Protein split ends

Overview
NameProtein split ends
Smed IDSMED30027416
Length (bp)8912
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein split ends (SMED30027416) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein split ends (SMED30027416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein split ends (SMED30027416) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein split ends (SMED30027416) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027416

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027416SMESG000016300.1 dd_Smed_v4_6458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027416SMESG000016300.1 dd_Smed_v4_6458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027416SMESG000016300.1 SMESG000016301.1 Contig12493uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027416SMESG000016300.1 SMESG000016301.1 Contig12493newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30027416SMESG000016300.1 SMESG000010233.1 dd_Smed_v4_5326_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027416SMESG000016300.1 dd_Smed_v4_6458_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein split ends vs. Ensembl Human
Match: SPEN (spen family transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:17575])

HSP 1 Score: 239.965 bits (611), Expect = 1.296e-65
Identity = 126/293 (43.00%), Postives = 189/293 (64.51%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPD------LCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYAD 1525
            G+ ++NL  RS+DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+        +I P+        P +  +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+ ++ +E AQ A+ +T+ R  G GN   +++VD+A+ E Q+AF + + KS Q D  D  +  A+
Sbjct:  268 GIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTA-----WIGPETESENEFRPLDERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVP--QYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKGRKIG-GN---KIKVDFANRESQLAFYHCMEKSGQ-DIRDFYEMLAE 547          
BLAST of Protein split ends vs. Ensembl Human
Match: SPEN (spen family transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:17575])

HSP 1 Score: 238.81 bits (608), Expect = 8.080e-62
Identity = 126/295 (42.71%), Postives = 188/295 (63.73%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKA--------KQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYAD 1525
            G+ ++NL  RS+DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+         +  N F  +D         +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+ ++ +E AQ A+ +T+ R  G GN   +++VD+A+ E Q+AF + + KS Q D  D  +  A+
Sbjct:  336 GIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWIGPETESENEFRPLD-------ERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKGRKIG-GN---KIKVDFANRESQLAFYHCMEKSGQ-DIRDFYEMLAE 615          

HSP 2 Score: 125.561 bits (314), Expect = 1.553e-27
Identity = 74/164 (45.12%), Postives = 90/164 (54.88%), Query Frame = 2
Query: 7868 PFPKFDEKDDWLKQNK----QTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQL 8347
            P PK D       Q      Q    YP+ W G L LKND   VQ+H ++GN  L   S+ L   G     PLRI QRMRLE  QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L
Sbjct: 3480 PAPKQDSSPHLTSQRPVDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGP----PLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHL 3639          

HSP 3 Score: 57.7658 bits (138), Expect = 5.016e-7
Identity = 27/85 (31.76%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G++++++I     S G + A   F+D KS+ KA  SV  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. Ensembl Human
Match: SPEN (spen family transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:17575])

HSP 1 Score: 207.994 bits (528), Expect = 6.518e-59
Identity = 104/230 (45.22%), Postives = 151/230 (65.65%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDP------DLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALI 1336
            G+ ++NL  RS+DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+        +I P      +  P +  +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+
Sbjct:   76 GIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTA-----WIGPETESENEFRPLDERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVP--QYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALV 297          
BLAST of Protein split ends vs. Ensembl Human
Match: RBM15 (RNA binding motif protein 15 [Source:HGNC Symbol;Acc:HGNC:14959])

HSP 1 Score: 98.9821 bits (245), Expect = 1.106e-19
Identity = 62/188 (32.98%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  929 PEHAMDEYHP----KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            P   +DE  P    +A +TLF+G L   +VTESDL+++F +FG I ++DIK  S    +++ F+++ ++    RA        I    +K+G+GK+ PT  LW+G L      A L R F R+G I  +      S A IQ++ ++ A  A T    R    G  ++R++VD+A  E  YQ  ++  L
Sbjct:  313 PFREVDEISPEDDQRANRTLFLGNLDI-TVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHM--RGFPLGGPDRRLRVDFADTEHRYQQQYLQPL 497          

