3
Query: 1836 TAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANL--SNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDN-------------IIKIQLEFTRMHVEQNIQSKL-LRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPES-GIDADYDESVALIKEIERDLAEYLE---KQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSI-AQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            TA G+RL+ QWI  PL D ++I ER   ++  +E D+ L  S  ++ L+  PDL +L  K       +  ++  D    LY+G+     ++   +  L  ++              +I ++ +F++   ++ I++ L + ++  H    K    P++SE+    +   D    K    +I  + G+  D  + + L  +       Y     K++K++ +N NF      +  ++   S+ S +   Y   ++ KG                   E+ +D ++K I++         Y +  Q +N + A  DA++S    S      P  RP I     G    +I+   R  C        FI N +         ++ +     ++TGPNMGGKST +RQT +I++++Q+GC+VP E   + + VD +  R GA DS   G ST   EM E A IL   +  S ++IDELGRGT+TYDG  LA++I   IA       +F+THFH+L            + +A  I   N         H+      + +T LY++  G C +S+G + A LAN P  +I    +KA   EE
Sbjct:  335 TAQGQRLVNQWIKQPLMDRNRIEERLNLVEAFVE-DSELRQSLQEDLLRRFPDLNRLAKKFQ-----RQAANLQDCYR-LYQGI----NQLPSVIQALEKYEGRHQALLLAVFVTPLIDLRSDFSKF--QEMIETTLDMDQVENHEFLVKPSFDPNLSEL----REVMDGLEKKMQSTLINAARGLGLDPGKQIKL--DSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSELSSLNEEY---TKNKG-----------------EYEEAQDAIVKEIVN-----ISSGYVEPMQTLNDVLAHLDAIVSFAHVSNAAPV-PYVRPVILEKGKGR---IILKASRHACVEVQDEVAFIPNDVHF-----EKDKQM---FHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEV-SIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISDYIATKIGAFCMFATHFHEL------------TALANQIPTVN-------NLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHVIACAKQKALELEE 853          
BLAST of msh6 vs. Ensembl Mouse
Match: Msh4 (mutS homolog 4 [Source:MGI Symbol;Acc:MGI:1860077])

HSP 1 Score: 121.709 bits (304), Expect = 1.757e-27
Identity = 89/302 (29.47%), Postives = 147/302 (48.68%), Query Frame = 3
Query: 2631 IMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQN-ITFLYKLTHGGC-PKSYGFNAARLANIPEQIILNG 3530
            I+ K+ ++  EH     ++ ++++  D LLS   F+         RPE           L I +G  P   K  + + ++N         N+     + V+++TGPNM GKST ++Q AL  I++Q+G YVPAE         ++FTR   +D I +  ST   EM E A IL   +  S +LIDELGRGT T +G  +++++ + +  S    T+F+THF +L     +  N++  H                  H+ N  + ++ I + YKL+ G    K+YG  AA  +++P  I+L+ 
Sbjct:  423 IVCKLLSEIYEHIHCLYKLSDTVSMLDMLLS---FAHACTLSDYVRPEFTDT-------LAIKQGWHPILEKISAEKPVAN---------NTYITEGSNVLIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAA-QIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGISYAVCEHLL-SIKAFTLFTTHFLELCHLDALYLNVENMHFEVQ--------------HVKNTSRNKDAILYTYKLSRGLTEEKNYGLKAAEASSLPSSIVLDA 689          
BLAST of msh6 vs. UniProt/SwissProt
Match: sp|E1BYJ2|MSH6_CHICK (DNA mismatch repair protein Msh6 OS=Gallus gallus OX=9031 GN=MSH6 PE=3 SV=2)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 331/801 (41.32%), Postives = 495/801 (61.80%), Query Frame = 3
Query: 1203 GKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFD--NIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            GK+  G+  D   C       F+ +     P ++++ KGNL+ +TQ +    L +  +E   +  QF S+  TL  L+  +YF E   N  S   LP+ +    +E+D+LG +  +  ELA+S LG +++YL KCLID+ L+S+A+F  Y P D D    +   +     F      M++D  TL NL++L+N + G  +GTLLER+D   T FG+RLL QW+  PLC+P  I +R  A+++L+ + A L+ I  +LK  PDLE+L++KIH +G      +HPDSRA+ YE + YS++KI DF++ L  F   N I   +E     V  + +S++L++++        G FPD+S  +  + TAFD   A+K G I P++G D DYD+++  IK +E D   YL+KQ+K++   ++ ++GTGKNR+Q+EIPE+  S+ +P  Y   S RKG+KRY T EIE +L +LINAE++RD  LK+ M ++F  FD++   W   +  IA  D L+SL ++S+  D GP+ RP I        PFL +   R PC  KT  G +FI N I +GS   + +   +   +L+TGPNMGGKSTLMRQ  L++I++QLGCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E + IL + + HS +L+DELGRGTAT+DG A+A ++++ +A++   RT+FSTH+H L+E+      +++ HMACM+E++              +   + ITFLYK   G CPKSYGFNAARLA+IPE+II  G +KAK FE++T+ +   +FL
Sbjct:  543 GKFYVGQFSDDRHCS-----RFRTLVAHYTPVQVLFEKGNLTVDTQKILKGSLISCIQEGLISGSQFWSASKTLKVLLEEEYFKEN-QNTESGCVLPSVIKSLTSESDSLGLTPGENSELALSALGGIVFYLKKCLIDQELLSLANFEKYIPVDAD----NAKTVSSSNFFARTDRRMVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPTSINDRLDAVEDLLAVPAKLTEITEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDAME----EVASDFKSQVLKQLVTRKAKHPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKTVEEDFRTYLDKQRKLLGLKSVLYWGTGKNRYQMEIPETATSRNLPEEYELKSTRKGYKRYWTKEIEKMLAELINAEERRDAALKDCMRRLFYNFDKNSQDWQTAVQCIAVLDVLMSLANYSQDGD-GPLCRPVILLPVDSAPPFLELKNARHPCITKTFFGDDFIPNDIVIGS--KDEDGGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVRELAENIKCRTLFSTHYHSLVEDYSGSAAVRLGHMACMVENE------------SEDPSQETITFLYKFIEGACPKSYGFNAARLADIPEEIIQKGHRKAKEFEKKTMSLRIFRFL 1313          

HSP 2 Score: 236.498 bits (602), Expect = 5.217e-62
Identity = 134/333 (40.24%), Postives = 194/333 (58.26%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLS-----SFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISKEIY----QKILSMFLI 1353
            RK  N S P K+   ++E S      A +S       ++ A   N E+  +        N   ++EH   E+L++   +DA RR+ +HPDYDP TL++PE +++K TPG+++WW++K+  N + +I +KVGKFYELYHMDAVT V+ELGL +M+G++AHSGFPE AF + +  LV KG+K+ARVEQTET E M  R K   H +  +KVV REIC++IT GT+ +S+ +  C  T           E+    L   KE   +E+  G+       GV  V+T+ GKF + QF+DD   SRFRTL++ +  ++    K       QKIL   LI
Sbjct:  282 RKRGNVSKPSKRSSLENEHSEAPKRAAPVSLEAKSKLTLFAAPENFESQANAC--SGGTNGFAAWEHEKLEWLQEGKKKDAHRRRQNHPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQ-NFDAVICYKVGKFYELYHMDAVTGVNELGLIFMKGSWAHSGFPETAFGRFSAILVQKGYKIARVEQTETPEMMEARCKATAHTTKFDKVVRREICRIITKGTQTYSIID--CDPT-----------ENHNKYLLCVKE---KEDSSGQRV----YGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLFEKGNLTVDTQKILKGSLI 591          
BLAST of msh6 vs. UniProt/SwissProt
Match: sp|P54276|MSH6_MOUSE (DNA mismatch repair protein Msh6 OS=Mus musculus OX=10090 GN=Msh6 PE=1 SV=3)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 332/792 (41.92%), Postives = 481/792 (60.73%), Query Frame = 3
Query: 1200 FGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQ--LEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD--KPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
             GK+  G+  D   C       F+ +     P +I++ KGNLS  T+ V    L++  +E      QF  +  TL  L+   YF     N  S   LP  L    +E+D++G +  +E ELA+S LG +++YL KCLID+ L+S+A+F  Y+P D D +      +     F      M++D+ TL NL++  N + G  +GTLLERLD   T FG+RLL QW+  PLC P  I +R  A+++L+ +   ++ + + LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F  + K+   LE     V     SK L++++     S  G FPD++  +  + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYL+KQ+  +   +I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD  LK+ M ++F  FD+++  W   +  IA  D LL L ++S+G D GPM RPEI  + PG+   PFL     R PC  KT  G +FI N I +G     +  +     +L+TGPNMGGKSTL+RQ  L+ +++QLGCYVPAE    LTPVDR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE
Sbjct:  564 LGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSSCLQEGLIPGSQFWDATKTLRTLLEGGYFT---GNGDSSTVLPLVLKGMTSESDSVGLTPGEESELALSALGGIVFYLKKCLIDQELLSMANFEEYFPLDSDTVS----TVKPGAVFTKASQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPSAISDRLDAVEDLMAVPDKVTEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKVSGLLE----EVAGGFTSKTLKQVVTLQSKSPKGRFPDLTAELQRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRLGCKSIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDTSLKDCMRRLFCNFDKNHKDWQSAVECIAVLDVLLCLANYSQGGD-GPMCRPEI--VLPGEDTHPFLEFKGSRHPCITKTFFGDDFIPNDILIG-CEEEAEEHGKAYCVLVTGPNMGGKSTLIRQAGLLAVMAQLGCYVPAE-KCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSKSVCVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE 1322          

HSP 2 Score: 250.751 bits (639), Expect = 1.540e-66
Identity = 138/303 (45.54%), Postives = 189/303 (62.38%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            RK++   T   K+ T     I   TK+ LS+FS   N S  +T++S    D     +  + H + E+LK E  RD  RR+PDHP+++PTTL++PE F++  TPG+++WW++K+  N + +IF+KVGKFYELYHMDAV  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+ +         G     Y       L S KE   EE   G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +
Sbjct:  312 RKSLKKETGSAKRAT----PILSETKSTLSAFSAPQN-SESQTHVSGGGNDSSGPTV--WYHETLEWLKPEKRRDEHRRRPDHPEFNPTTLYVPEEFLNSCTPGMRKWWQLKSQ-NFDLVIFYKVGKFYELYHMDAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVVRREICRIITKGTQTYSVLD---------GDPSENYSR----YLLSLKEK--EEETSG---HTRVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHY 588          
BLAST of msh6 vs. UniProt/SwissProt
Match: sp|P52701|MSH6_HUMAN (DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 333/793 (41.99%), Postives = 484/793 (61.03%), Query Frame = 3
Query: 1200 FGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFD---NIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD-KPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
             GK+  G+  D   C       F+ +     P ++++ KGNLSK T+ +  S L+ + +E      QF  +  TL  L+  +YF E  ++ +    LP  L    +E+D++G +  ++ ELA+S LG  ++YL KCLID+ L+S+A+F  Y P D D +   +        F      M++D+ TL NL++  N + G  +GTLLER+D   T FG+RLL QW+  PLC+   I +R  AI++L+ +   +S +   LK  PDLE+L++KIH +G      +HPDSRA++YE   YS++KI DF++ L  F     II I  E     V    +SK+L++++     +  G FPD++  ++ + TAFD E A+K G I P++G D+DYD+++A I+E E+ L EYLEKQ+  I    I ++G G+NR+QLEIPE+  ++ +P  Y   S +KG KRY T  IE  L  LINAE++RD+ LK+ M ++F  FD++Y  W   +  IA  D LL L ++SRG D GPM RP I  + P D  PFL +   R PC  KT  G +FI N I +G        N     +L+TGPNMGGKSTLMRQ  L+ +++Q+GCYVPAE    LTP+DR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTAT+DG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I  G +KA+ FE+
Sbjct:  565 LGKFFIGQFSDDRHCS-----RFRTLVAHYPPVQVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGA----IFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEE-----VADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGD-GPMCRPVI--LLPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIG-CEEEEQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAE-VCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVE---------NECE---DPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEK 1325          

HSP 2 Score: 252.292 bits (643), Expect = 5.759e-67
Identity = 139/312 (44.55%), Postives = 193/312 (61.86%), Query Frame = 1
Query:  391 RKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISK 1317
            RK+    TP     TK   SI+  TK  L +FS   N S  + ++S   +D  +  +  + H + E+LK+E  RD  RR+PDHPD+D +TL++PE F++  TPG+++WW+IK+  N + +I +KVGKFYELYHMDA+  VSELGL +M+GN+AHSGFPEIAF + +D LV KG+KVARVEQTET E M  R +   H S  ++VV REIC++IT GT+ +S+          EG       E+    L S KE   EE+  G   +T   GV  V+T+ GKF I QF+DD   SRFRTL++ +  ++    K
Sbjct:  312 RKSSRKETP---SATKQATSISSETKNTLRAFSAPQN-SESQAHVSGGGDDSSRPTV--WYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQ-NFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSV---------LEGDPS----ENYSKYLLSLKEK--EEDSSG---HTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEK 598          
BLAST of msh6 vs. UniProt/SwissProt
Match: sp|Q9VUM0|MSH6_DROME (Probable DNA mismatch repair protein Msh6 OS=Drosophila melanogaster OX=7227 GN=Msh6 PE=1 SV=2)

HSP 1 Score: 496.508 bits (1277), Expect = 7.959e-154
Identity = 292/760 (38.42%), Postives = 440/760 (57.89%), Query Frame = 3
Query: 1314 KGNLSKNTQHVFNSCLAATKKECFTNN-KQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYT---HQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVS--DHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFK---RYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMT--RPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIAD-SCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQ-NITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
            K  LS+ TQ +  + L    KE    N K   S+E TL +L++  Y+A   ++       P  L    ++ D+LG + +  Y+LA+  LG  ++++ KC ++  ++ +A + LY P       P QLA  D +P       +SHM++D+ TL+NL ++      G + +LL  LD   T FG+RLL  W+  P CD   I ERQ AI ELI +   L  ++  L   PD E+ +A+IH+ G +K +   DHPDSRA+L+E  LY+++K+  F+  L  F+++ K+   F         ++ LL++I    +    G FPD+S+ + +F TAFD + A K G I P++G+DA+YD ++  I E+E+ L  YL +Q++     I +FG+ K R+QL++PES  SK   +Y    Q KG K   RY T E   LLK + +AED R++VLK++  ++F KF  HY QW Q I+ +A  D L SL  ++    G  M    PE+  ++  D+PF+ + EG  PC     +  +I N ++LG+         + P+ LLTGPNMGGKSTLMR+  L++I++Q+G ++PA     L+ VDR+FTR GA D I +G ST  VE+NE +LIL + + HS +L+DELGRGTATYDG A+A S++  +A+  C  RT+FSTH+H L++       + + HMACM+E++            DN    Q  +TFLYK T G CPKSYGFNAA+LA +P+ II    + +K  E
Sbjct:  449 KSALSQRTQQIVRTVLGGILKEPVPGNGKHACSAEKTL-KLLAERYYAGPGSDD----NWPLVLRTMQSDMDHLGLTPNDNYKLALKALGQCIFFIHKCKLEPKVLPMARYQLYVP-------PDQLA--DAKPAVASTLRRSHMVLDATTLSNLRII------GEEHSLLSTLDHCCTKFGKRLLHHWLCAPSCDVSVIKERQDAIGELIRMPTELQEVRALLAPMPDFERNLAQIHLFG-NKQIKQMDHPDSRAILFEEKLYNKQKLQGFMAVLKGFNDLTKLPTMF------HQCKTTLLKRITQLPESG--GSFPDLSKELQYFATAFDHDAAAKTGVIAPQAGMDAEYDAAMDSIGEVEKRLKTYLVEQERHFGCRITYFGSDKKRYQLDVPESHASKANKSYTLEGQTKGKKPSRRYTTAETRALLKDMQHAEDTRNMVLKDLARRLFEKFSNHYDQWKQCIDCVANLDVLGSLAEYA----GQQMVICVPEL--VSDADQPFIQLEEGYHPC---ANASTYIPNGLELGTA-------SEAPLSLLTGPNMGGKSTLMREVGLLVIMAQIGAHIPA-ASCRLSLVDRIFTRLGAQDDILAGHSTFLVELNETSLILKHATCHSLVLLDELGRGTATYDGTAIAASVVNFLANLKC--RTLFSTHYHNLIDFFHNDKRITLGHMACMVENE------------DNADPTQETVTFLYKYTAGACPKSYGFNAAKLAGMPQGIIKRAYELSKKVE 1148          

HSP 2 Score: 218.394 bits (555), Expect = 2.193e-56
Identity = 162/484 (33.47%), Postives = 250/484 (51.65%), Query Frame = 1
Query:   55 SILSFFPKTPS-SKNKQTDILNIETANSKSK----VNKTDKIK-FKDNDSMPSTDNK--DSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRK------NVNASTPHKKKPTKDEKSIN--------------DSTKALLSSFSINANDSNIETNISQVIEDDFKNDIES----------YEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKH-ESSK-NKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISR-----FNLMKSFISKEIYQKILSMFLILVLLQP 1371
            ++L++F K+P+  K K T  +  +   SKS+     N+  K+K  K   S P+   K   SDD   + ++  KR+  +  + +S+ E  +  S +       +YE      +++   SG  +      +++  +P  KK  K  K +N              +ST  L    +      N+++N  Q   D   +DI +          + H   EFL+ + I+D + R+PDHPDYD +TL +PE F++ L+PG++QWW +K++ N + ++FFKVGKFYELYHMDA   V+ELG TYMRG +AHSGFPEI+F KM+  LV +GFKVARVEQTET + MTER K  +++K +KVV REICQ+   GT+ F  + +       + +  L  +E   G    +                   GV  ++T+ G F + +F DD   SR  TL+S      F   KS +S+   Q+I+   L  +L +P
Sbjct:   16 TLLNYFSKSPAFDKKKLTPSVKTDPDASKSEKENLQNQQPKVKDGKKEASKPAAKRKLPISDDEPASGQRKRKRI--VQPESDSEPEMEVTKSEDDFSDCASDYEPDENEASDDSVSSGAEEVSPSENDMSVDSPTPKKSRKKSKILNNNNNNEPSSKKVKLESTIQLAEGATFQEKLKNLQSNAKQ---DASYDDIVTNTSNLDEPVVWPHQKLEFLQPDKIKDKEGRRPDHPDYDKSTLHVPEKFLNGLSPGVRQWWVLKSD-NYDCVLFFKVGKFYELYHMDADVGVNELGFTYMRGEFAHSGFPEISFDKMSTILVDRGFKVARVEQTETPDMMTERCKRIKATKFDKVVAREICQITNRGTQVFGSQCKI--GPNHQPNYMLAIVEKDEGTCSRY-------------------GVCFIDTSIGDFHLGEFEDDKNCSRLLTLVSHHMPVLFLNEKSALSQRT-QQIVRTVLGGILKEP 471          
BLAST of msh6 vs. UniProt/SwissProt
Match: sp|O74502|MSH6_SCHPO (DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh6 PE=1 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 3.020e-121
Identity = 231/763 (30.28%), Postives = 362/763 (47.44%), Query Frame = 3
Query: 1287 VQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNN-KQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVE--QNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEET 3563
            V+P E+I  K  +S+ +      C++++    F     +F  +E     +++ DYF              NGL      A  + +S   E  LA+S  GAL +YL +  +DK + S+ +F+ Y  S                      + ++++  TL NL++  NS  GG +GTL   L   +T FG+RL   W+  PL     I  R   ++ + +       I   L   PDLE+L++++H                         R K  DFV  L  F    +I   F ++  E  +  +  LL +I        I   P++ E +  +  AF+ + A + G   PE G +A+YD S     E++ +L   LE+ KK +  S++NF   GK  +Q+E+P     KVP  +   S  K   RY   E+   +KKL+ AE+    ++  +  K + +FD +Y QW  +I   A  D   SL+  +  L G P  RPEI     G    L   E R PC   + +  F+ N + LG    N        +++LTGPNM GKSTL+RQ  + +I++QLGC+VPA+   I TP+  ++TR GAND I S +ST  VE++E   IL    P S +++DELGRGT+TYDG A+A+++L  +  +      FSTH+  L  +      +++  MA  +++                 K++ +TFLYKL  G CPKSYG N A +A +PE++I    +KA   E+ +
Sbjct:  552 VRPKELILEKSKISQKSIRAIKYCVSSSSIWNFIKPYTEFWDNERVEREIIAGDYFK-------------NGLEG----APKILKSYLSEKPLAISAFGALFWYLRQLKLDKDMCSMGNFDEYDASQ-------------------QSTSLLMNGQTLKNLEIFSNSFDGGSEGTLFHLLCRCVTPFGKRLFHTWLCHPLRSGTAINARLDVVELIADNPVIRDTIWGFLHKLPDLERLISRVHA-----------------------GRSKPADFVRVLEGFQ---RINSAFDQLREEFMEVAEGTLLGEI--------IQSAPNMKEELEAWTRAFNWQKASEEGVFEPEIGFEAEYDTSQKYQSELKNELYALLEQYKKQLRCSSLNFKNIGKEVYQVEVPSD--VKVPVNWCKMSGTKKTNRYYNDELRKKIKKLLEAEELHLAIMSRMQEKFYIRFDSNYEQWLALIKYTASIDCFFSLSQAAAAL-GEPYCRPEIIEQKDG---HLYFEELRHPCINASAASTFVPNDVVLGGESPN--------MIVLTGPNMAGKSTLLRQVCIAVIMAQLGCWVPAKRASI-TPMTSIYTRLGANDDIMSARSTFMVELSETKKILDECGPKSLVILDELGRGTSTYDGHAIAYAVLHHLVSNIGCLGFFSTHYQSLCVDFMHHRQVRLMQMAAAVDE-----------------KIRRVTFLYKLEDGICPKSYGMNVASMAGLPEKVIDAAEEKASELEQAS 1212          

HSP 2 Score: 128.257 bits (321), Expect = 3.020e-121
Identity = 111/365 (30.41%), Postives = 180/365 (49.32%), Query Frame = 1
Query:  250 RLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTE--NEFLSGIRKN-VNASTPHKKKPTKDE------KSINDSTKALLSSFSINANDSNIETNISQVI--EDDFKNDIESYE---HFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTA--VSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISR 1287
            R K +  DDESD      +     I    +  S P+ + E  +E + G   + V+ + P  KK ++ E      +S    ++    S S++ + S  ++N + V+  E+  +  +E+++   +  YE+L   ++RDA + +   P+YDP TL+IP S  +   P  KQ+WKIK +  M+T++FF+ GKFYELY  DA     V  L LT  R N    G PE +F   A Q + KG+++ARV+Q ET  A+ + IK       + KVV R + QV+T GT                  +E     D      + KESL  +N         + G+  ++T+TG F + +F DD  R++  TL+++
Sbjct:  220 RHKRIVSDDESDD-----YVEPDHISEASSEASLPIDEVESMDEDVDGYSDHSVSVAAPIPKKESRKESSNSLYESYRLGSQIASPSPSVSGSASPTKSNKNGVLNREEKRRQRMEAFKKENNERYEWLL--DVRDADQNRVGDPNYDPRTLYIPPSAWATFKPFEKQFWKIKKD-LMDTVVFFQKGKFYELYENDAAIGHQVFSLKLT-DRVNMKMVGIPEASFDYWASQFIAKGYRIARVDQLET--ALGKEIKDRQRTQKEEKVVQRGLTQVLTSGTL----------------VDEAMLTSDLSTYCMAIKESLQSDN------EEPSFGICFIDTSTGGFHMCEFTDDIHRTKLDTLLTQ 551          
BLAST of msh6 vs. TrEMBL
Match: F8U1P2 (Msh6 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=msh6 PE=2 SV=1)

HSP 1 Score: 1542.71 bits (3993), Expect = 0.000e+0
Identity = 763/766 (99.61%), Postives = 763/766 (99.61%), Query Frame = 3
Query: 1290 QPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSN--INFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFR 3581
            QPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAE PANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSN  INFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEDDNDDDVGNNECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFR
Sbjct:  409 QPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAEAPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNVLINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEDDNDDDVGNNECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFR 1174          

HSP 2 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 402/420 (95.71%), Postives = 402/420 (95.71%), Query Frame = 1
Query:   46 MQKSILSFFPKTPSSKNKQTDILNIETANSKSKVNKTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFM-----SKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            MQKSILSFFPKTPSSKNKQTDILNIETANSKSKVNKTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFM     SKLTPGLKQWWKIKANGNMETI FFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQL   GFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVAL         IAQFADDDQRSRFRTLISRF
Sbjct:    1 MQKSILSFFPKTPSSKNKQTDILNIETANSKSKVNKTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMMSLIQSKLTPGLKQWWKIKANGNMETIFFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQL---GFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVAL---------IAQFADDDQRSRFRTLISRF 408          
BLAST of msh6 vs. TrEMBL
Match: A0A1S3Q6C7 (DNA mismatch repair protein OS=Salmo salar OX=8030 GN=msh6 PE=3 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 336/782 (42.97%), Postives = 491/782 (62.79%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAET------PANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD----KPFLIITEGRFPCKAKTQSGE-FISNTIKLGSLLMNSNRNLDN---PVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            P ++++ KGN S  T+ +F + L++  +E  T   QF  ++ TL  L   DYF E+      P + +    LP+ L    +++D+LG +  + YELA+S LG  ++YL KCL+D+ L+S+ +F  Y P D +     + A      F   +  M++D  TL NL++L+N S GG +GTLLERLD   T FG+RLL QW+ +PLC+P  I ER  A+++L+ + A  + + + LK  PDLE+L++KIH +G  K   DHPDSRAVLYE + YS++KI DF++ L  F  + +I        V  + QS+LLR+++    D + G FPD+S  +  + TAFD + A+  G I P++G D ++D++++ IK  ERDL +YL++QKK +   N+ ++GTG+NRFQ+E+P+S   + +P  Y   S +KG+KRY T EIE L  +L + E+KRD  LK+ M ++F  FD++Y  W   +  +A  D LLSLT +S+G DGGPM RP++  + PGD      FL +   R PC  KT  G+ FI N I +G          DN   P +L+TGPNMGGKSTLMRQ  L+++L+QLGCYVPAE  +  TPVDR+FTR GA+D I +G+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++  +A+    RT+FSTH+H L+E+      +++ HMACM+E++            D +   + ITFLYK   G CPKSYGFNAARLAN+PE +I +G +KAK FE  T+ +   K L
Sbjct:  607 PAQVLFEKGNPSAETRKIFKASLSSAMQEGLTAGSQFWDAQKTLKTLAEEDYFKESVGKDEEPGSSV----LPSVLKSMTSKSDSLGLTPKEGYELALSALGGCMFYLKKCLVDQELLSMTNFQEYVPVDVEM----EKAAGPTSFFSQTRQRMVLDGVTLANLEILQNVS-GGTEGTLLERLDTCSTPFGKRLLKQWLCSPLCNPTSIGERLDALEDLMGVQAQATEVSDLLKKLPDLERLLSKIHSIGTPKG-QDHPDSRAVLYEEVTYSKKKIADFLSALEGFKTMQEIVTILG--PVAGDFQSRLLRQVVNLKDDGQEGLFPDLSAELKRWDTAFDHQKARATGVITPKAGFDPEFDQALSGIKACERDLQDYLDRQKKRLGCRNLTYWGTGRNRFQMEVPDSVSERNIPEEYKVKSTKKGWKRYWTREIERLFSELQSFEEKRDAALKDCMRRLFYNFDKNYRDWQTGVECMAVLDVLLSLTRYSQGGDGGPMARPQV--LLPGDISQSAAFLDLRGSRHPCVTKTFFGDDFIPNDIAIGCPGSEEGGQEDNGHAPCVLVTGPNMGGKSTLMRQCGLVVVLAQLGCYVPAES-LSFTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHGTKHSLVLLDELGRGTATYDGTAIASAVVNELAERICCRTLFSTHYHSLVEDYTNNPAVRLGHMACMVENEG-----------DEDPSQETITFLYKFITGACPKSYGFNAARLANLPEDVIQSGHRKAKEFERSTISLRVFKKL 1362          

HSP 2 Score: 223.787 bits (569), Expect = 0.000e+0
Identity = 124/308 (40.26%), Postives = 186/308 (60.39%), Query Frame = 1
Query:  403 NASTPHKKKPTKDE--------KSINDSTKALLSSFSINANDS-NIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            +++ P  K PT  E         +I  +TK+ LS+FS  A +S + + N S       +     ++H   ++L++   +DA+RR+    DYDPTTL++PE F++K TPG+++WW++K+    + ++FFKVGKFYELYHMDAV  V+ELGLT+M+G++AHSGFPEI F + +D LV +G+KVARVEQTET + M  R K     +  ++VV RE+C++IT GT+ +S+ +    ET  +              L S KE   EE   G+ +     GV+ V+T+ G F + QF DD   SR RTL+S +
Sbjct:  321 SSAKPKPKTPTLPETAKRAPLSSTITANTKSRLSAFS--APESFDSQANGSGACG---QGGATVWDHEKLDWLQEGRRKDAKRRRQSEEDYDPTTLYVPEDFLNKTTPGMRRWWQLKSE-TFDAVLFFKVGKFYELYHMDAVIGVNELGLTFMKGSWAHSGFPEIGFGRFSDGLVQRGYKVARVEQTETPDMMEARCKTMLKPTKFDRVVQREVCRIITRGTQTYSVLDGAPSETHSK-------------YLLSIKEK-AEEESSGRCR---TYGVSFVDTSVGYFHVGQFQDDRHCSRLRTLLSHY 605          
BLAST of msh6 vs. TrEMBL
Match: A0A444UGZ1 (DNA mismatch repair protein OS=Acipenser ruthenus OX=7906 GN=EOD39_0145 PE=3 SV=1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 350/802 (43.64%), Postives = 497/802 (61.97%), Query Frame = 3
Query: 1203 GKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAET-PANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRM--HVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINS-NINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            GK+  G+  D   C       F+ +     P ++++ KGNLS  T+ +  + LA+  +E   +  QF  +  TL  L    YF E+   N  ++  LP  L +  +++D+LG +  + YELA+S LGA ++YL KCL+D+ L+S+++F  Y P D +  +    A      F   +  M++D  TL+NL++L+N S G  +GTLLERLD   T FG+RLL QW+  PLC+P  I +R  A ++L+ L   LS  +  LK  PDLE+L++KIH LG +    DHPDSRA+LYE + YS+RKI DF++ L  F    KI LE T +     +N +SKLL++I+    +S  G FPD+S  +  ++TAFD + A+  G I P++G D ++D++++ I+  +R L EYLEKQ+K + S +I ++G GKNR+Q+EIPES   + VP  Y   S RKG+KRY T EIE L  +L+ +E+KRD  LK+ M ++F  FD +Y  W   +  IA  D L+ L ++S+G D GPM RPE+     G  PFL +   R PC  KT  G +FI N + +G     S        +L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPAE    LTPVDR+FTR GA+D I +G+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++K +A++   RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLANIPE++I  G KKAK FE  T+ +   K L
Sbjct:  626 GKFHVGQFQDDRHCS-----RFRTLVAHYAPAQLLFEKGNLSGETRKILKASLASVIQEGLQSESQFWDASKTLKVLAEEGYFKESNKKNGDAQDALPAVLKRMTSDSDSLGFTPGEGYELALSALGACVFYLKKCLVDQELLSMSNFEEYVPVDMEMGK----AKGSSSFFARTRQRMVLDGVTLSNLEILQNGSTGTAEGTLLERLDSCCTPFGKRLLKQWLCAPLCNPSSIDDRLHAAEDLMALPDKLSETRELLKKLPDLERLLSKIHSLGSTLKSQDHPDSRAILYEEVTYSKRKIADFLSALEGF----KIMLEVTSIIQPAVENFRSKLLKQIVSLRDESNEGLFPDLSAELKRWETAFDHQKARSTGVITPKAGFDPEFDQALSEIEGTQRSLQEYLEKQRKRLGSKSIVYWGIGKNRYQMEIPESVTERHVPKEYEVKSTRKGYKRYWTREIERLFGELVTSEEKRDGALKDCMRRLFYNFDNNYKDWQTAVECIAVLDVLICLANYSQGGD-GPMCRPEVVLPVDGAVPFLELRGSRHPCITKTFFGDDFIPNDVFIGCSGEESESQAS--CVLVTGPNMGGKSTLMRQCGLMVILAQLGCYVPAES-FRLTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHGTSHSLVLLDELGRGTATYDGTAIASAVVKELAENIQCRTLFSTHYHSLVEDYSHCTAVRLGHMACMVE---------NEC---EDPSQETITFLYKFITGACPKSYGFNAARLANIPEEVIQTGHKKAKEFERITVSLRVFKEL 1398          