HSP 2 Score: 60.4622 bits (145), Expect = 5.431e-8
Identity = 42/154 (27.27%), Postives = 78/154 (50.65%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILND--------NFIKYLQEKSAAGIINICIP--ESQQNAYVIHIFPPCEFSDNQLKNCCSKL 8368
            W G L LKN      MH++ G+  +  + +   S G  ++Q L+I QR+RL+  +L+ + RR+    P  +   L + G       + +++            N + YL++K AAG+I++ +   + ++N  V+H FPP +  + ++K   SKL
Sbjct:  744 WQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQ-LKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPSKLVEQRMKIWNSKL 896          
BLAST of Protein split ends vs. Ensembl Human
Match: RBM15 (RNA binding motif protein 15 [Source:HGNC Symbol;Acc:HGNC:14959])

HSP 1 Score: 98.9821 bits (245), Expect = 1.116e-19
Identity = 62/188 (32.98%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  929 PEHAMDEYHP----KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            P   +DE  P    +A +TLF+G L   +VTESDL+++F +FG I ++DIK  S    +++ F+++ ++    RA        I    +K+G+GK+ PT  LW+G L      A L R F R+G I  +      S A IQ++ ++ A  A T    R    G  ++R++VD+A  E  YQ  ++  L
Sbjct:  313 PFREVDEISPEDDQRANRTLFLGNLDI-TVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHM--RGFPLGGPDRRLRVDFADTEHRYQQQYLQPL 497          

HSP 2 Score: 65.4698 bits (158), Expect = 1.938e-9
Identity = 46/161 (28.57%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILND--------NFIKYLQEKSAAGIINICIP--ESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            W G L LKN      MH++ G+  +  + +   S G  ++Q L+I QR+RL+  +L+ + RR+    P  +   L + G       + +++            N + YL++K AAG+I++ +   + ++N  V+H FPPCEFS  Q  +  +K   K +E+
Sbjct:  744 WQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQ-LKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFS-QQFLDSPAKALAKSEED 902          
BLAST of Protein split ends vs. Ensembl Celegans
Match: din-1 (Daf-12-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK6])

HSP 1 Score: 89.3521 bits (220), Expect = 1.290e-19
Identity = 46/148 (31.08%), Postives = 82/148 (55.41%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNL-ISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLK 8383
            WTG+L LK+ E  + +H+I G+E  + + +   ++        ++I+QR+RL+  Q+E + R LT P E+  CL L+  + +E L +  + L  +FI YL  K  AGI ++   E++  +  +H+F P E  +  L    + L+D L+
Sbjct:    3 WTGRLALKSTEAMINLHLINGSETFLNDVLGRQVTEENPRRDSVKILQRLRLDNGQVEHIYRILTNP-EYACCLALSSVNNIENLKENDTNLKSHFIDYLINKKIAGISSLGEVETKFKSARVHVFAPGEIVNRYLSELATSLHDYLQ 149          
BLAST of Protein split ends vs. Ensembl Celegans
Match: din-1 (Daf-12-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK6])

HSP 1 Score: 89.3521 bits (220), Expect = 1.290e-19
Identity = 46/148 (31.08%), Postives = 82/148 (55.41%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNL-ISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLK 8383
            WTG+L LK+ E  + +H+I G+E  + + +   ++        ++I+QR+RL+  Q+E + R LT P E+  CL L+  + +E L +  + L  +FI YL  K  AGI ++   E++  +  +H+F P E  +  L    + L+D L+
Sbjct:    3 WTGRLALKSTEAMINLHLINGSETFLNDVLGRQVTEENPRRDSVKILQRLRLDNGQVEHIYRILTNP-EYACCLALSSVNNIENLKENDTNLKSHFIDYLINKKIAGISSLGEVETKFKSARVHVFAPGEIVNRYLSELATSLHDYLQ 149          
BLAST of Protein split ends vs. Ensembl Celegans
Match: din-1 (Daf-12-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK6])

HSP 1 Score: 92.8189 bits (229), Expect = 1.445e-18
Identity = 47/152 (30.92%), Postives = 85/152 (55.92%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNL-ISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLK 8383
            +P+ WTG+L LK+ E  + +H+I G+E  + + +   ++        ++I+QR+RL+  Q+E + R LT P E+  CL L+  + +E L +  + L  +FI YL  K  AGI ++   E++  +  +H+F P E  +  L    + L+D L+
Sbjct:  380 FPMVWTGRLALKSTEAMINLHLINGSETFLNDVLGRQVTEENPRRDSVKILQRLRLDNGQVEHIYRILTNP-EYACCLALSSVNNIENLKENDTNLKSHFIDYLINKKIAGISSLGEVETKFKSARVHVFAPGEIVNRYLSELATSLHDYLQ 530          
BLAST of Protein split ends vs. Ensembl Celegans
Match: din-1 (Daf-12-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK6])

HSP 1 Score: 92.8189 bits (229), Expect = 1.445e-18
Identity = 47/152 (30.92%), Postives = 85/152 (55.92%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNL-ISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLK 8383
            +P+ WTG+L LK+ E  + +H+I G+E  + + +   ++        ++I+QR+RL+  Q+E + R LT P E+  CL L+  + +E L +  + L  +FI YL  K  AGI ++   E++  +  +H+F P E  +  L    + L+D L+
Sbjct:  380 FPMVWTGRLALKSTEAMINLHLINGSETFLNDVLGRQVTEENPRRDSVKILQRLRLDNGQVEHIYRILTNP-EYACCLALSSVNNIENLKENDTNLKSHFIDYLINKKIAGISSLGEVETKFKSARVHVFAPGEIVNRYLSELATSLHDYLQ 530          
BLAST of Protein split ends vs. Ensembl Celegans
Match: din-1 (Daf-12-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK6])

HSP 1 Score: 88.5817 bits (218), Expect = 8.143e-17
Identity = 47/152 (30.92%), Postives = 85/152 (55.92%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNL-ISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLK 8383
            +P+ WTG+L LK+ E  + +H+I G+E  + + +   ++        ++I+QR+RL+  Q+E + R LT P E+  CL L+  + +E L +  + L  +FI YL  K  AGI ++   E++  +  +H+F P E  +  L    + L+D L+
Sbjct: 2220 FPMVWTGRLALKSTEAMINLHLINGSETFLNDVLGRQVTEENPRRDSVKILQRLRLDNGQVEHIYRILTNP-EYACCLALSSVNNIENLKENDTNLKSHFIDYLINKKIAGISSLGEVETKFKSARVHVFAPGEIVNRYLSELATSLHDYLQ 2370          
BLAST of Protein split ends vs. Ensembl Fly
Match: spen (gene:FBgn0016977 transcript:FBtr0078121)

HSP 1 Score: 241.891 bits (616), Expect = 5.641e-63
Identity = 126/271 (46.49%), Postives = 175/271 (64.58%), Query Frame = 2
Query:  650 NKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            N+ L  + + NL  RSSDTSL++GLFHEYKKHGK+T V V+GQ S RYA++ FK+ +D+EKA E S  K FFG  I+ + + G++  D +  P E  +DEYHPK+T+TLF+G L    +T  +L+  F+ FGEII+IDIK Q      ++AF QY DI SVV+A+R  D   + S  +KLGFGKS PTNC+WI  +    +++FL+  F R+G +  V  D     AL+ +D V++AQ A+ D R    G     K++QVD+AS E Q AF
Sbjct:  551 NRPLA-IRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKSTRTLFIGNLEK-DITAGELRSHFEAFGEIIEIDIKKQGL---NAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQVQNAQAAVKDMR----GTILRRKKLQVDFASRECQDAF 812          

HSP 2 Score: 133.65 bits (335), Expect = 2.737e-30
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSM-NLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKE 8386
            YPV W G L LK D+  VQMH + GN ++ + S+ +L+     L   LRI QRMRLE  QLEG+ +++    E C  L L  G    ++ Q S  L   FI YLQ+K AAGI+NI IP S+Q AYV+HIFP C+F++  L+     L +++ E
Sbjct: 5373 YPVMWQGLLALKTDQAAVQMHFVHGNPNVARASLPSLVETNTPL---LRIAQRMRLEQTQLEGVAKKMQVDKEHCMLLALPCGRDHADVLQHSRNLQTGFITYLQQKMAAGIVNIPIPGSEQAAYVVHIFPSCDFANENLERAAPDLKNRVAE 5522          
BLAST of Protein split ends vs. Ensembl Fly
Match: spen (gene:FBgn0016977 transcript:FBtr0078122)