HSP 2 Score: 195.667 bits (496), Expect = 1.003e-46
Identity = 105/244 (43.03%), Postives = 152/244 (62.30%), Query Frame = 1
Query:  568 YEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNK---VVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            ++H   ++L+    RD++RRK   PDYDPTTL++ E F++K TPG+++WW++K+    + ++F+KVGKFYELYHMDAV  V+E+ L +M+G++AHSGFPEI F + +D LV KG+KVARVEQ ET + M  R K  +   K   VV RE+C+VIT GT+ +S+ +    E+  +              L   KE   EE+           GV  V+T+ GKF + QF DD   SRFRTL++ +
Sbjct:  424 WDHEKLDWLQDGRRRDSKRRKQTDPDYDPTTLYVSEDFLNKCTPGMRRWWQLKSE-MFDAVLFYKVGKFYELYHMDAVIGVTEMALVFMKGSWAHSGFPEIGFGRYSDVLVQKGYKVARVEQLETPDMMEARCKTMACPTKFDRVVRREVCRVITKGTQTYSVLDGASSESHSK-------------YLLCVKEKADEESSGCHR----TYGVGFVDTSVGKFHVGQFQDDRHCSRFRTLVAHY 649          
BLAST of msh6 vs. TrEMBL
Match: A0A060XRR2 (DNA mismatch repair protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00010330001 PE=3 SV=1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 336/779 (43.13%), Postives = 489/779 (62.77%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFG---LPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD----KPFLIITEGRFPCKAKTQSGE-FISNTIKLGSLLMNSNRNLDN---PVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            P ++++ KGN S  T+ +F + L++  +E  T   QF  ++ TL  L   DYF E+   K    G   LP+ L    +E+D+LG +  + YELA+S LG  ++YL KCL+D+ L+S+ +F  Y P D +     + A      F   +  M++D  TL NL++L+N S GG +GTLLERLD   T FG+RLL QW+ +PLC+P  I ER  A+++L+ + A  + + + LK  PDLE+L++KIH +G  K   DHPDSRAVLYE + YS++KI DF++ L  F  + +I      + V  + +S+LLR+++    D + G FPD+S  +  + TAFD + A+  G I P++G D ++D++++ IK  ERDL +YL++QKK +   N+ ++GTG+NRFQ+E+P+S   + +P  Y   S +KG+KRY T EIE L  +L + E+KRD  LK+ M ++F  FD++Y  W   +  +A  D LLSLT +S+G DGGPM RP++  + PGD      FL +   R PC  KT  G+ FI N I +G          D    P +L+TGPNMGGKSTLMRQ  L+++L+QLGCYVPAE  +  TPVDR+FTR GA+D I +G+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++  +A     RT+FSTH+H L+E+      +++ HMACM+E++            D +   + ITFLYK   G CPKSYGFNAARLAN+PE +I +G +KAK FE  T+ +   K L
Sbjct:  609 PAQVLFEKGNPSAETRKIFKASLSSAMQEGLTAGSQFWDAQKTLKTLAEEDYFKES-VRKDEESGSSVLPSVLKSMTSESDSLGLTPKEGYELALSALGGCMFYLKKCLVDQELLSMTNFQEYIPVDVE----MEKAAGPTSFFSQTRQRMVLDGVTLANLEILQNVS-GGTEGTLLERLDTCSTPFGKRLLKQWLCSPLCNPTSIGERLDALEDLMGVQAQATEVSDLLKKLPDLERLLSKIHSIGTPKG-QDHPDSRAVLYEEVTYSKKKIVDFLSALEGFKTMQEIVTILGPVAV--DFRSRLLRQVVNLKDDGQEGLFPDLSAELKRWDTAFDHQKARATGVITPKTGFDPEFDQALSGIKACERDLQDYLDRQKKRLGCRNLTYWGTGRNRFQMEVPDSVSERNIPEEYKVKSTKKGWKRYWTREIERLFSELQSLEEKRDAALKDCMRRLFYNFDKNYRDWQTGVECMAVLDVLLSLTRYSQGGDGGPMARPQV--LLPGDISQSAAFLDLRGSRHPCVTKTFFGDDFIPNDIAIGCPGGEEEGQEDKGHAPCVLVTGPNMGGKSTLMRQCGLVVVLAQLGCYVPAES-LSFTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHGTKHSLVLLDELGRGTATYDGTAIASAVVNELAKRICCRTLFSTHYHSLVEDYTNNPAVRLGHMACMVENEG-----------DEDPSQETITFLYKFIAGACPKSYGFNAARLANLPEDVIQSGHRKAKEFERSTISLRVFKKL 1364          

HSP 2 Score: 220.705 bits (561), Expect = 0.000e+0
Identity = 123/317 (38.80%), Postives = 184/317 (58.04%), Query Frame = 1
Query:  403 NASTPHKKKPTKDE--------KSINDSTKALLSSFSINAN-DSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISK 1317
            +++ P  K PT  E         +I   TK+ LS+FS   + DS    + +       +     ++H   ++L++   +DA+RR+    DYDPTTL++PE F++K TPG+++WW++K+    + ++FFKVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEI F + +D LV +G+KVARVEQTET + M  R K     +  ++VV RE+C++IT GT+ +S+ +    ET  +              L S KE   EE   G+ +     GV+ V+T+ G F + QF DD   SR RTL+S +   +    K
Sbjct:  323 SSAKPKPKTPTLPETAKRAPLSSTITADTKSRLSAFSAPESFDSQANGSGAGG-----QGGATVWDHEKLDWLQEGRRKDAKRRRQSEEDYDPTTLYVPEDFLNKTTPGMRRWWQLKSE-TFDAVLFFKVGKFYELYHMDAVIGVNELGLTFMKGAWAHSGFPEIGFGRFSDGLVQRGYKVARVEQTETPDMMEARCKTMLKPTKFDRVVQREVCRIITRGTQTYSVLDGAPSETHSK-------------YLLSIKEK-AEEESSGRCR---TYGVSFVDTSVGYFYVGQFQDDRHCSRLRTLLSHYTPAQVLFEK 616          
BLAST of msh6 vs. TrEMBL
Match: A0A5A9P8P1 (DNA mismatch repair protein OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti017289 PE=3 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 337/778 (43.32%), Postives = 486/778 (62.47%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGD----KPFLIITEGRFPCKAKTQSG-EFISNTIKLGSLLMNSNRNLDN-----PVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            P ++++ KGN S  T  +F + L++  +E      QF  ++ TL      DYF ET +N +    LP  L    +E+D+LG +  K YELA+S LG  ++YL KCL+D+ LVS+ +F  Y P D +  Q    A      F   +  M++D  TL NL++L+NSS GG +GTLLERL+   T FG+RLL QW+  PLC+P  I +R  A+++L+   +  + + + LK  PDLE+L++KIH +G      DHPD+RA+LYE L+YS+RKI DF+  L  F   +  ++      V +  +SKLLR+++L   + K G FPD+   +  + TAFD + A+  G I P+SG D +YD+++  IK+ E++L  +L++QKK +    ++++GTG+NR+QLE+P+S   K +P  Y   S +KG+KRY T +IE L   L + EDKRD  LK+ M ++F  FD++Y  W   +  +A  D LLS++ +S+  D GPM RPE+  + PGD     PFL +   R PC  KT  G +FI N I +G    +     DN     P +L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPA+  + LTPVDR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++K +++    RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLANIPE++I +G KKA+ FE  T+ +   K L
Sbjct:  591 PAQVLFEKGNPSAETLKIFKATLSSALQEGLNAGSQFWDAQKTLKVFAEEDYFKETASNNVGGSVLPPTLKSMTSESDSLGLTPKKGYELALSALGGCIFYLKKCLVDQELVSMGNFEDYVPVDVEMEQ----AGGSSCFFAKTRQRMVLDGVTLANLEILQNSSNGGPEGTLLERLETCCTPFGKRLLKQWLCAPLCNPSSIADRLDALEDLMGAPSQSTEVTDLLKKLPDLERLLSKIHSMGTPLKGQDHPDTRAILYEELVYSKRKIADFLAALEGF--TVMKEVVSVMDPVAEGFRSKLLRQVVLLKTEHKDGLFPDLDPELKRWDTAFDHQKARTTGVITPKSGFDPEYDQALTGIKDCEKELQAFLDRQKKRLGCKTLSYWGTGRNRYQLEVPDSISEKSIPMEYEVRSTKKGWKRYSTKDIERLFSDLQSWEDKRDAALKDCMRRLFYNFDKNYKDWQTAVECMAVLDVLLSMSRYSQSGD-GPMVRPEM--VLPGDGCQPSPFLDLRGSRHPCVTKTFFGDDFIPNDIFIGCPGDSEEEGQDNMKANAPCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPADS-LRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILLHATNHSLVLLDELGRGTATYDGTAIASAVVKELSEKICCRTLFSTHYHSLVEDHTQNPAVRLGHMACMVE---------NECE---DPSQETITFLYKFIGGACPKSYGFNAARLANIPEEVIQSGHKKAREFERSTVSLRLFKKL 1346          

HSP 2 Score: 221.09 bits (562), Expect = 0.000e+0
Identity = 127/312 (40.71%), Postives = 187/312 (59.94%), Query Frame = 1
Query:  394 KNVNASTPHKKKPTKDE-KSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIK---HESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISK 1317
            K+  + TP K  P K    S+    K+ LS+FS  A D N E++ +  ++         ++H   E+L+    +DA+RR+    +YDP TL++PE FM+K TPG+++WW++K+    +T++F+KVGKFYELYHMDAV  V+E+GLT+MRGN+AHSGFPEI F + +D LV KG+KVARVEQTET + M  R K     +  ++VVNRE+C++IT GT+ +S+ +      G     +  Y       L S KE   EE+  G+       GV  V+T+ G F + QF DD   SR RTL++ ++  +    K
Sbjct:  313 KSSPSDTP-KPAPVKPATPSLGSDNKSRLSAFS--APD-NFESSGTGGLD----GGSTVWDHEKLEWLQDGKRKDARRRRQSDENYDPATLYVPEDFMNKTTPGMRRWWQLKSE-MFDTVLFYKVGKFYELYHMDAVIGVNEMGLTFMRGNWAHSGFPEIGFGRFSDVLVQKGYKVARVEQTETPDMMEARCKAITRPTKFDRVVNREVCRIITRGTQTYSVLD------GAPSGTQSKY-------LLSIKEK-SEEDSAGQGH---VYGVCFVDTSVGHFHVGQFQDDRHCSRLRTLVAHYSPAQVLFEK 598          
BLAST of msh6 vs. Ensembl Cavefish
Match: msh6 (mutS homolog 6 [Source:NCBI gene;Acc:103027666])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 346/823 (42.04%), Postives = 505/823 (61.36%), Query Frame = 3
Query: 1164 GQIKKYCQHWSRFGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFG--LPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMH-VEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEI--RHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLG------SLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            G I   C   +  G++  G+ +D   C        + +     P ++++ K NLS  T+ +F + +++  +E      QF  ++ TL  L   DYF E   N+    G  LP  L    +++D+LG +  + YELA+S LG  ++YL KCL+D+ L+S+A+F  Y P D +  Q    A      F   +  M++D  TLTNL++L+NSS GG +GTLLERLD   T FG+RLL QW+  PLC+P  I +R  AI++L+   A  +     LK  PDLE+L++KIH +G      +HPD RAVLYE L+YS+RKI DF++ L  F  + +I    + M  V +  QSKLLR+++L     + G FPD++  ++ + TAFD + A+  G I P+SG D ++D++V+ IK+ ER L +YL++QKK +    ++++GTG+NR+Q+E+P+S   + VP  Y   S +KG+KRY T EIE L  +L + E+KRD  LK+ M ++F  FD++Y  W   +  +A  D LLSL+ +S+  D GPM RPE+      P   PFL +   R PC  KT  G +FI N I +G          ++N+ L + V L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPA+  + LTPVDR+FTR GA+D I SG+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++K +++    RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK  +G CPKSYGFNAARLA+IPE++I +G  KA+ FE  T+ +   K L
Sbjct:  454 GHIYGVCFIDTSVGRFHVGQFHDDRHCS-----RLRTLVAHYAPAQVVFEKSNLSLETRKIFKAIVSSAMQEALNAGTQFWDAQKTLKTLAEEDYFKEI-ENEGGNAGSTLPTVLKAMTSDSDSLGLTPKEGYELALSALGGCMFYLKKCLVDQELLSMANFEEYVPVDVEMEQ----AEGASGFFARTRQRMVLDGVTLTNLEILQNSSTGGTEGTLLERLDTCCTPFGKRLLKQWLCAPLCNPTSIKDRLNAIEDLMGAPAQATEATELLKKLPDLERLLSKIHSMGTPLKGQNHPDCRAVLYEELVYSKRKIADFLSALEGFKAMQEI---VSLMESVSEGFQSKLLRQVVLLKTKCEDGLFPDLTPELNRWDTAFDHQKARTTGVITPKSGFDPEFDQAVSGIKDSERGLQDYLDRQKKRLGCRTLSYWGTGRNRYQMEVPDSVSERNVPEEYEVRSTKKGWKRYSTKEIERLFSELQSWEEKRDAALKDCMRRLFYNFDKNYRDWQTAVECMAVLDVLLSLSRYSQSAD-GPMARPEVVLPESGPQSSPFLDLRGSRHPCVTKTFFGDDFIPNDIFIGCPGTEEEEGEDTNKALASCV-LVTGPNMGGKSTLMRQCGLVVILAQLGCYVPADS-LCLTPVDRVFTRLGASDRIMSGESTFFVELSETASILLHGTNHSLVLLDELGRGTATYDGTAIASAVVKELSEKIHCRTLFSTHYHSLVEDYAQDPAVKLGHMACMVE---------NECE---DPSQETITFLYKFINGACPKSYGFNAARLASIPEEVIQSGHHKAREFERNTVALRIFKKL 1248          

HSP 2 Score: 201.83 bits (512), Expect = 4.266e-52
Identity = 128/326 (39.26%), Postives = 190/326 (58.28%), Query Frame = 1
Query:  409 STPHKKKPTKDEKSIND---STKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNK---VVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENV-KGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMK--------SFISKEIYQKILS 1341
            STP  + P +   S+N     TKA LS+FS   N  +  T  S  +E         ++H   ++L+    +DA+RR+    DYDPTTL++PE F +++TPG+++WW++K+    + ++F+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEI FS+ +D LV KG+KVARVEQTET E M  R K  +   K   VV RE+C+VIT GT+ +S+ +    E   +              L + KE   EE+   G +      GV  ++T+ G+F + QF DD   SR RTL++ +   +        S  +++I++ I+S
Sbjct:  215 STP-SETPKRAPASLNSVAVDTKARLSAFSAPENFESQGTAGSGGVEGH-----GVWDHEKLDWLQDGKRKDARRRRQSDEDYDPTTLYVPEEFSNRVTPGMRRWWQLKSE-MFDAVLFYKVGKFYELYHMDAVIGVNELGLTFMKGTWAHSGFPEIGFSRFSDVLVQKGYKVARVEQTETPEMMEARCKTMARPTKFDRVVRREVCRVITRGTQTYSVLDGAPSEVQSK-------------YLLAVKEKNEEESAGHGHI-----YGVCFIDTSVGRFHVGQFHDDRHCSRLRTLVAHYAPAQVVFEKSNLSLETRKIFKAIVS 515          
BLAST of msh6 vs. Ensembl Cavefish
Match: msh6 (mutS homolog 6 [Source:NCBI gene;Acc:103027666])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 331/823 (40.22%), Postives = 483/823 (58.69%), Query Frame = 3
Query: 1164 GQIKKYCQHWSRFGKY*YGEIYDCTICR**SKVTFQDIDFSVQPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFG--LPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMH-VEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEI--RHINPGDKPFLIITEGRFPCKAKTQSG-EFISNTIKLG------SLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            G I   C   +  G++  G+ +D   C        + +     P ++++ K NLS  T+ +F + +++  +E      QF  ++ TL  L   DYF E   N+    G  LP  L    +++D+LG +  + YELA+S LG  ++YL KCL+D+ L+S+A+F  Y P D +  Q    A      F   +  M++D  TLTNL++L+NSS GG +GTLLERLD   T FG+RLL QW+  PLC+P  I +R  AI++L+   A  +     LK  PDLE+L++KIH +G      +HPD RAVLYE L+YS+RKI DF++ L  F  + +I    + M  V +  QSKLLR+++L     + G FPD++  ++ + TAFD + A+  G I P+SG D ++D++V+ IK+ ER L +YL++QKK +    ++++GTG+NR+Q+E+P+S   + VP  Y   S +KG+KRY T EIE L  +L + E+KRD  LK+ M ++F  FD++Y  W   +  +A  D LLSL+ +S+  D GPM RPE+      P   PFL +   R PC  KT  G +FI N I +G          ++N+ L + V L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPA+  + LTPVDR+FTR GA+D I S                              GRGTATYDG A+A +++K +++    RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK  +G CPKSYGFNAARLA+IPE++I +G  KA+ FE  T+ +   K L
Sbjct:  556 GHIYGVCFIDTSVGRFHVGQFHDDRHCS-----RLRTLVAHYAPAQVVFEKSNLSLETRKIFKAIVSSAMQEALNAGTQFWDAQKTLKTLAEEDYFKEI-ENEGGNAGSTLPTVLKAMTSDSDSLGLTPKEGYELALSALGGCMFYLKKCLVDQELLSMANFEEYVPVDVEMEQ----AEGASGFFARTRQRMVLDGVTLTNLEILQNSSTGGTEGTLLERLDTCCTPFGKRLLKQWLCAPLCNPTSIKDRLNAIEDLMGAPAQATEATELLKKLPDLERLLSKIHSMGTPLKGQNHPDCRAVLYEELVYSKRKIADFLSALEGFKAMQEI---VSLMESVSEGFQSKLLRQVVLLKTKCEDGLFPDLTPELNRWDTAFDHQKARTTGVITPKSGFDPEFDQAVSGIKDSERGLQDYLDRQKKRLGCRTLSYWGTGRNRYQMEVPDSVSERNVPEEYEVRSTKKGWKRYSTKEIERLFSELQSWEEKRDAALKDCMRRLFYNFDKNYRDWQTAVECMAVLDVLLSLSRYSQSAD-GPMARPEVVLPESGPQSSPFLDLRGSRHPCVTKTFFGDDFIPNDIFIGCPGTEEEEGEDTNKALASCV-LVTGPNMGGKSTLMRQCGLVVILAQLGCYVPADS-LCLTPVDRVFTRLGASDRIMS------------------------------GRGTATYDGTAIASAVVKELSEKIHCRTLFSTHYHSLVEDYAQDPAVKLGHMACMVE---------NECE---DPSQETITFLYKFINGACPKSYGFNAARLASIPEEVIQSGHHKAREFERNTVALRIFKKL 1320          