HSP 1 Score: 241.506 bits (615), Expect = 5.939e-63
Identity = 126/271 (46.49%), Postives = 175/271 (64.58%), Query Frame = 2
Query:  650 NKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            N+ L  + + NL  RSSDTSL++GLFHEYKKHGK+T V V+GQ S RYA++ FK+ +D+EKA E S  K FFG  I+ + + G++  D +  P E  +DEYHPK+T+TLF+G L    +T  +L+  F+ FGEII+IDIK Q      ++AF QY DI SVV+A+R  D   + S  +KLGFGKS PTNC+WI  +    +++FL+  F R+G +  V  D     AL+ +D V++AQ A+ D R    G     K++QVD+AS E Q AF
Sbjct:  551 NRPLA-IRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKSTRTLFIGNLEK-DITAGELRSHFEAFGEIIEIDIKKQGL---NAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQVQNAQAAVKDMR----GTILRRKKLQVDFASRECQDAF 812          

HSP 2 Score: 133.65 bits (335), Expect = 2.785e-30
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSM-NLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKE 8386
            YPV W G L LK D+  VQMH + GN ++ + S+ +L+     L   LRI QRMRLE  QLEG+ +++    E C  L L  G    ++ Q S  L   FI YLQ+K AAGI+NI IP S+Q AYV+HIFP C+F++  L+     L +++ E
Sbjct: 5400 YPVMWQGLLALKTDQAAVQMHFVHGNPNVARASLPSLVETNTPL---LRIAQRMRLEQTQLEGVAKKMQVDKEHCMLLALPCGRDHADVLQHSRNLQTGFITYLQQKMAAGIVNIPIPGSEQAAYVVHIFPSCDFANENLERAAPDLKNRVAE 5549          
BLAST of Protein split ends vs. Ensembl Fly
Match: spen (gene:FBgn0016977 transcript:FBtr0078123)

HSP 1 Score: 241.506 bits (615), Expect = 5.966e-63
Identity = 126/271 (46.49%), Postives = 175/271 (64.58%), Query Frame = 2
Query:  650 NKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            N+ L  + + NL  RSSDTSL++GLFHEYKKHGK+T V V+GQ S RYA++ FK+ +D+EKA E S  K FFG  I+ + + G++  D +  P E  +DEYHPK+T+TLF+G L    +T  +L+  F+ FGEII+IDIK Q      ++AF QY DI SVV+A+R  D   + S  +KLGFGKS PTNC+WI  +    +++FL+  F R+G +  V  D     AL+ +D V++AQ A+ D R    G     K++QVD+AS E Q AF
Sbjct:  494 NRPLA-IRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKSTRTLFIGNLEK-DITAGELRSHFEAFGEIIEIDIKKQGL---NAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQVQNAQAAVKDMR----GTILRRKKLQVDFASRECQDAF 755          

HSP 2 Score: 133.65 bits (335), Expect = 2.621e-30
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSM-NLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKE 8386
            YPV W G L LK D+  VQMH + GN ++ + S+ +L+     L   LRI QRMRLE  QLEG+ +++    E C  L L  G    ++ Q S  L   FI YLQ+K AAGI+NI IP S+Q AYV+HIFP C+F++  L+     L +++ E
Sbjct: 5316 YPVMWQGLLALKTDQAAVQMHFVHGNPNVARASLPSLVETNTPL---LRIAQRMRLEQTQLEGVAKKMQVDKEHCMLLALPCGRDHADVLQHSRNLQTGFITYLQQKMAAGIVNIPIPGSEQAAYVVHIFPSCDFANENLERAAPDLKNRVAE 5465          
BLAST of Protein split ends vs. Ensembl Fly
Match: spen (gene:FBgn0016977 transcript:FBtr0332337)

HSP 1 Score: 241.506 bits (615), Expect = 6.164e-63
Identity = 126/271 (46.49%), Postives = 175/271 (64.58%), Query Frame = 2
Query:  650 NKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            N+ L  + + NL  RSSDTSL++GLFHEYKKHGK+T V V+GQ S RYA++ FK+ +D+EKA E S  K FFG  I+ + + G++  D +  P E  +DEYHPK+T+TLF+G L    +T  +L+  F+ FGEII+IDIK Q      ++AF QY DI SVV+A+R  D   + S  +KLGFGKS PTNC+WI  +    +++FL+  F R+G +  V  D     AL+ +D V++AQ A+ D R    G     K++QVD+AS E Q AF
Sbjct:  494 NRPLA-IRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKSTRTLFIGNLEK-DITAGELRSHFEAFGEIIEIDIKKQGL---NAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQVQNAQAAVKDMR----GTILRRKKLQVDFASRECQDAF 755          

HSP 2 Score: 133.65 bits (335), Expect = 2.687e-30
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSM-NLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKE 8386
            YPV W G L LK D+  VQMH + GN ++ + S+ +L+     L   LRI QRMRLE  QLEG+ +++    E C  L L  G    ++ Q S  L   FI YLQ+K AAGI+NI IP S+Q AYV+HIFP C+F++  L+     L +++ E
Sbjct: 5298 YPVMWQGLLALKTDQAAVQMHFVHGNPNVARASLPSLVETNTPL---LRIAQRMRLEQTQLEGVAKKMQVDKEHCMLLALPCGRDHADVLQHSRNLQTGFITYLQQKMAAGIVNIPIPGSEQAAYVVHIFPSCDFANENLERAAPDLKNRVAE 5447          
BLAST of Protein split ends vs. Ensembl Fly
Match: spen (gene:FBgn0016977 transcript:FBtr0306341)

HSP 1 Score: 241.506 bits (615), Expect = 6.497e-63
Identity = 126/271 (46.49%), Postives = 175/271 (64.58%), Query Frame = 2
Query:  650 NKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            N+ L  + + NL  RSSDTSL++GLFHEYKKHGK+T V V+GQ S RYA++ FK+ +D+EKA E S  K FFG  I+ + + G++  D +  P E  +DEYHPK+T+TLF+G L    +T  +L+  F+ FGEII+IDIK Q      ++AF QY DI SVV+A+R  D   + S  +KLGFGKS PTNC+WI  +    +++FL+  F R+G +  V  D     AL+ +D V++AQ A+ D R    G     K++QVD+AS E Q AF
Sbjct:  496 NRPLA-IRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKSTRTLFIGNLEK-DITAGELRSHFEAFGEIIEIDIKKQGL---NAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQVQNAQAAVKDMR----GTILRRKKLQVDFASRECQDAF 757          

HSP 2 Score: 133.65 bits (335), Expect = 2.735e-30
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSM-NLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKE 8386
            YPV W G L LK D+  VQMH + GN ++ + S+ +L+     L   LRI QRMRLE  QLEG+ +++    E C  L L  G    ++ Q S  L   FI YLQ+K AAGI+NI IP S+Q AYV+HIFP C+F++  L+     L +++ E
Sbjct: 5345 YPVMWQGLLALKTDQAAVQMHFVHGNPNVARASLPSLVETNTPL---LRIAQRMRLEQTQLEGVAKKMQVDKEHCMLLALPCGRDHADVLQHSRNLQTGFITYLQQKMAAGIVNIPIPGSEQAAYVVHIFPSCDFANENLERAAPDLKNRVAE 5494          
BLAST of Protein split ends vs. Ensembl Zebrafish
Match: si:ch1073-335m2.2 (si:ch1073-335m2.2 [Source:ZFIN;Acc:ZDB-GENE-081104-82])