HSP 2 Score: 201.83 bits (512), Expect = 4.015e-52
Identity = 128/326 (39.26%), Postives = 190/326 (58.28%), Query Frame = 1
Query:  409 STPHKKKPTKDEKSIND---STKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNK---VVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENV-KGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMK--------SFISKEIYQKILS 1341
            STP  + P +   S+N     TKA LS+FS   N  +  T  S  +E         ++H   ++L+    +DA+RR+    DYDPTTL++PE F +++TPG+++WW++K+    + ++F+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEI FS+ +D LV KG+KVARVEQTET E M  R K  +   K   VV RE+C+VIT GT+ +S+ +    E   +              L + KE   EE+   G +      GV  ++T+ G+F + QF DD   SR RTL++ +   +        S  +++I++ I+S
Sbjct:  317 STP-SETPKRAPASLNSVAVDTKARLSAFSAPENFESQGTAGSGGVEGH-----GVWDHEKLDWLQDGKRKDARRRRQSDEDYDPTTLYVPEEFSNRVTPGMRRWWQLKSE-MFDAVLFYKVGKFYELYHMDAVIGVNELGLTFMKGTWAHSGFPEIGFSRFSDVLVQKGYKVARVEQTETPEMMEARCKTMARPTKFDRVVRREVCRVITRGTQTYSVLDGAPSEVQSK-------------YLLAVKEKNEEESAGHGHI-----YGVCFIDTSVGRFHVGQFHDDRHCSRLRTLVAHYAPAQVVFEKSNLSLETRKIFKAIVS 617          
BLAST of msh6 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 231.491 bits (589), Expect = 9.722e-62
Identity = 197/693 (28.43%), Postives = 331/693 (47.76%), Query Frame = 3
Query: 1563 AVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDI-SEIISFFKTAFDQENAKKNGKIIPESGIDADY---DESVALIKEIERDLAEYLEKQKKII-NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKI--FAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEI----RHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDG 3596
             + CLG ++ YL +  +++ L+  + F     SD D                    HM++ + T+ NL++  N + G + G+LL  LD + T FG+RLL +W++ PL    +I+ RQ+A+ E++  +++ L +I+  L   PDLE+ +  I                        Y ++  T     L++   + ++ +EF      Q +   +  +I      S + + P + S   +F K     ENA K G          D+   ++    I+ I  D+ E+  + + I+ N ++N+       F +E+  S  S VP  ++  +  K   RY +  I    + L+   ++  LV+ +    I     F EHY+   + +  +A  D   SL   ++  +     RPE+    RHI        +I +GR P       +  +++ N  +L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA    I   VD +FTR GA+D+I  G+ST   E+ EA+ ILS+ +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E EK    ++   HMA ++ +             +  ++ + ITFLY+LT G   +SYG N ARLANIPE I+     K+K  E E +I   R+ + G
Sbjct:  483 VICCLGPVIQYLTEFKLERVLLCPSSFRRLL-SDSD--------------------HMVLSATTMKNLEIFCNQTTGSVKGSLLWVLDHTHTPFGKRLLKKWVSQPLKSASEILSRQEAVAEILSSESSVLPSIQALLNRLPDLERGLCSI------------------------YHKKCSTQEFYLLSS--TLSRLGIEF------QALIPAVQSQISSALLKSLLLDTPQLLSPAHNFLKVL--NENAAKTGNKTELFADLTDFPVIEQRKDQIQNILSDIMEHRRELRLILRNPSLNYATVSGQEFLIEVKNSMSSVVPPDWVKINSTKVVGRYHSPFIVEKYRCLLQLREQ--LVIDSGQEWINFLQLFGEHYYILKKAVGHLATMDCFFSLAQVAKENN---YCRPEVLEQERHI--------VIRDGRHPVIDMLMGEQDQYVPNDTELQG---DGKR-----AMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGM-VDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFIRDVKCLTLFVTHYPPLCELEKLYPLHVGNYHMAFLLNEPEIVGD-------EEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTAALKSK--ELEAIINSRRRAVKG 1089          
BLAST of msh6 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 231.491 bits (589), Expect = 9.722e-62
Identity = 197/693 (28.43%), Postives = 331/693 (47.76%), Query Frame = 3
Query: 1563 AVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDI-SEIISFFKTAFDQENAKKNGKIIPESGIDADY---DESVALIKEIERDLAEYLEKQKKII-NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKI--FAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEI----RHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDG 3596
             + CLG ++ YL +  +++ L+  + F     SD D                    HM++ + T+ NL++  N + G + G+LL  LD + T FG+RLL +W++ PL    +I+ RQ+A+ E++  +++ L +I+  L   PDLE+ +  I                        Y ++  T     L++   + ++ +EF      Q +   +  +I      S + + P + S   +F K     ENA K G          D+   ++    I+ I  D+ E+  + + I+ N ++N+       F +E+  S  S VP  ++  +  K   RY +  I    + L+   ++  LV+ +    I     F EHY+   + +  +A  D   SL   ++  +     RPE+    RHI        +I +GR P       +  +++ N  +L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA    I   VD +FTR GA+D+I  G+ST   E+ EA+ ILS+ +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E EK    ++   HMA ++ +             +  ++ + ITFLY+LT G   +SYG N ARLANIPE I+     K+K  E E +I   R+ + G
Sbjct:  483 VICCLGPVIQYLTEFKLERVLLCPSSFRRLL-SDSD--------------------HMVLSATTMKNLEIFCNQTTGSVKGSLLWVLDHTHTPFGKRLLKKWVSQPLKSASEILSRQEAVAEILSSESSVLPSIQALLNRLPDLERGLCSI------------------------YHKKCSTQEFYLLSS--TLSRLGIEF------QALIPAVQSQISSALLKSLLLDTPQLLSPAHNFLKVL--NENAAKTGNKTELFADLTDFPVIEQRKDQIQNILSDIMEHRRELRLILRNPSLNYATVSGQEFLIEVKNSMSSVVPPDWVKINSTKVVGRYHSPFIVEKYRCLLQLREQ--LVIDSGQEWINFLQLFGEHYYILKKAVGHLATMDCFFSLAQVAKENN---YCRPEVLEQERHI--------VIRDGRHPVIDMLMGEQDQYVPNDTELQG---DGKR-----AMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGM-VDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFIRDVKCLTLFVTHYPPLCELEKLYPLHVGNYHMAFLLNEPEIVGD-------EEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTAALKSK--ELEAIINSRRRAVKG 1089          
BLAST of msh6 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 208.379 bits (529), Expect = 2.322e-54
Identity = 188/687 (27.37%), Postives = 316/687 (46.00%), Query Frame = 3
Query: 1563 AVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDI-SEIISFFKTAFDQENAKKNGKIIPESGIDADY---DESVALIKEIERDLAEYLEKQKKII-NSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDG 3596
             + CLG ++ YL +  +++ L+  + F     SD D                    HM++ + T+ NL++  N + G + G+LL  LD + T FG+RLL +W++ PL    +I+ RQ+A+ E++  +++ L +I+  L   PDLE+ +  I                        Y ++  T     L++   + ++ +EF      Q +   +  +I      S + + P + S   +F K     ENA K G          D+   ++    I+ I  D+ E+  + + I+ N ++N+       F +E+  S  S VP  ++  +  K   RY +  I    + L+   ++                         VI+S  ++   L            P    + RHI        +I +GR P       +  +++ N  +L     +  R      M++TGPNMGGKS+ +RQ AL+ I++QLG +VPA    I   VD +FTR GA+D+I  G+ST   E+ EA+ ILS+ +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E EK    ++   HMA ++ +             +  ++ + ITFLY+LT G   +SYG N ARLANIPE I+     K+K  E E +I   R+ + G
Sbjct:  483 VICCLGPVIQYLTEFKLERVLLCPSSFRRLL-SDSD--------------------HMVLSATTMKNLEIFCNQTTGSVKGSLLWVLDHTHTPFGKRLLKKWVSQPLKSASEILSRQEAVAEILSSESSVLPSIQALLNRLPDLERGLCSI------------------------YHKKCSTQEFYLLSS--TLSRLGIEF------QALIPAVQSQISSALLKSLLLDTPQLLSPAHNFLKVL--NENAAKTGNKTELFADLTDFPVIEQRKDQIQNILSDIMEHRRELRLILRNPSLNYATVSGQEFLIEVKNSMSSVVPPDWVKINSTKVVGRYHSPFIVEKYRCLLQLREQ------------------------LVIDSGQEWINFLQ-----------PEVLEQERHI--------VIRDGRHPVIDMLMGEQDQYVPNDTELQG---DGKR-----AMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGM-VDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFIRDVKCLTLFVTHYPPLCELEKLYPLHVGNYHMAFLLNEPEIVGD-------EEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTAALKSK--ELEAIINSRRRAVKG 1053          
BLAST of msh6 vs. Ensembl Sea Lamprey
Match: msh6 (mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-020905-3])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 320/784 (40.82%), Postives = 470/784 (59.95%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYT--HQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLS-KSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDA--LLSLTSFSR--GLDGGPMTRPEIR-----HINPGDKPFLIITEGRFPCKAKTQSGE-FISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGS-----GQSTLQVEMNEAALILSYMSPHSFLLIDEL-------GRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEET 3563
            P +++Y +G LS  TQ +    LA+  ++  T + QF  +  TL      D    +     S   LP  L      +D+LG +++ E ELA+S LGA+L+YL KCLID  L+S+ +F  Y P D        LA D     YT      M++D  TLTNL++L++S+ GG++GTLL RLD  LT FGRRLL  W+  P CDP  I +R  A+++L+ +   +  +K+ L+  PDLE+L++KIH LG   ++  DHPDSRAVLYE   YS+RKI DF++TL  F      Q          + +S+LLRK+ + ++D   G FPD+S  +  + TAFD + A+ +G I P  G D +YD+++  I   ++ L EYLEKQ+K ++  +I ++GTG+N FQ+E+P++   +  P  Y   S +KGF+R+ + EIE L+  L +AE++RD+ +++ M ++F  FD  Y QW+  ++ +A  D   LLSL  +S   G    PM RP +R       + G  PFL +   R PC + T  G+ FI N + +G  L + + +     +L+TGPNMGGKSTLMRQ  LI+I++QLGCYVPAE    LTPVDR+FTR GA+D I S     G+ST  VE++E + IL + + HS +L+DEL       GRGTATYDG A+A +++  +A+    RT+FSTH+H L+E+     ++++ HMACM+E +N           D++   + ITFLYK   G CPKSYGFNAARLA +P+ ++  G +KA+ FE  T
Sbjct:  616 PAQVLYERGGLSAETQKIVRVTLASALQDALTPSTQFWDATKTLK---VEDERGGSGGGGGSSGALPPVLRAMTAASDSLGLAAADEAELALSALGAMLFYLRKCLIDHELLSMGNFRRYQPPD------LVLAGDAHNGGYTGLATRRMVLDGVTLTNLEVLQSSTTGGVEGTLLVRLDSCLTPFGRRLLRAWLVAPPCDPRAIDDRLDALEDLMAVPDKVLQVKDLLRKMPDLERLLSKIHGLGTPLRASRDHPDSRAVLYEETAYSKRKIADFLSTLEGFR--AASQAAGLLQECAGDFKSRLLRKV-VSTEDG--GHFPDLSPELQRWDTAFDHQKARSSGVITPRPGFDPEYDQALLDISANKKLLDEYLEKQRKRLSCKSIVYWGTGRNCFQMEVPDAVAQRNTPEEYQLKSTKKGFRRFHSPEIERLMALLSDAEERRDIAMRDCMRRLFYNFDASYKQWSAAMHCMAVLDTDVLLSLAHYSEQGGEGANPMCRPSVRPPPSEGGSSGGGPFLELRGSRHPCVSTTFLGDSFIPNDVVVG--LSDGDDDGGARCVLVTGPNMGGKSTLMRQAGLIVIMAQLGCYVPAEA-CRLTPVDRVFTRLGASDRIMSVLRRAGESTFFVELSETSSILQHATRHSLVLLDELGFLLRPRGRGTATYDGTAIASAVVHELAEGVRCRTLFSTHYHSLVEDFAASPHVRLGHMACMVEQEN-----------DDDPSQETITFLYKFVAGACPKSYGFNAARLAGLPDAVVRAGHRKAREFESST 1371          

HSP 2 Score: 211.46 bits (537), Expect = 0.000e+0
Identity = 129/381 (33.86%), Postives = 206/381 (54.07%), Query Frame = 1
Query:  196 TDNKDSD-DFRNNS--RKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSK----NKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGG-LLYSFKESLIEENVKGKLKNTVNI----------GVALVNTNTGKFTIAQFADDDQRSRFRTLIS 1284
            +D  DSD +F+ ++    S +    + E + S+ E++    +  K + +   ++P +T +    + G+    ++     K  T  +     + KA LS+FS +  +S            D   +   ++H   ++L+    RD +RR    P+YDP+++++P+SF+S  TPG+++WW+IK+    +T++FFKVGKFYELYHMDA+T VSELGL +M+G +AHSGFPE +F++ +D LV KG+KVARVEQTET + M  R +  +      +KVV RE+C++IT GT+ +S+ +              G   DA    L + +E    E   G   N              GV  V+T+ G F + QF DD   SRFRTL++
Sbjct:  260 SDTDDSDAEFKPDTVDASSDEASSGVDEKEASEPESASDPESPVKKRKRTTTKAPALTPSRQPLMLGLSSVASSG----KAATPKQAQTGSNAKAKLSAFSSDTLESQ------NGGGQDGGKEGGGWDHEKLDWLRDGKRRDGKRRLQSDPEYDPSSIYVPDSFLSACTPGMRRWWEIKST-LFDTVLFFKVGKFYELYHMDALTGVSELGLLFMKGTWAHSGFPETSFARFSDGLVQKGYKVARVEQTETPDMMEARCRAMARPATKLDKVVKREVCRIITKGTQTYSILD--------------GDPSDAQNKFLLAVRE---REGPPGGSGNNSGANETGASVRTYGVCFVDTSVGVFHLGQFTDDRHCSRFRTLVA 612          
BLAST of msh6 vs. Ensembl Sea Lamprey
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 217.624 bits (553), Expect = 1.466e-58
Identity = 172/671 (25.63%), Postives = 307/671 (45.75%), Query Frame = 3
Query: 1566 VSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGK---IIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINS-NINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKA--KTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
            ++CL  L++YL +  +++ L   ++F   +  + +C+                     I+  T  N++L +N + G + G+LL  +D + T FGRR+   W+  PL     I  R   + E++  +   LS  K  L   PDLE+        GL+                 +Y R+  T   + + +    +  +        +  + S LL  I+L        + P   + +  +    D++ AK+  K       +G       S   I+ +  +L E+  + ++ + S   ++       F +E+  S    VPS ++     K   R+ T  +    K+L    +K  +           +F EHY  +   +  +A  D L SL + +   DG    RPE       +K  ++I  GR P          +++ N+  L +   +  R      M++TGPNMGGKS+ +RQ ALI +++Q+G +VPA     L+ +  + TR GA+D+I  G ST   E++EA+ I+   + HS +++DELGRGT+T+DG A+A++ L+         T+F TH+  + E E+   + +   HM+ ++ +  +   G      ++  +L+++TFLY+LT G   +SYG N ARLA IPEQ++    +K++  E
Sbjct:  300 IACLAVLIHYLTEFGLERVLYLSSNFQ-KFSMESECLH--------------------INGITQKNMELFQNQTNGKVKGSLLWAMDRTCTPFGRRMFRNWLGRPLISISDINARLDCVSEILASEHMVLSRAKELLWKLPDLER--------GLTS----------------IYHRKCSTKEFSLIASSLERLCTETHALAASAQDQLSSPLLLGILL--------DVPRRLQHVQHYTRVLDKQAAKEGDKTRLFTDLTGFPRMLRRSEE-IRAVLEELREHRTEVRRTLRSPAADYTTVSGQEFLIEVRNSMLHTVPSNWVKIGSTKAVTRFHTPFVVQKFKQLCQLREKLRIDSNAEWLGFLTQFGEHYHNFRAAVAQLATLDCLFSLAAIA-SRDGYCSIRPEFVE----EKSLIVIENGRHPVVELLMGDQNQYVPNSTHLDA---DGKR-----AMIITGPNMGGKSSYIRQVALIAVMAQMGSFVPA-SHAKLSSLHAIHTRMGASDNIYKGHSTFMEELSEASEIIRKATRHSLVILDELGRGTSTHDGIAIAYATLEYFVKEVQCLTLFVTHYPPVCEMERLNAEVVSNYHMSFLLSEPEETAQG------EDGERLESVTFLYQLTEGPAARSYGLNVARLAAIPEQVLHTAAQKSRELE 896          
BLAST of msh6 vs. Ensembl Yeast
Match: MSH6 (Protein required for mismatch repair in mitosis and meiosis; forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; also involved in interstrand cross-link repair; potentially phosphorylated by Cdc28p [Source:SGD;Acc:S000002504])

HSP 1 Score: 287.73 bits (735), Expect = 1.229e-80
Identity = 223/778 (28.66%), Postives = 366/778 (47.04%), Query Frame = 3
Query: 1287 VQPNEIIYLKGNLSKNTQHV--FNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPD-ISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQ-WTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEI-----RHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVM-LLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFR 3581
            V+P E++  + NLS     +  FNS   A   E     ++F   + T + ++SS+YF+       +    P  L    +    +G           S  G LLYYL    +DK L+S+ +   Y                    F   Q  M++D  TL NL++  NS  G   GTL +  + ++T  G+R++ +W+  PL   + I  R  ++  L++       ++      PDLE+++A+IH             SR +          K+ DF   +TAF+ II++Q       ++ ++ SK             I  FP+ + E +  +  AF+++ A     I+P+ G D ++D+S+  I+E+E +L E L   +K    SNI +  +GK  + +EIP S    VPS ++  +  K +KRY + E+  L + +  A++    + +++ +++  KFD HY   W   I +I+  D LL++T  S  L G P  RP I        N     FL     R PC     T + +FI N I+LG          + P + LLTG N  GKST++R   + +I++Q+GCYVP E  V LTP+DR+ TR GAND+I  G+ST  VE+ E   IL   +  S L++DELGRG ++ DG A+A S+L  +A        F+TH+  L    +    ++   M+ ++++                   +N+TFLYK+  G    S+G + A +  I ++II N    A   E  + +++ R
Sbjct:  500 VRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEV-KAGEEFYDCDKTYAEIISSEYFS-------TEEDWPEVLKSYYDTGKKVG----------FSAFGGLLYYLKWLKLDKNLISMKNIKEY-------------------DFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIH-------------SRTI----------KVKDFEKVITAFETIIELQDSLKNNDLKGDV-SKY------------ISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYL-GAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGK---------EQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAV-LTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEAT-----------------RNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKER 1176          

HSP 2 Score: 127.102 bits (318), Expect = 7.216e-30
Identity = 86/250 (34.40%), Postives = 134/250 (53.60%), Query Frame = 1
Query:  583 YEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAH---SGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPG--TRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISK 1317
            Y++L  E  RDAQRR    P+YDP TL+IP S  +K TP  KQ+W+IK+    + I+FFK GKF+ELY  DA+ A +   L    G  A+   +G PE++F   A Q +  G+KVA+V+Q E++ A   R   E SK  +V RE+  ++T G  T G  L +             L   E+ G     + E+ ++ +   +  NT   G A ++T TG+  + +F DD + ++  TL+S+   M+  + +
Sbjct:  277 YQWLVDE--RDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKSK-MWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMR---EGSKG-IVKRELQCILTSGTLTDGDMLHSDLATFC-------LAIREEPGNF---YNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPMEVVMER 509          
BLAST of msh6 vs. Ensembl Yeast
Match: MSH3 (Mismatch repair protein; forms dimers with Msh2p that mediate repair of insertion or deletion mutations and removal of nonhomologous DNA ends, contains a PCNA (Pol30p) binding motif required for genome stability [Source:SGD;Acc:S000000688])

HSP 1 Score: 177.178 bits (448), Expect = 1.419e-45
Identity = 185/665 (27.82%), Postives = 320/665 (48.12%), Query Frame = 3
Query: 1710 PFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN----LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQN-----IQSKLLRKIMLHSKDSKIGEFPDISEIISFFK----TAFDQENAKKNGKIIPESGIDADYDESVALIK------EIERDLAEYL-EKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAED----KRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIAD-SCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNG------LKKAKIFEEE-TLIMEFRKFLDGKNIS 3608
            PF + + HM++D N+L +LD+  +   GG  G+L   LD + T+FG R+L +WI  PL D  +I ER  AI E I  + N      ++   L   PDL + + +I + G +                   SR+++  ++  +T+F +  K+   +   H + +      QS LL ++      S++ E    +++  F      +A  ++N+ K  +++    ++ +YD S  +IK       +   L E L E +K +    +NF    +  + +E+  S+   +P  +I  +  K   R+ T   + L +KL   +D    + +L  K  ++KI A++ E      ++  ++AQ+D +LSL + S  ++     RP         +  +I    R P   ++    ++ N I      M S  N    + ++TGPNMGGKS+ +RQ AL+ I++Q+G +VPAE  + L+  + + TR GA+D I +G ST +VEM +   IL   +  S LL+DE+GRGT T+DG A++++++K  ++ S  P  +F+THF  L E K     ++  HM  + E    +                ++ FLYKL  G    SYG N A+LA + + II         L+K  I E+   L    ++ L   NI+
Sbjct:  411 PFAS-KIHMLLDPNSLQSLDIFTHD--GG-KGSLFWLLDHTRTSFGLRMLREWILKPLVDVHQIEERLDAI-ECITSEINNSIFFESLNQMLNHTPDLLRTLNRI-MYGTT-------------------SRKEVYFYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLF-----SELNELLSTTQLPHFLTMINVSAVMEKNSDK--QVMDFFNLN-NYDCSEGIIKIQRESESVRSQLKEELAEIRKYLKRPYLNF--RDEVDYLIEVKNSQIKDLPDDWIKVNNTKMVSRFTTPRTQKLTQKLEYYKDLLIRESELQYKEFLNKITAEYTE----LRKITLNLAQYDCILSLAATSCNVN---YVRPTF----VNGQQAIIAKNARNPI-IESLDVHYVPNDI------MMSPEN--GKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAE-EIRLSIFENVLTRIGAHDDIINGDSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYFSELSDCPLILFTTHFPMLGEIK--SPLIRNYHMDYVEEQKTGE-------------DWMSVIFLYKLKKGLTYNSYGMNVAKLARLDKDIINRAFSISEELRKESINEDALKLFSSLKRILKSDNIT 1004          

HSP 2 Score: 48.9062 bits (115), Expect = 5.513e-6
Identity = 62/226 (27.43%), Postives = 101/226 (44.69%), Query Frame = 1
Query:  685 SKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRG---------------NYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHE--SSKNKVVNREICQVITPGTRG----FSLRNR-----------TCRETGQEGSEELGYIE---DAGGLLY-SFKE-SLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADD 1251
            +KLTP  KQ   +K + + + ++  +VG  Y+ +  DAVT    L +  + G                +A+  FP++  +   ++LV    KVA VEQ ET        KH+  +SK+ V  R+I  V T  T G    F LR +             R+  Q    +   I    + G ++Y  F+E +L +E ++ ++K    I V LVNT+     +A+F  D
Sbjct:  130 AKLTPLDKQVKDLKMH-HRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPGKLTIDESNPQDCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIK----KHDPGASKSSVFERKISNVFTKATFGVNSTFVLRGKRILGDTNSIWALSRDVHQGKVAKYSLISVNLNNGEVVYDEFEEPNLADEKLQIRIKYLQPIEV-LVNTDDLPLHVAKFFKD 349          
BLAST of msh6 vs. Ensembl Yeast
Match: MSH2 (Protein that binds to DNA mismatches; forms heterodimers with Msh3p and Msh6p that bind to DNA mismatches to initiate the mismatch repair process; contains a Walker ATP-binding motif required for repair activity and involved in interstrand cross-link repair; Msh2p-Msh6p binds to and hydrolyzes ATP [Source:SGD;Acc:S000005450])

HSP 1 Score: 158.303 bits (399), Expect = 1.144e-39
Identity = 172/601 (28.62%), Postives = 273/601 (45.42%), Query Frame = 3
Query: 1806 TLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELI---ELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKD-SKIGEFPDISEIISFF--------KTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYL--EKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKK---LINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQ-----NITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKA 3542
            +L + L+   T  G RLL +W+  PL + D+I +R   +  LI   EL   L++    L   PD+ +L  K++  G  + V         +Y+   +S+R I + V   T+F     ++ +     V + ++S  L  +  H +  SK  E  + +  +  +        K  F++E     GKI   S +D   DE    I  I  D AE L  +  KK+   N +  G      +L   ++K  +    YI  S  K    + T +++ +  +   L    DK+   L   +  I   +   + + + V+   A  D + S    S      P  RP++  ++   +  LI    R P         FISN + L S             +++TGPNMGGKST +RQ  +I +++Q+GC+VP E   I   VD +  R GA DS   G ST  VE+ E A IL   S +S +++DELGRGT+TYDG  LA++I + IA       +F+THFH+L E  E   N++  H+                 H++ NLK Q     +IT LYK+  G   +S+G + A +   PE+I+    +KA
Sbjct:  337 SLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDYLIDQIELRQMLTS--EYLPMIPDIRRLTKKLNKRGNLEDVLK-------IYQ---FSKR-IPEIVQVFTSF-----LEDDSPTEPVNELVRSVWLAPLSHHVEPLSKFEEMVETTVDLDAYEENNEFMIKVEFNEEL----GKI--RSKLDTLRDE----IHSIHLDSAEDLGFDPDKKLKLENHHLHGWC---MRLTRNDAKELRKHKKYIELSTVKAGIFFSTKQLKSIANETNILQKEYDKQQSALVREIINITLTYTPVFEKLSLVL---AHLDVIASFAHTS-SYAPIPYIRPKLHPMDSERRTHLI--SSRHPVLEMQDDISFISNDVTLESG--------KGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAI-VDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVV---------------AHIEKNLKEQKHDDEDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKA 876          
BLAST of msh6 vs. Ensembl Yeast
Match: MSH1 (DNA-binding protein of the mitochondria; involved in repair of mitochondrial DNA; has ATPase activity and binds to DNA mismatches; has homology to E. coli MutS; transcription is induced during meiosis [Source:SGD;Acc:S000001162])

HSP 1 Score: 141.739 bits (356), Expect = 1.597e-34
Identity = 163/633 (25.75%), Postives = 290/633 (45.81%), Query Frame = 3
Query: 1734 MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAK--------IHVLGLSKSVSDHPDSRAVLYE--GLLYS--RRKITDFVNTLTAFDNIIKIQLEF-------TRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFF-KTAFDQENAKKNGKIIPESGIDADYDESVALIKEI---ERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIE---GLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINP---GDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAK 3545
            M IDS T T L+L          G+LL  +  ++T  G RLL QW++ P  D  +I +RQK +    +       ++  LK   DL +++ K        + ++ +++S+    + R  L     L+ +  + +IT    +L    N+I   L+F            +QN  + + R + +  KD K     +I E+  F    +F+ +  K +       G+     E  AL+K     +     +  K+++     ++  GT  +  +++   SK ++   +     Q+    R+L+ +I    G   +L+N + + +    NI+     KF +   +  QV  ++   D   +L+SF+   +   +  P++   N     +   L++ EG      +T    F +N  +L           DN + ++TGPNMGGKST +RQ A+I+IL+Q+GC+VP     +   VD+LF+R G+ D + +  ST  VEM E + IL   +  S  ++DE+GRGT+  +G ++A++ LK + ++   RT+F+THF +  E K+I DN     M+  ++                +L   N  + +KL  G C KS     A LA  P    +  LK+A+
Sbjct:  363 MQIDSRTSTALELHSTVRDNNKKGSLLSSIRRTVTPSGTRLLSQWLSGPSLDLKEIKKRQKIVAFFKDNRDITETLRTMLKKVNDLSRILQKFSFGRGEALELIQMARSLEVSREIRKYLLNNTSLMKATLKSQITQLTESLNFEKNLIDDILKFLNEEELAKSQDAKQN--ADVTRMLDIDVKDKKESNKDEIFELRDFIVNPSFNTKLRKLHDTY---QGVWQKKTEYNALLKGFFVGDLGAKTFTLKERQNGEYALHVTGTASSLKKIDELISKSTEYHGSCFHILQKSSQTRWLSHKIWTDLGHELELLNLKIRNEEA--NIIDLFKRKFIDRSNEVRQVATTLGYLD---TLSSFAVLANERNLVCPKVDESNKLEVVNGRHLMVEEGLSARSLET----FTANNCELAK---------DN-LWVITGPNMGGKSTFLRQNAIIVILAQIGCFVPCSKARV-GIVDKLFSRVGSADDLYNEMSTFMVEMIETSFILQGATERSLAILDEIGRGTSGKEGISIAYATLKYLLENNQCRTLFATHFGQ--ELKQIIDNKCSKGMSEKVKFYQSGI---------TDLGGNNFCYNHKLKPGICTKSDAIRVAELAGFP----MEALKEAR 955          
BLAST of msh6 vs. Ensembl Yeast
Match: MSH4 (Protein involved in meiotic recombination; required for normal levels of crossing over, colocalizes with Zip2p to discrete foci on meiotic chromosomes, has homology to bacterial MutS protein [Source:SGD;Acc:S000001891])

HSP 1 Score: 110.538 bits (275), Expect = 5.208e-25
Identity = 137/547 (25.05%), Postives = 240/547 (43.88%), Query Frame = 3
Query: 1713 FYTHQSHMIIDSNTLTNLDLLKNS-SLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKI--------IPESGIDADYDESVALIKEIERDLAEYLE--KQKKIINSNINFFGTGKNRFQLEIPESK----CSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPA-EGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIF-STHFHKL 3302
            F   ++ M+IDS T+  L+L++N     GI  +L + LD + T  G+R L   I  PL D   I  R +A++EL   D  L  ++  +KS PDL+KL +++  +  S    D   +  +L +  L S + + D +N                    +Q IQS+L+      S+  KI     I EI     +  +++    +  I          +S  +   D S  + KE++ +    +E    K  IN + N+       F L I   +     + +P  +I+ + +K +    T+ I     +L    ++  L+ +  + ++  K   H  +   +  ++A  D +    SF+  L     T P   +        L+I + R P   K     F+ NTI        S+    + + ++TG NM GKS  ++Q ALI I++Q+G  +PA  G     PV +    +  NDS+    S    EM E A  L  ++  + L++DELGRG++  DG  ++ ++ + +    +  T+F STHF  +
Sbjct:  258 FEGTENTMLIDSKTVRGLELVENKLDKNGI--SLWKFLDTTSTKMGQRSLRNSILQPLTDRGSIEMRLEALEELKANDDLLQKLRLEMKSLPDLDKLFSRLLCINHSAIKPDQRINYVLLLKETLQSVKSLKDALN--------------------DQLIQSRLI------SETKKIFNNDAIMEIEKLINSCINEDCVWASSAIQLLNQRSYAVKSDSNGLLDVSRQIYKEVKEEFFREVEDLTAKNKINLDHNY--DSARGFYLRIKRQEFTDDVATLPDVFISRTIKKNYIECTTLNIIKKNARLKEVMEEILLLSEETVDELLDKIATHISELFMIAEAVAILDLV---CSFTYNLKENNYTIPIFTN-------NLLIRDSRHPLLEKVLKN-FVPNTI--------SSTKHSSSLQIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGSF---PVFKRLHARVCNDSMELTSSNFGFEMKEMAYFLDDINTETLLILDELGRGSSIADGFCVSLAVTEHLLR--TEATVFLSTHFQDI 750          
BLAST of msh6 vs. Ensembl Nematostella
Match: EDO38799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW8])

HSP 1 Score: 229.95 bits (585), Expect = 1.869e-62
Identity = 182/631 (28.84%), Postives = 301/631 (47.70%), Query Frame = 3
Query: 1707 EPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN---LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQ-SKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQ----KKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLD-GGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNP-VMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEE 3560
            E F T    M ++   L NL++LK S  G   G+LL  LD + T FG+RLL +WI  PL +  +I ER KA+  L  L ++   L +I   L   PDLEK +  I+                       Y +    +F++   A   +   +L+ T ++  + +  S +L +           E PD+   +  F    D E A K G         + +   +  I+EI+   AE  E +    + I + ++++     N F +E+  +K   VP+ +I  S  K   R+ T  +E   K +    +K     +    +    F   Y ++ + +  +A  D ++SL + +R      P+ + E       +   ++IT+GR P       +  +++ N         N+  N + P  M++TGPNMGGKS+ ++Q ALI++++Q+G +VPA   V LTP+D ++TR GA+D+I  G+ST  VE+ E + IL+  +  S +++DELGRGT+T+DG A+A++ L+   D     T+F TH+  L E E+    ++  +HMA M  D + +            +    +TFLY+L  G   +SYG N ARLA IP  I+     K+   E E
Sbjct:  308 EKFSTIAKFMKLNGCALQNLEILK-SQCGSRKGSLLGILDHTSTPFGKRLLKRWITQPLLEKREIEERLKAVSCLSALSSDQPLLKSIHRLLSHIPDLEKGLCAIY-----------------------YKKCSTVEFLSIAKALSKL-HDELKSTELNSAKELAGSSILSRTFT--------EVPDLLSGVEDFLNQID-EKAAKCGDKTKLFTDPSKFPPVLTCIQEIDGLTAELKEHRSEIRRTIQHPSVDYCTVSGNEFLIEVRNAKLPSVPADWIKISATKQICRFRTPFVEEKFKSICQWREKLAQACQEAWLEFLDIFSTSYTRFHRAVKLVANLDCIMSLATVARQPGYVCPVIKKET------EASSVLITQGRHPVIDVLLQEHAQYVPN---------NTELNTEGPRCMIITGPNMGGKSSYIKQVALIVLMAQMGSFVPAHS-VELTPLDAIYTRMGASDNIYKGRSTFMVELQETSEILAQATRRSLVILDELGRGTSTHDGVAIAYATLRHFIDQTHSLTLFVTHYPSLAELERIFPGHVTNNHMAFMTSDGDTELASVA-------MDTPAVTFLYELVRGVAARSYGLNVARLAGIPINIVAMAAGKSHDLESE 881          
BLAST of msh6 vs. Ensembl Nematostella
Match: EDO26509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBU4])