HSP 1 Score: 230.72 bits (587), Expect = 1.482e-59
Identity = 119/276 (43.12%), Postives = 177/276 (64.13%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNY-IDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS+DTSL++GLFHE+KK+GK+TSV + G +  RY ++ F++ ED EKA   S+GK+FFG LI+    NG     + +  P +  +DE+HPKAT+TLF+G L   +     L   F++FGEI+DIDIK  +  P   +AFVQY DI+SV +A++  D   + +  +KLGFGKS PT C+W+  L  N  + +L RHF RYGP++ V+ D     AL+ ++  + AQ A+ +T+    G GN   +++VD+AS E QMAF   ++ S Q
Sbjct:  341 GIRVQNLPTRSTDTSLKDGLFHEFKKYGKVTSVQIHGASEERYGLVFFRQQEDQEKALSVSKGKLFFGMLIEVTAWNGPETESENEFRPLDGRIDEFHPKATRTLFIGNLEK-TTNYQQLLDVFQRFGEIVDIDIKRVNGVPQ--YAFVQYSDIASVCKAIKKMDGEYLGTNRLKLGFGKSMPTACVWLDGLTSNITEQYLTRHFCRYGPVVKVVFDRLKGMALVLYNNTDFAQAAVRETKGWKIG-GN---KIKVDFASQESQMAFYRSMQASGQ 609          

HSP 2 Score: 120.168 bits (300), Expect = 4.077e-26
Identity = 69/154 (44.81%), Postives = 89/154 (57.79%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEES 8392
            YP+ W G L LKND   VQ+H + GN+ L   S+ L  +G  L    RIVQRMRLE  QLEG+ RR+T   +FC  L +  G   E++   +  L   FI YLQ K AAGIIN+  P S Q A+V+ IFPPCEFS++ L      L  ++   S
Sbjct: 2980 YPIVWQGLLALKNDTAAVQLHFLCGNKALGLRSLPLPESGGIL----RIVQRMRLEAQQLEGVARRMTGESDFCLLLAMPCGLDQEDVLNQTQALKSAFINYLQAKLAAGIINVPNPGSNQPAFVLQIFPPCEFSESHLSRLAPDLLSQISSIS 3129          

HSP 3 Score: 55.0694 bits (131), Expect = 2.081e-6
Identity = 24/85 (28.24%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  +  E  I + F+  G+++++++ +   S G + A   F+D KS+ KA  +V  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPEHVREEKIVEHFKRFGRVESVKVLRKRGSEGGVAAFVDFVDIKSAQKAHNAVNKMGDRDLRTDYNEPGSVP 85          
BLAST of Protein split ends vs. Ensembl Zebrafish
Match: spen (spen family transcriptional repressor [Source:ZFIN;Acc:ZDB-GENE-050309-70])

HSP 1 Score: 228.409 bits (581), Expect = 7.302e-59
Identity = 119/276 (43.12%), Postives = 178/276 (64.49%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQ-HNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS+DTSL++GLFHE+KKHGK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I     H      + +  P +  +DE+HPKAT+TLF+G L   + T +DL   F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PT C+W+  L  +  + +L RHF RYG ++ V+ D     ALI ++ +E AQ A+ +T+    G GN   +++VD+A+ E QMAF   ++ S Q
Sbjct:  384 GIKVQNLPVRSTDTSLKDGLFHEFKKHGKVTSVQIHGASEERYGLVFFRQQEDQEKALSASKGKLFFGMQIDVTAWHGPETESENEFRPLDERIDEFHPKATRTLFIGNLEK-TTTYNDLLNIFQRFGEIVDIDIKKVNGSPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTTCVWLDGLSSSITEQYLTRHFCRYGHVVKVVFDRLKGMALILYNNIEYAQAAVKETKGWKIG-GN---KIKVDFANQESQMAFYRSMQGSGQ 652          

HSP 2 Score: 131.724 bits (330), Expect = 1.196e-29
Identity = 68/146 (46.58%), Postives = 85/146 (58.22%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKL 8368
            YP+ W G L LKND   VQ+H ++GN  L   S+     G  L    RI QRMRLE +QLEG+ RR+T   E+C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L +    L
Sbjct: 3317 YPIIWQGHLALKNDTAAVQLHFVSGNNVLAHRSLPPPEGGAFL----RIAQRMRLEASQLEGVARRMTAENEYCLLLALPCGLDQEDVHNQTHALKTGFITYLQAKQAAGIINVPNPGSNQPAYVVQIFPPCEFSESHLSHLAPDL 3458          