HSP 1 Score: 166.007 bits (419), Expect = 7.513e-46
Identity = 110/295 (37.29%), Postives = 167/295 (56.61%), Query Frame = 3
Query: 2682 QVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQ--SGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCS-PRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            Q  NSIAQ D LLS   F++        RP +      +   L I  GR P   K      E+I+N + L       NRN    ++++TGPNM GKS ++RQTALI++L+Q+G YVPA+   I   VD++FTR GA+D+I  G+ST  VEMNE A IL+ +S  S +L+DE+GRGT+TYDG ++A++I + + +  S  +T+F+TH+H+L +  E  + ++  +++                     LK   I FL KL  GG   S+G + A+LA +P ++I    + +KI E+
Sbjct:    7 QNANSIAQLDCLLS---FAKTAIDNNYVRPIL-----DESTDLEIKNGRHPVIEKQLPIGEEYIANDVVL-------NRN-QQQIIMITGPNMSGKSAILRQTALIVLLAQMGSYVPAQNARI-GIVDKIFTRVGASDNISMGESTFMVEMNETASILNNISERSLVLLDEIGRGTSTYDGISIAWAIAEFLHEHPSKAKTLFATHYHELNDMTETFERIKNYNVSV------------------KELK-DTIIFLRKLVAGGSNHSFGIHVAKLAGMPNRVI---HRASKILEQ 262          
BLAST of msh6 vs. Ensembl Nematostella
Match: EDO38319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD83])

HSP 1 Score: 171.4 bits (433), Expect = 8.580e-44
Identity = 171/630 (27.14%), Postives = 277/630 (43.97%), Query Frame = 3
Query: 1731 HMIIDSNTLTNLDLLKNSSLGGIDGTLLERL-DFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHS-KDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKE----------IE-----RDLAEYLEKQKKI---INSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINS-IAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            +M +D+  +  L+LL N   GG     L  L +   T  G+RL+ QWI  PL D +KI ER   ++  +E       +++ +K  PD  +L  K                +A L + +     ++   V  L  F ++++      R H +        RK+++   +D  +    D ++     +T  D E  + +     E  I A +DE +   +E          +E     RDL+  LE  K I    N+ + +F      F++   E K  +    Y     RK   R+    +  L  +    +D  + V   + +++  K    Y +  Q ++  IAQ DAL+S    S      P  RP I     G +  +I+T  R PC     +  FI+N + L     + ++ +    +++TGPNMGGKST +RQ  +I++++QLGC+VP     I +  D +  R G+ DS   G ST   EM E A IL   +  S ++IDELGRGT+TYDG  LA++I + IA       +F+THFH+L     + D +                      H+        +T LYK+  G C +S+G + A LA+ P  +I    +KA   E+
Sbjct:  157 YMKLDAAAVRALNLLPNPMDGGNKSMCLTGLLNKCKTPQGQRLVAQWIKQPLMDKNKIEERLNIVEAFVEDTELRQTLQDEMKKFPDFSRLAKKFQ------------RQKATLQDCV-----RVYQSVQRLEPFADVLE------RYHGDH-------RKLLVECFRDPLMELVADFAKFCDLVETTIDLEQVENH-----EYLIKATFDEGLQECREHMDEILEKFPVELNKAGRDLS--LEPSKTIKLESNNQLGYF------FRITRKEEKVLRNNKRYSTIETRKDGVRFTNSALSQLNDEFRGYKDTYNDVQGKLAAEVL-KIAGGYSEPMQGLSDVIAQIDALVSFAHVSANAPI-PYVRPTI--TPKGSEGDIILTGSRHPCLEIQDNVAFIANDVTL-----SRDKQM---FLIITGPNMGGKSTYIRQIGVIVLMAQLGCFVPCSTAQI-SITDCILARVGSGDSQLKGVSTFMSEMLETASILRTATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATQIKSFCLFATHFHEL---TSLADEV----------------STVTNLHVTALTTGGTLTLLYKVKPGVCDQSFGIHVAELAHFPSDVIEFAKQKAAELED 711          
BLAST of msh6 vs. Ensembl Nematostella
Match: EDO48759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ7])

HSP 1 Score: 136.732 bits (343), Expect = 1.138e-32
Identity = 158/627 (25.20%), Postives = 252/627 (40.19%), Query Frame = 3
Query: 1734 MIIDSNTLTNLDLLKNSSLGGI--DGT-------LLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKEL-----IELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPST--YIASSQRKGFKRYLTVEIEGL----------LKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCS--PRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNG 3530
            +I+D NT + L + +  S   +   GT       L   L+ + +A G RLL  W   P  D   + ERQKAI        I+L A+L +   N+K+         ++++      V   P     +   +  ++  ITD+        N + I      +  E  I  K+   +             D+  I S   T  D +++ +  + + + G+D   DE     K     L +++ K  +             N+    I E     +P     +A  +    K     E++GL            K  +  D    ++  + S I     E       V+   A+ D L+SL   +R         PEI       K  L IT G  P +    S +F+ N   +     +S R     V++LTGPN  GKS  ++Q  LI+ L+ +G +VPAE  +I    DRLFTR    +++  G ST  +++N+ A  +   +  S +LIDE G+GTAT DG +L  + L+    S S  P+T+ STHFH L+ +K + D                      E   D     + + FLY L  G    SY  + A LA +PE ++  G
Sbjct:  232 VIVDDNTYSALQIFQKESHPSVYKSGTSSKEGLSLFGVLNRTRSALGSRLLRMWFLRPTRDILVLTERQKAITFFTTPRNIDLIASLQDCLKNVKNVS------VRLYITKRELKVKSVPR----ILVRMKTAQASITDWQALYKTVYNAMYIADLCRTIPSEIAIAKKITVLVT-----------QDLHNIASLINTIIDFDDSTEQNRFVVKPGVDPALDER----KRTYNGLPDFMTKVAR----------KELNKLNPSIVECNVIYLPQLGYLLAVPRTTKMKEEKDFEMDGLDFVFLSNNMVYYKSASTRDHETAIMHRLQSTIL----ERTKVLLDVMECTAELDCLISLAVSARE---NNYVCPEI-----TSKSILHITGGMHPLQELCVS-QFVPNDTAINE---DSGR-----VVILTGPNASGKSVYLKQVGLIVFLAHIGSFVPAESAII-GVTDRLFTRIHTRETVSVGLSTFMIDLNQVASAIQSATDKSLVLIDEFGKGTATVDGLSLLCATLRHWLASSSKCPKTLVSTHFHSLIRQKLLPD-------------IPILRFQTTEVIQDG----KELVFLYHLVDGHAKTSYASHIAALAGMPEHLVKRG 784          
BLAST of msh6 vs. Ensembl Nematostella
Match: EDO39460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X4])

HSP 1 Score: 103.99 bits (258), Expect = 2.946e-26
Identity = 54/112 (48.21%), Postives = 74/112 (66.07%), Query Frame = 3
Query: 2958 GKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHF 3293
            GKST +RQ ALI IL+Q G YVPA+   +   VDRLF R GA+D++   QST   EM E A IL+  +  S +LIDE+GRGT+  DG ++A+++ + + D    RT+ STHF
Sbjct:    1 GKSTFLRQNALIAILAQAGSYVPAQQATVGI-VDRLFARIGASDNLVQHQSTFMSEMLETAYILTNATEKSLVLIDEIGRGTSMLDGMSIAWAVTEHLHDVIRCRTLASTHF 111          
BLAST of msh6 vs. Ensembl Medaka
Match: msh6 (mutS homolog 6 [Source:NCBI gene;Acc:101160935])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 336/775 (43.35%), Postives = 477/775 (61.55%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFG--LPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDK--PFLIITEGRFPCKAKTQSGE-FISNTIKLGSLLMNSNRNLDN--PVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            P E+++ KGN S  T+ +  + L++  +E      QF  ++ TL  L   DYF E+   +    G  LP  L K  +E+D+L  S  + YELA+S LG  ++YL KCL+DK L+S+A+F  Y P D +  +    A      F   +  M++D  TL NL++ +N S G  +GTLLERLD   T FG+RLL QW+  PLC+P  I +R  A+++L+   A  +     LK  PDLE+L++KIH +G      DHPDSRAVLYE + YS+RKI DF++ L  F  + +I   F    V     SKLLR+ ++  K  + G FPD+S  +  + TAFD + A+  G I P++G D +YD+++A I+  ER+L +YLE+QKK +    + F+GTGKNRFQ+E+P+S   + +P  Y   S +KG KRY+T E E L  +L   E+KRD  LK+ M ++F  FD++Y  W   +  +A  D LL+++ +S+G DG PMTRPE+     GD+  PF+ +   R PC  KT  G+ FI N I +G          +     +L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPAE  +  TPVDR+FTR GA+D I +G+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++K +A+    RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I +G KKA+ FE  T+ +   K L
Sbjct:  605 PAEVLFEKGNPSVETRKILKASLSSALQEGLHGGSQFWDAQKTLKTLSEEDYFKESAGEEKQTGGCFLPALLKKMTSESDSLCLSPKEGYELALSALGGCIFYLKKCLVDKELLSMANFEEYVPVDVEMAK----AAGPSSFFAQTRLRMVLDGVTLANLEIFQNGS-GRTEGTLLERLDTCSTPFGKRLLKQWLCAPLCNPTAIKDRLDALEDLMGAQAQATEAAELLKKLPDLERLLSKIHSIGTPLKGKDHPDSRAVLYEEVTYSKRKIADFLSALEGFKTMQEIISNFA--QVSAKFGSKLLRQ-LVSLKTEEGGLFPDLSAELKRWDTAFDHQKARSTGVITPKAGFDPEYDQALAGIRSCERELNDYLERQKKRLGCKGMAFWGTGKNRFQMEVPDSVPERNIPEEYEVKSTKKGCKRYVTKETERLFSQLQGLEEKRDAALKDCMRRLFYNFDKNYGDWKTSVECMAVLDVLLAMSRYSQGGDG-PMTRPEVELPEDGDQAVPFINLVGSRHPCVTKTFFGDDFIPNDIYIGCPGNGDGLEEEGCASCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPAES-LRFTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHATKHSLVLLDELGRGTATYDGTAIASAVVKELAEKVCCRTLFSTHYHSLVEDYAKNSAVRLGHMACMVE---------NEC---EDPSQETITFLYKFISGACPKSYGFNAARLANLPEEVIQSGHKKAREFERSTVSLRLFKKL 1357          

HSP 2 Score: 222.631 bits (566), Expect = 0.000e+0
Identity = 125/304 (41.12%), Postives = 182/304 (59.87%), Query Frame = 1
Query:  394 KNVNASTPHK--KKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNK---VVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            K+  A TP      P +   ++  +TK+ L++FS  A DS  E   SQ            ++H   E+L++   +D +RR+    DYDPT+L++PE F++++TPG+++WW++K+    +T+IF+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEI F++ +D LV KG+KVARVEQTET E M  R K  +  +K   VV RE+C+++T GT+ +S+ +    E+  +              L S KE   EE   G  +     GV  V+T+ G F + QF DD   SR RTLI+ F
Sbjct:  324 KSSKAKTPAAFTATPKRAPPAVAANTKSRLTAFS--APDS-FE---SQANGPASAGAATVWDHEKLEWLQEGKRKDGKRRRQTDEDYDPTSLYVPEDFLNRITPGMRRWWQLKSE-MFDTVIFYKVGKFYELYHMDAVIGVNELGLTFMKGTWAHSGFPEIGFARFSDVLVHKGYKVARVEQTETPEMMEARCKAMAKPSKFDRVVRREVCRIVTRGTQTYSVLDGAPSESQSK-------------FLLSLKEK-PEEESSGHCR---VYGVCFVDTSVGYFHVGQFPDDRHCSRLRTLIAHF 603          
BLAST of msh6 vs. Ensembl Medaka
Match: msh6 (mutS homolog 6 [Source:NCBI gene;Acc:101160935])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 336/775 (43.35%), Postives = 477/775 (61.55%), Query Frame = 3
Query: 1293 PNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFG--LPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIIN-SNINFFGTGKNRFQLEIPESKCSK-VPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDK--PFLIITEGRFPCKAKTQSGE-FISNTIKLGSLLMNSNRNLDN--PVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFL 3590
            P E+++ KGN S  T+ +  + L++  +E      QF  ++ TL  L   DYF E+   +    G  LP  L K  +E+D+L  S  + YELA+S LG  ++YL KCL+DK L+S+A+F  Y P D +  +    A      F   +  M++D  TL NL++ +N S G  +GTLLERLD   T FG+RLL QW+  PLC+P  I +R  A+++L+   A  +     LK  PDLE+L++KIH +G      DHPDSRAVLYE + YS+RKI DF++ L  F  + +I   F    V     SKLLR+ ++  K  + G FPD+S  +  + TAFD + A+  G I P++G D +YD+++A I+  ER+L +YLE+QKK +    + F+GTGKNRFQ+E+P+S   + +P  Y   S +KG KRY+T E E L  +L   E+KRD  LK+ M ++F  FD++Y  W   +  +A  D LL+++ +S+G DG PMTRPE+     GD+  PF+ +   R PC  KT  G+ FI N I +G          +     +L+TGPNMGGKSTLMRQ  L++IL+QLGCYVPAE  +  TPVDR+FTR GA+D I +G+ST  VE++E A IL + + HS +L+DELGRGTATYDG A+A +++K +A+    RT+FSTH+H L+E+      +++ HMACM+E         NEC    +   + ITFLYK   G CPKSYGFNAARLAN+PE++I +G KKA+ FE  T+ +   K L
Sbjct:  523 PAEVLFEKGNPSVETRKILKASLSSALQEGLHGGSQFWDAQKTLKTLSEEDYFKESAGEEKQTGGCFLPALLKKMTSESDSLCLSPKEGYELALSALGGCIFYLKKCLVDKELLSMANFEEYVPVDVEMAK----AAGPSSFFAQTRLRMVLDGVTLANLEIFQNGS-GRTEGTLLERLDTCSTPFGKRLLKQWLCAPLCNPTAIKDRLDALEDLMGAQAQATEAAELLKKLPDLERLLSKIHSIGTPLKGKDHPDSRAVLYEEVTYSKRKIADFLSALEGFKTMQEIISNFA--QVSAKFGSKLLRQ-LVSLKTEEGGLFPDLSAELKRWDTAFDHQKARSTGVITPKAGFDPEYDQALAGIRSCERELNDYLERQKKRLGCKGMAFWGTGKNRFQMEVPDSVPERNIPEEYEVKSTKKGCKRYVTKETERLFSQLQGLEEKRDAALKDCMRRLFYNFDKNYGDWKTSVECMAVLDVLLAMSRYSQGGDG-PMTRPEVELPEDGDQAVPFINLVGSRHPCVTKTFFGDDFIPNDIYIGCPGNGDGLEEEGCASCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPAES-LRFTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHATKHSLVLLDELGRGTATYDGTAIASAVVKELAEKVCCRTLFSTHYHSLVEDYAKNSAVRLGHMACMVE---------NEC---EDPSQETITFLYKFISGACPKSYGFNAARLANLPEEVIQSGHKKAREFERSTVSLRLFKKL 1275          

HSP 2 Score: 221.861 bits (564), Expect = 0.000e+0
Identity = 125/304 (41.12%), Postives = 182/304 (59.87%), Query Frame = 1
Query:  394 KNVNASTPHK--KKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNK---VVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            K+  A TP      P +   ++  +TK+ L++FS  A DS  E   SQ            ++H   E+L++   +D +RR+    DYDPT+L++PE F++++TPG+++WW++K+    +T+IF+KVGKFYELYHMDAV  V+ELGLT+M+G +AHSGFPEI F++ +D LV KG+KVARVEQTET E M  R K  +  +K   VV RE+C+++T GT+ +S+ +    E+  +              L S KE   EE   G  +     GV  V+T+ G F + QF DD   SR RTLI+ F
Sbjct:  242 KSSKAKTPAAFTATPKRAPPAVAANTKSRLTAFS--APDS-FE---SQANGPASAGAATVWDHEKLEWLQEGKRKDGKRRRQTDEDYDPTSLYVPEDFLNRITPGMRRWWQLKSE-MFDTVIFYKVGKFYELYHMDAVIGVNELGLTFMKGTWAHSGFPEIGFARFSDVLVHKGYKVARVEQTETPEMMEARCKAMAKPSKFDRVVRREVCRIVTRGTQTYSVLDGAPSESQSK-------------FLLSLKEK-PEEESSGHCR---VYGVCFVDTSVGYFHVGQFPDDRHCSRLRTLIAHF 521          
BLAST of msh6 vs. Ensembl Medaka
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:101156254])

HSP 1 Score: 258.07 bits (658), Expect = 1.964e-70
Identity = 197/691 (28.51%), Postives = 340/691 (49.20%), Query Frame = 3
Query: 1518 EADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDA--DYDESVALIKEIERDLAEYLEKQKKIINS-NINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHL-----DNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
            ++ +L R +S E  + + CLG L+ YL +  +++ L S + F              +L+ + +         MI+++ TL NL++L N +  G+ G+L   LD S T FGRRL+ +W++ PL D  +I ERQ A++E++E D+  L ++K+ L   PDLE+ +  I                        Y ++  T     +++  + + +QL+     +    +S LLR ++L +        PD+      F    +++ A+   K    S +       E    I  +  ++ E+L+  + ++ +  +N+       F +E+  S  S VPS ++  S  K   RY +  +    KKL    ++  L  +   +    +F EHY    + I+ +A  D L SL   ++    G   RP++      D+P ++I +GR P       +  +F+ N   L     +  R      M++TGPNMGGKS+ +RQ ALI I++Q+G +VPA     L  +D ++TR GA+D+I  G+ST   E+ EA+ I+S  +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E E+   D++   HMA ++           E H+     D +++ + ITFLY LT G   +SYG N A+LA++P+ I+    +KA+  E
Sbjct:  447 DSRSLWRVASFESPV-ICCLGPLIQYLQEFNLERVLRSESSF-------------QRLSCESEA--------MILNAATLRNLEILNNQTDRGVRGSLFWVLDHSRTPFGRRLMRKWVSQPLTDLQRISERQDAVQEIMESDSPILDSVKSLLPRLPDLERGICSI------------------------YHKKSSTQEFYLISSHLSRLGLQLQSWIPAIRSQTRSVLLRSVLLDT--------PDLLAPAHTFLNVLNEKAARSGNKTELFSDLSGFPVLQERTKQIHFVLSEIQEHLKDIRMVLKAPTLNYITVSGQEFLIEVKNSLSSTVPSDWVKISSTKAVGRYHSPLLVERYKKLQQLREQLLLDCQREWTDFLDQFGEHYHTMKRAISHLATIDCLFSLAEVAQQ---GGYCRPKVCE----DQPQIMIRDGRHPAIDLLMGEQNQFVPNHTDLQG---DGKR-----TMIITGPNMGGKSSYIRQVALICIMAQIGSFVPA-SEACLGLLDGIYTRMGASDNIYKGRSTFMEELTEASEIISRATERSLVILDELGRGTSTHDGIAIAYATLEYFIRHVKSFTLFVTHYPPLCELERMYPDHVSNFHMAFLLN----------ETHISSDTKDGDVQPEFITFLYNLTEGAAGQSYGLNVAKLADVPDPILCTAARKAQELE 1057          
BLAST of msh6 vs. Ensembl Medaka
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:101156254])

HSP 1 Score: 221.09 bits (562), Expect = 1.696e-58
Identity = 185/691 (26.77%), Postives = 323/691 (46.74%), Query Frame = 3
Query: 1518 EADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN-LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDA--DYDESVALIKEIERDLAEYLEKQKKIINS-NINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPC--KAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLE-EKEIGDNLQISHMACMIEXXXXXXXXXXECHL-----DNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFE 3554
            ++ +L R +S E  + + CLG L+ YL +  +++ L S + F              +L+ + +         MI+++ TL NL++L N +  G+ G+L   LD S T FGRRL+ +W++ PL D  +I ERQ A++E++E D+  L ++K+ L   PDLE+ +  I                        Y ++  T     +++  + + +QL+     +    +S LLR ++L +        PD+      F    +++ A+   K    S +       E    I  +  ++ E+L+  + ++ +  +N+       F +E+  S  S VPS ++  S  K   RY +  +    KKL    ++  L  +               +WT  +                          P++    P     ++I +GR P       +  +F+ N   L     +  R +     ++TGPNMGGKS+ +RQ ALI I++Q+G +VPA     L  +D ++TR GA+D+I  G+ST   E+ EA+ I+S  +  S +++DELGRGT+T+DG A+A++ L+         T+F TH+  L E E+   D++   HMA ++           E H+     D +++ + ITFLY LT G   +SYG N A+LA++P+ I+    +KA+  E
Sbjct:  447 DSRSLWRVASFESPV-ICCLGPLIQYLQEFNLERVLRSESSF-------------QRLSCESEA--------MILNAATLRNLEILNNQTDRGVRGSLFWVLDHSRTPFGRRLMRKWVSQPLTDLQRISERQDAVQEIMESDSPILDSVKSLLPRLPDLERGICSI------------------------YHKKSSTQEFYLISSHLSRLGLQLQSWIPAIRSQTRSVLLRSVLLDT--------PDLLAPAHTFLNVLNEKAARSGNKTELFSDLSGFPVLQERTKQIHFVLSEIQEHLKDIRMVLKAPTLNYITVSGQEFLIEVKNSLSSTVPSDWVKISSTKAVGRYHSPLLVERYKKLQQLREQLLLDCQR--------------EWTDFLE-------------------------PKVCEDQPQ----IMIRDGRHPAIDLLMGEQNQFVPNHTDLQG---DGKRTM-----IITGPNMGGKSSYIRQVALICIMAQIGSFVPA-SEACLGLLDGIYTRMGASDNIYKGRSTFMEELTEASEIISRATERSLVILDELGRGTSTHDGIAIAYATLEYFIRHVKSFTLFVTHYPPLCELERMYPDHVSNFHMAFLLN----------ETHISSDTKDGDVQPEFITFLYNLTEGAAGQSYGLNVAKLADVPDPILCTAARKAQELE 1021          
BLAST of msh6 vs. Ensembl Medaka
Match: msh2 (mutS homolog 2 [Source:NCBI gene;Acc:101167993])

HSP 1 Score: 159.458 bits (402), Expect = 3.270e-39
Identity = 155/600 (25.83%), Postives = 254/600 (42.33%), Query Frame = 3
Query: 1836 TAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNN--LKSCPDLEKLVAKIH------------------VLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLE---KQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINS-IAQFDAL--LSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEE 3557
            T  G+RL+ QWI  PL D  KI ER   ++  +  D+ L        L   PDL +L  K H                  + GL  +   +  S  VL + +  S   +TD     T +  +++  L+  ++   + +       ++   ++    +  D+ E +     +  +E   + GK +          ES A+       L  YL    K++K + +N  F      +  +    SK S +   Y  + +                      E+ ++ ++K I++         Y    Q ++  IAQ DA+  L+L S S  +   P  RP I  ++ G +  L + + R PC        FI N +      +   R+      ++TGPNMGGKST +RQ  +I +++Q+GC+VP E    L+  D +  R GA DS   G ST   EM E A IL   + +S ++IDELGRGT+TYDG  LA++I + IA   S   +F+THFH+L        ++   H+  +                        +T LY++  G C +S+G + A LA  P  ++    +KA+  EE
Sbjct:  334 TPQGQRLVNQWIKQPLMDKTKIEERLDLVESFV-CDSELRQTCQGDLLHRFPDLHRLAKKFHRHSATLQDCYRVYQAVSQIPGLIAAFEKYSGSYQVLLQAVFTS--PLTDLQTDFTKYQEMVETTLDMNQIDHHEFLVKASFDPVLTELRE----KMDDLEESMQAVLNSAARELGLEAGKTVKL--------ESNAM-------LGFYLRVTCKEEKGLRNNKKFTTLDVQKNGVRFTNSKLSSLNEEYTRNKEEY--------------------EEAQNAIVKEIIN-----IASGYVDPLQTLSDVIAQLDAVVSLALASVSAPV---PYVRPRI--LDEGCRR-LELVQARHPCMETDADTAFIPNDVSF----VQGERSF----YIITGPNMGGKSTYIRQVGVIALMAQIGCFVPCE-KAELSVTDSILARVGAGDSQVKGVSTFMSEMLETAAILRSATENSLIIIDELGRGTSTYDGFGLAWAISEHIASKISCFCLFATHFHELTALASQQPSVHNLHVTALTTH-------------------NTLTMLYRVKAGVCDQSFGIHVAELACFPPAVLAVAREKAEELEE 852          
BLAST of msh6 vs. Planmine SMEST
Match: SMESG000073017.1 (SMESG000073017.1)

HSP 1 Score: 1603.57 bits (4151), Expect = 0.000e+0
Identity = 790/790 (100.00%), Postives = 790/790 (100.00%), Query Frame = 3
Query: 1290 QPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDGKNISFESIKMWQNRFKKLYRI 3659
            QPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEDDNDDDVGNNECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDGKNISFESIKMWQNRFKKLYRI
Sbjct:  416 QPNEIIYLKGNLSKNTQHVFNSCLAATKKECFTNNKQFLSSEDTLSRLMSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGALLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSHMIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEDDNDDDVGNNECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLIMEFRKFLDGKNISFESIKMWQNRFKKLYRI 1205          

HSP 2 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 415/415 (100.00%), Postives = 415/415 (100.00%), Query Frame = 1
Query:   46 MQKSILSFFPKTPSSKNKQTDILNIETANSKSKVNKTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 1290
            MQKSILSFFPKTPSSKNKQTDILNIETANSKSKVNKTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF
Sbjct:    1 MQKSILSFFPKTPSSKNKQTDILNIETANSKSKVNKTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSLIFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKSINDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKKENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETIIFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLVLKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLRNRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVALVNTNTGKFTIAQFADDDQRSRFRTLISRF 415          
BLAST of msh6 vs. Planmine SMEST
Match: SMESG000016751.1 (SMESG000016751.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.086e-40
Identity = 165/617 (26.74%), Postives = 272/617 (44.08%), Query Frame = 3
Query: 1767 DLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNI--KNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPS-----------TYIASSQRKGFKRY---LTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLI 3569
            DL K+ SL G+       L+   TA G RLL+QWI  PL D + I  R   ++ LI  D  L     + NL+  PDL+++  +     L ++  +  D    +Y+ L  + R+ +D +N L   +   K         + Q+  S ++++I+            D    I  F + FD E  K +     E  +  D DES+   +     L   +E +   ++  +    T + +F+         +V               I  + + G K +   +T+  E  L+   + E+    +++ IM KI  K+     Q + +I   A+ D L SL +   G   G   RP++  ++        +   R P      +  +I+N I                  ++TGPNMGGKST +R   LI +++Q+G +VP +G  I +  DR+ TR GA D   +G ST   EM + + IL   +  S ++IDELGRGT+T+DG  LA+SI + IA      + F+THFH+L +  +I  N+   H+                  + N L      F+YK+  G   +SYG   A+ + +P++ I   L K K+ E E L+
Sbjct:  305 DLRKHDSLYGL-------LNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIN-DNKLRGCLYEENLRRIPDLQRITRR-----LQRNKGNLQD----IYK-LYVALRQASDMLNLLNEHNGPYKC--------IIQSELSSVIQEIL-----------KDTENFIQMFTSFFDFEAVKNH-----EFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHRRDYEEYERSIIEEIM-KITNKYVGSLHQLSSII---AKLDVLCSLATMVCGA-PGTYARPKV--VDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDE---------SRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEI-SIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQT--------------IGNEL-----IFMYKVEEGPAVRSYGIEVAKASGLPDESI--KLAKLKLSEYENLM 841          
BLAST of msh6 vs. Planmine SMEST
Match: SMESG000019325.1 (SMESG000019325.1)

HSP 1 Score: 114.005 bits (284), Expect = 3.214e-27
Identity = 85/267 (31.84%), Postives = 133/267 (49.81%), Query Frame = 3
Query: 2781 HINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPK-SYGFNAARLANIPEQIILNGLK-KAKIFEEETLIME 3575
            +I P     L I   R P   +  + E ISN +           NL N   ++TG NM GKS  +RQ AL+ I+ Q+GC++PAE        D LFTR G +D I S  ST  +EM E + I++ ++ +S +LIDELGRGT+  +G  + F+I + +  +       +THF +L + + +  N+Q  +     E  N  +   +E HL          F YK   G CP  +     A+L+N+P+Q++    K   ++ +   LI+E
Sbjct:    4 YIRPEFTDTLAIKNCRNPLLDRLSNKETISNHVYAA--------NLSN-FTIVTGANMSGKSMYLRQIALVQIMGQIGCFIPAEYASFRLS-DHLFTRIGVDDDIQSNSSTFTIEMREMSYIINTITDNSLVLIDELGRGTSFDEGLGICFAICEHLLQT-KAFIFIATHFRELSKLEILYPNVQNVNF----EVKNLSESDGDENHL---------LFTYKCVRGVCPDFTNAMKLAKLSNLPKQLLFEAEKIYGRLGDSNELIIE 246          
BLAST of msh6 vs. Planmine SMEST
Match: SMESG000006277.1 (SMESG000006277.1)

HSP 1 Score: 107.071 bits (266), Expect = 2.481e-23
Identity = 147/640 (22.97%), Postives = 265/640 (41.41%), Query Frame = 3
Query: 1716 YTHQSHMIIDSNTLTNLDLL-KNSSLGGIDGTLLERLDFSLTAF----------GRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN---LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPSTYIASSQRKGFKRYLTVEIEGL--LKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVI----NSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIA--DSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLI 3569
            YT    M ID N+L  LD+  K S   G    + +     L+ F             +L  W+  PL D   I +R   + +  +   N   L  +   LK   ++++++     L +  S +  PD   ++        + I   ++    F + IK  LE     ++Q I++K   K+ L               I S+     D E  +K  + + + G+D   DE  +    +   L+   E++ K  N++I   G       + +P+         Y+ +   +  +    + I G+  L  + NA   ++   KN+ + I     E   ++T ++    + + + D LLSL   +R + G   TRP       G+   + I  GR P + +  S  FI N+          + + D  + +++G N  GKS  ++Q  ++I+L+Q+G +VPA   + LTP + L TR  + +S  SG ST  V++N+ +L     + HS +LIDE G+G     G +L  + L+ +    S  P     THFH+L    +    +Q  +   + +                  K   + +LY+L  G    S+   AARL N+ + I+   ++ +  F +   I
Sbjct:   43 YTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCV-DFFQNSQNQDVLQILLRKLKGVGNIKQIL-----LRMKNSTALLPDWNVLI--------QSIAGLISIFEIF-SAIKEPLE-----IKQKIEAKFTDKLYL---------------IASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGI------VYLPQV-------GYLLTIPIENNENEQKINIPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLAIAARQIGG---TRPLFE--TSGE---IKIENGRHPLQ-EVFSNPFIPNS--------TYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPAT-KMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIED------------------KHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVSDSFAKNKTI 598          
BLAST of msh6 vs. Planmine SMEST
Match: SMESG000006277.1 (SMESG000006277.1)

HSP 1 Score: 104.375 bits (259), Expect = 1.527e-22
Identity = 149/648 (22.99%), Postives = 267/648 (41.20%), Query Frame = 3
Query: 1716 YTHQSHMIIDSNTLTNLDLL-KNSSLGGIDGTLLERLDFSLTAF----------GRRLLIQWIATPLCDPDKIIERQKAIKELIELDAN---LSNIKNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGT---GKNRFQLEIP------ESKCSKVPSTYIASSQRKGF-KRYLTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVI----NSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIA--DSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEXXXXXXXXXXECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLI 3569
            YT    M ID N+L  LD+  K S   G    + +     L+ F             +L  W+  PL D   I +R   + +  +   N   L  +   LK   ++++++     L +  S +  PD   ++        + I   ++    F + IK  LE     ++Q I++K   K+ L               I S+     D E  +K  + + + G+D   DE  +    +   L+   E++ K  N++I   G     +  + L IP      E K +     Y+ S     + K Y T +++     ++         +K++ + I     E   ++T ++    + + + D LLSL   +R + G   TRP       G+   + I  GR P + +  S  FI N+          + + D  + +++G N  GKS  ++Q  ++I+L+Q+G +VPA   + LTP + L TR  + +S  SG ST  V++N+ +L     + HS +LIDE G+G     G +L  + L+ +    S  P     THFH+L    +    +Q  +   + +                  K   + +LY+L  G    S+   AARL N+ + I+   ++ +  F +   I
Sbjct:   43 YTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCV-DFFQNSQNQDVLQILLRKLKGVGNIKQIL-----LRMKNSTALLPDWNVLI--------QSIAGLISIFEIF-SAIKEPLE-----IKQKIEAKFTDKLYL---------------IASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYLFSMNNAVYYKNYTTKKLDKEFGDILYE-------IKDLETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLAIAARQIGG---TRPLFE--TSGE---IKIENGRHPLQ-EVFSNPFIPNS--------TYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPAT-KMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIED------------------KHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVSDSFAKNKTI 612          
The following BLAST results are available for this feature:
BLAST of msh6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSH67.220e-6841.99mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329][more]
MSH63.659e-6841.79mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329][more]
MSH63.659e-6841.79mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329][more]
MSH69.846e-6841.99mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329][more]
MSH61.199e-6741.99mutS homolog 6 [Source:HGNC Symbol;Acc:HGNC:7329][more]
back to top
BLAST of msh6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh-63.001e-17633.90MSH (MutS Homolog) family [Source:UniProtKB/TrEMB... [more]
msh-21.611e-3525.00MSH (MutS Homolog) family [Source:UniProtKB/TrEMB... [more]
him-149.875e-2325.61MutS protein homolog him-14 [Source:UniProtKB/Swi... [more]
msh-52.622e-1826.01MutS protein homolog 5 [Source:UniProtKB/Swiss-Pr... [more]
msh-52.683e-1826.01MutS protein homolog 5 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of msh6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msh67.940e-15538.42gene:FBgn0036486 transcript:FBtr0075646[more]
spel12.398e-4024.33gene:FBgn0015546 transcript:FBtr0344018[more]
spel12.398e-4024.33gene:FBgn0015546 transcript:FBtr0344019[more]
spel12.398e-4024.33gene:FBgn0015546 transcript:FBtr0080630[more]
spel12.398e-4024.33gene:FBgn0015546 transcript:FBtr0309281[more]
back to top
BLAST of msh6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh60.000e+043.65mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh36.515e-6227.20mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh39.226e-6227.20mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh32.678e-6127.05mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh34.723e-6127.19mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of msh6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSH63.474e-6241.84mutS homolog 6 [Source:NCBI gene;Acc:100145639][more]
MSH63.497e-6241.49mutS homolog 6 [Source:NCBI gene;Acc:100145639][more]
MSH63.598e-6241.59mutS homolog 6 [Source:NCBI gene;Acc:100145639][more]
MSH34.165e-6129.97mutS homolog 3 [Source:NCBI gene;Acc:100486354][more]
MSH32.300e-5929.10mutS homolog 3 [Source:NCBI gene;Acc:100486354][more]
back to top
BLAST of msh6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msh62.202e-6741.92mutS homolog 6 [Source:MGI Symbol;Acc:MGI:1343961][more]
Msh36.679e-5627.65mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519][more]
Msh31.286e-5527.49mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519][more]
Msh24.429e-4026.72mutS homolog 2 [Source:MGI Symbol;Acc:MGI:101816][more]
Msh41.757e-2729.47mutS homolog 4 [Source:MGI Symbol;Acc:MGI:1860077][more]
back to top
BLAST of msh6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E1BYJ2|MSH6_CHICK5.217e-6241.32DNA mismatch repair protein Msh6 OS=Gallus gallus ... [more]
sp|P54276|MSH6_MOUSE1.540e-6641.92DNA mismatch repair protein Msh6 OS=Mus musculus O... [more]
sp|P52701|MSH6_HUMAN5.759e-6741.99DNA mismatch repair protein Msh6 OS=Homo sapiens O... [more]
sp|Q9VUM0|MSH6_DROME7.959e-15438.42Probable DNA mismatch repair protein Msh6 OS=Droso... [more]
sp|O74502|MSH6_SCHPO3.020e-12130.28DNA mismatch repair protein msh6 OS=Schizosaccharo... [more]
back to top
BLAST of msh6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F8U1P20.000e+099.61Msh6 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A1S3Q6C70.000e+042.97DNA mismatch repair protein OS=Salmo salar OX=8030... [more]
A0A444UGZ11.003e-4643.64DNA mismatch repair protein OS=Acipenser ruthenus ... [more]
A0A060XRR20.000e+043.13DNA mismatch repair protein OS=Oncorhynchus mykiss... [more]
A0A5A9P8P10.000e+043.32DNA mismatch repair protein OS=Triplophysa tibetan... [more]
back to top
BLAST of msh6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh64.266e-5242.04mutS homolog 6 [Source:NCBI gene;Acc:103027666][more]
msh64.015e-5240.22mutS homolog 6 [Source:NCBI gene;Acc:103027666][more]
msh39.722e-6228.43mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
msh39.722e-6228.43mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
msh32.322e-5427.37mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
back to top
BLAST of msh6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
msh60.000e+040.82mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh31.466e-5825.63mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of msh6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MSH61.229e-8028.66Protein required for mismatch repair in mitosis an... [more]
MSH31.419e-4527.82Mismatch repair protein; forms dimers with Msh2p t... [more]
MSH21.144e-3928.62Protein that binds to DNA mismatches; forms hetero... [more]
MSH11.597e-3425.75DNA-binding protein of the mitochondria; involved ... [more]
MSH45.208e-2525.05Protein involved in meiotic recombination; require... [more]
back to top
BLAST of msh6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387991.869e-6228.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265097.513e-4637.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383198.580e-4427.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487591.138e-3225.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394602.946e-2648.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of msh6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh60.000e+043.35mutS homolog 6 [Source:NCBI gene;Acc:101160935][more]
msh60.000e+043.35mutS homolog 6 [Source:NCBI gene;Acc:101160935][more]
msh31.964e-7028.51mutS homolog 3 [Source:NCBI gene;Acc:101156254][more]
msh31.696e-5826.77mutS homolog 3 [Source:NCBI gene;Acc:101156254][more]
msh23.270e-3925.83mutS homolog 2 [Source:NCBI gene;Acc:101167993][more]
back to top
BLAST of msh6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073017.10.000e+0100.00SMESG000073017.1[more]
SMESG000016751.11.086e-4026.74SMESG000016751.1[more]
SMESG000019325.13.214e-2731.84SMESG000019325.1[more]
SMESG000006277.12.481e-2322.97SMESG000006277.1[more]
SMESG000006277.11.527e-2222.99SMESG000006277.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027419
GenBankAEB20401.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027419 ID=SMED30027419|Name=msh6|organism=Schmidtea mediterranea sexual|type=transcript|length=3719bp
CGCAACTTTTTAAAATATAGGCCATTATTTCAAAGTTTAATTAAAATGCA
GAAATCAATTTTAAGTTTTTTTCCTAAAACTCCAAGTAGTAAAAATAAGC
AAACTGATATACTAAATATTGAAACTGCTAATTCAAAATCAAAAGTTAAC
AAAACAGATAAAATCAAGTTCAAAGATAATGACTCTATGCCAAGTACCGA
TAATAAAGATTCAGATGATTTCCGAAATAATTCAAGGAAATCTTTTAAAA
GGTTAAAGGCTTTGTCAGAAGATGACGAAAGTGATAAAGAAAATTCTTTA
ATATTTTCTACAAATAAGAAAATAAAAGTTAAACCTAATTACGAATCGCC
TCCAATGACAAAAACCGAAAACGAGTTTCTATCAGGTATCAGAAAAAATG
TTAATGCATCAACTCCTCACAAGAAAAAACCAACAAAAGACGAAAAATCA
ATTAATGATTCAACCAAAGCTCTATTGTCGTCCTTTTCAATTAATGCAAA
TGATTCTAATATCGAAACAAATATATCTCAAGTAATTGAGGACGATTTTA
AGAACGATATCGAAAGCTATGAACATTTCTCTTATGAATTCTTGAAGAAA
GAAAATATTCGAGATGCACAGAGACGAAAACCAGACCATCCGGATTATGA
TCCCACAACGCTTTTTATACCAGAATCTTTTATGTCTAAACTGACTCCTG
GTTTAAAACAATGGTGGAAAATAAAAGCCAATGGAAATATGGAAACAATT
ATTTTCTTCAAAGTTGGAAAATTCTATGAGCTATATCATATGGACGCTGT
CACTGCAGTTAGTGAATTGGGTTTAACGTACATGCGGGGTAATTACGCTC
ATTCTGGATTTCCAGAAATAGCTTTTTCCAAAATGGCAGATCAACTCGTT
TTAAAAGGGTTTAAAGTTGCTCGTGTGGAGCAAACAGAAACTGTTGAAGC
GATGACTGAACGTATTAAACATGAATCGTCTAAAAACAAAGTAGTAAATC
GAGAGATATGTCAAGTCATAACTCCAGGTACTCGAGGTTTTAGTTTGCGA
AATAGAACTTGTCGAGAAACTGGCCAAGAAGGTAGTGAGGAATTGGGTTA
CATAGAAGATGCCGGGGGCCTACTGTACTCTTTTAAGGAGTCGTTGATTG
AAGAGAATGTTAAGGGCAAATTAAAAAATACTGTCAACATTGGAGTCGCT
TTGGTAAATACTAATACGGGGAAATTTACGATTGCACAATTTGCAGATGA
TGATCAAAGGTCACGTTTCAGGACATTGATTTCTCGGTTCAACCTAATGA
AATCATTTATCTCAAAGGAAATTTATCAAAAAATACTCAGCATGTTTTTA
ATTCTTGTCTTGCTGCAACCAAGAAAGAATGTTTTACTAACAATAAGCAA
TTTCTTAGTAGTGAAGATACACTGTCTCGCCTGATGTCTTCTGATTACTT
TGCTGAAACTCCTGCCAATAAGTTATCGCGATTTGGATTACCAAATGGCT
TGACTAAAACTTTGAATGAAGCTGATAATTTGGGTCGTTCTTCTTCTAAA
GAATATGAGTTAGCTGTCAGCTGTTTAGGTGCTTTGCTTTATTACCTGGG
GAAATGTTTGATCGATAAGTATTTGGTATCTATTGCTGATTTCAATCTAT
ATTACCCTTCTGATGGTGATTGTATTCAACCTCACCAATTAGCTATAGAT
GATAAGGAACCATTTTATACTCACCAATCTCACATGATTATTGATAGCAA
CACTTTGACTAATTTGGATTTATTAAAAAATAGTAGTTTGGGTGGAATCG
ATGGAACATTGCTGGAAAGATTGGACTTTTCATTAACGGCATTCGGACGT
CGATTACTTATTCAATGGATTGCTACTCCTCTTTGCGATCCAGATAAAAT
AATTGAAAGGCAAAAAGCAATTAAAGAGTTAATCGAGTTGGATGCTAATC
TTAGCAATATTAAAAACAATCTCAAATCGTGTCCTGATTTAGAGAAATTA
GTGGCCAAAATCCATGTTCTGGGTTTGAGTAAATCTGTATCGGATCATCC
AGATTCTCGTGCAGTATTATATGAAGGACTTCTTTATTCCAGAAGAAAAA
TAACCGATTTTGTCAATACATTGACTGCATTCGATAACATAATAAAAATA
CAACTGGAATTTACTCGAATGCATGTTGAACAAAATATACAATCAAAATT
ACTTCGGAAGATAATGTTGCATTCTAAAGATTCAAAAATTGGCGAATTTC
CTGACATCTCTGAAATCATTAGTTTTTTCAAAACCGCATTTGATCAAGAG
AATGCGAAAAAGAATGGAAAAATAATTCCAGAATCTGGAATCGATGCAGA
TTACGATGAGTCGGTTGCATTGATCAAGGAAATTGAGCGTGATCTAGCAG
AATATTTAGAAAAACAAAAGAAAATAATTAATAGCAATATCAATTTTTTT
GGTACTGGCAAAAATCGATTTCAATTAGAAATACCTGAATCAAAATGTTC
TAAGGTTCCATCGACATATATTGCTTCTAGCCAAAGGAAAGGATTTAAAA
GATATTTAACTGTGGAAATTGAAGGATTATTAAAAAAACTGATAAACGCA
GAAGATAAGCGTGATTTAGTTCTGAAGAATATAATGAGTAAAATCTTTGC
CAAATTCGATGAGCACTATTTTCAATGGACTCAAGTTATTAATTCTATCG
CTCAATTTGATGCTCTTCTATCTCTGACTTCGTTTAGTCGTGGTTTAGAC
GGGGGTCCTATGACCAGGCCGGAAATAAGGCATATAAATCCCGGGGATAA
ACCTTTTCTAATAATTACTGAAGGAAGATTTCCATGTAAAGCTAAGACTC
AATCAGGAGAATTTATATCCAACACCATAAAGCTCGGATCATTGCTAATG
AATTCAAATAGAAACCTTGACAATCCGGTAATGTTACTCACTGGGCCGAA
TATGGGGGGCAAGTCAACTCTTATGCGCCAAACTGCTCTAATAATCATAC
TCTCACAATTGGGCTGTTATGTCCCAGCCGAGGGCCCGGTAATTTTAACT
CCTGTAGATCGATTATTTACGAGACAAGGTGCAAATGATTCTATTGGATC
TGGTCAATCAACACTTCAAGTGGAAATGAATGAAGCAGCATTGATTTTGT
CATACATGTCACCACATTCGTTTCTGCTTATCGATGAACTCGGTCGCGGT
ACTGCTACATATGATGGCTGCGCATTAGCGTTTTCGATTTTGAAAAGAAT
TGCAGATAGTTGCAGTCCTAGAACTATCTTTAGCACGCATTTTCATAAAT
TACTCGAGGAAAAAGAAATCGGGGACAACCTACAAATTAGTCACATGGCT
TGCATGATTGAAGATGATAACGATGATGATGTTGGGAATAATGAATGTCA
TTTGGACAATAACTTAAAGTTACAAAACATCACTTTCCTTTATAAATTAA
CCCATGGCGGTTGTCCGAAAAGTTATGGCTTCAATGCAGCAAGATTGGCC
AATATTCCTGAACAGATAATATTAAACGGGTTGAAAAAAGCTAAAATATT
TGAAGAGGAAACTTTAATTATGGAATTTAGAAAATTTTTAGATGGAAAAA
ATATTTCATTTGAATCGATTAAGATGTGGCAGAATCGATTCAAGAAACTT
TATAGAATATAATAACCAGGCTATTCGTAGATTTATAGATGTGCTTTGTT
TATAATAAAAAAATTTAGC
back to top

protein sequence of SMED30027419-orf-1

>SMED30027419-orf-1 ID=SMED30027419-orf-1|Name=SMED30027419-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=743bp
MSSDYFAETPANKLSRFGLPNGLTKTLNEADNLGRSSSKEYELAVSCLGA
LLYYLGKCLIDKYLVSIADFNLYYPSDGDCIQPHQLAIDDKEPFYTHQSH
MIIDSNTLTNLDLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPL
CDPDKIIERQKAIKELIELDANLSNIKNNLKSCPDLEKLVAKIHVLGLSK
SVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQ
NIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPE
SGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEI
PESKCSKVPSTYIASSQRKGFKRYLTVEIEGLLKKLINAEDKRDLVLKNI
MSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRH
INPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVM
LLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGA
NDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAF
SILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEDDNDDDV
GNNECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGL
KKAKIFEEETLIMEFRKFLDGKNISFESIKMWQNRFKKLYRI*
back to top

protein sequence of SMED30027419-orf-2

>SMED30027419-orf-2 ID=SMED30027419-orf-2|Name=SMED30027419-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=478bp
RNFLKYRPLFQSLIKMQKSILSFFPKTPSSKNKQTDILNIETANSKSKVN
KTDKIKFKDNDSMPSTDNKDSDDFRNNSRKSFKRLKALSEDDESDKENSL
IFSTNKKIKVKPNYESPPMTKTENEFLSGIRKNVNASTPHKKKPTKDEKS
INDSTKALLSSFSINANDSNIETNISQVIEDDFKNDIESYEHFSYEFLKK
ENIRDAQRRKPDHPDYDPTTLFIPESFMSKLTPGLKQWWKIKANGNMETI
IFFKVGKFYELYHMDAVTAVSELGLTYMRGNYAHSGFPEIAFSKMADQLV
LKGFKVARVEQTETVEAMTERIKHESSKNKVVNREICQVITPGTRGFSLR
NRTCRETGQEGSEELGYIEDAGGLLYSFKESLIEENVKGKLKNTVNIGVA
LVNTNTGKFTIAQFADDDQRSRFRTLISRFNLMKSFISKEIYQKILSMFL
ILVLLQPRKNVLLTISNFLVVKIHCLA*
back to top
Aliases
The feature 'msh6' has the following synonyms
Synonym
msh6
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043570maintenance of DNA repeat elements
GO:0006298mismatch repair
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0007095mitotic G2 DNA damage checkpoint
GO:0008340determination of adult lifespan
GO:0008630intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009411response to UV
GO:0016446somatic hypermutation of immunoglobulin genes
GO:0016447somatic recombination of immunoglobulin gene segments
GO:0030890positive regulation of B cell proliferation
GO:0032876negative regulation of DNA endoreduplication
GO:0045190isotype switching
GO:0045830positive regulation of isotype switching
GO:0045910negative regulation of DNA recombination
GO:0051096positive regulation of helicase activity
GO:0097193intrinsic apoptotic signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007860DNA_mmatch_repair_MutS_con_dom
IPR036678MutS_con_dom_sf
IPR007696DNA_mismatch_repair_MutS_core
IPR000432DNA_mismatch_repair_MutS_C
IPR007861DNA_mismatch_repair_MutS_clamp
IPR027417P-loop_NTPase
IPR007695DNA_mismatch_repair_MutS-lik_N
IPR016151DNA_mismatch_repair_MutS_N
Vocabulary: molecular function
TermDefinition
GO:0030983mismatched DNA binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0000400four-way junction DNA binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0003684damaged DNA binding
GO:0003690double-stranded DNA binding
GO:0016887ATPase activity
GO:0032137guanine/thymine mispair binding
GO:0032142single guanine insertion binding
GO:0032143single thymine insertion binding
GO:0032357oxidized purine DNA binding
GO:0032405MutLalpha complex binding
GO:0035064methylated histone binding
GO:0043531ADP binding
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0032301MutSalpha complex
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007860DNA mismatch repair protein MutS, connector domainPFAMPF05188MutS_IIcoord: 395..446
e-value: 4.7E-9
score: 36.6
IPR016151DNA mismatch repair protein MutS, N-terminalGENE3DG3DSA:3.40.1170.10coord: 188..352
e-value: 3.0E-64
score: 217.8
IPR016151DNA mismatch repair protein MutS, N-terminalSUPERFAMILYSSF55271DNA repair protein MutS, domain Icoord: 220..344
IPR036678MutS, connector domain superfamilyGENE3DG3DSA:3.30.420.110coord: 379..478
e-value: 5.6E-26
score: 93.3
IPR036678MutS, connector domain superfamilySUPERFAMILYSSF53150DNA repair protein MutS, domain IIcoord: 396..462
IPR007695DNA mismatch repair protein MutS-like, N-terminalPFAMPF01624MutS_Icoord: 232..344
e-value: 2.0E-31
score: 108.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..152
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..75
NoneNo IPR availablePANTHERPTHR11361DNA MISMATCH REPAIR PROTEIN MUTS FAMILY MEMBERcoord: 113..454
NoneNo IPR availablePANTHERPTHR11361:SF134DNA MISMATCH REPAIR PROTEIN MSH6coord: 113..454