HSP 3 Score: 56.225 bits (134), Expect = 9.695e-7
Identity = 25/85 (29.41%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G+++++++     S G + A   F+D KS+ KA  S+  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKVLPKRGSEGGVAAFVDFVDIKSAQKAHNSINKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. Ensembl Zebrafish
Match: spen (spen family transcriptional repressor [Source:ZFIN;Acc:ZDB-GENE-050309-70])

HSP 1 Score: 132.88 bits (333), Expect = 5.120e-30
Identity = 68/146 (46.58%), Postives = 85/146 (58.22%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKL 8368
            YP+ W G L LKND   VQ+H ++GN  L   S+     G  L    RI QRMRLE +QLEG+ RR+T   E+C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L +    L
Sbjct: 2340 YPIIWQGHLALKNDTAAVQLHFVSGNNVLAHRSLPPPEGGAFL----RIAQRMRLEASQLEGVARRMTAENEYCLLLALPCGLDQEDVHNQTHALKTGFITYLQAKQAAGIINVPNPGSNQPAYVVQIFPPCEFSESHLSHLAPDL 2481          
BLAST of Protein split ends vs. Ensembl Zebrafish
Match: rbm15 (RNA binding motif protein 15 [Source:ZFIN;Acc:ZDB-GENE-041008-192])

HSP 1 Score: 97.4413 bits (241), Expect = 1.610e-19
Identity = 55/174 (31.61%), Postives = 96/174 (55.17%), Query Frame = 2
Query:  959 KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            +A +TLF+G L   +VTE+DL+++F++FG I ++DIK  +    +++ F+++ ++    RA  +     +    +K+G+GK+ PT  LW+G L        L R F R+G I  +      + A IQ++ ++ AQ A T    R    G  ++R++VD+A  E  YQ  F+  L
Sbjct:  301 RANRTLFLGNLDI-TVTENDLRRAFERFGTITEVDIKRPTRGQSSTYGFLKFENLDMAHRAKISMSGKVVGRNPIKIGYGKATPTTRLWVGGLGPWVPLTALAREFDRFGTIRTIDYRKGDTWAYIQYESLDAAQAACTHM--RGFPLGGPDRRLRVDFADTEHRYQQQFLQPL 471          

HSP 2 Score: 73.1738 bits (178), Expect = 5.115e-12
Identity = 53/171 (30.99%), Postives = 88/171 (51.46%), Query Frame = 2
Query: 7904 KQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILN-----DNFIKYLQEKSAAGIINICIPESQQ--NAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            KQ+    LS  + W G L LKN      MH++ G+  +  + +   S G  +SQ LRI QR+RL+  +++ + RR+    P  +   L + G    EE + +    +      N + YL++K AAG+I++ +  S+   N  V+H FPPC+FS  Q  +  +K   K +E+
Sbjct:  678 KQDAGGKLS--MAWNGMLLLKNSNFPASMHLLEGDLSVATSLLIDGSTGGKVSQ-LRITQRLRLDQPKIDEVSRRIKVAGPGGYAVLLAVPGSS--EETSSSDPAASTQRPLRNLVSYLKQKQAAGVISLPVGGSRDKDNTGVLHAFPPCDFS-QQFLDSSAKALAKTEED 842          
BLAST of Protein split ends vs. Ensembl Zebrafish
Match: rbm15 (RNA binding motif protein 15 [Source:ZFIN;Acc:ZDB-GENE-041008-192])

HSP 1 Score: 97.4413 bits (241), Expect = 1.610e-19
Identity = 55/174 (31.61%), Postives = 96/174 (55.17%), Query Frame = 2
Query:  959 KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            +A +TLF+G L   +VTE+DL+++F++FG I ++DIK  +    +++ F+++ ++    RA  +     +    +K+G+GK+ PT  LW+G L        L R F R+G I  +      + A IQ++ ++ AQ A T    R    G  ++R++VD+A  E  YQ  F+  L
Sbjct:  301 RANRTLFLGNLDI-TVTENDLRRAFERFGTITEVDIKRPTRGQSSTYGFLKFENLDMAHRAKISMSGKVVGRNPIKIGYGKATPTTRLWVGGLGPWVPLTALAREFDRFGTIRTIDYRKGDTWAYIQYESLDAAQAACTHM--RGFPLGGPDRRLRVDFADTEHRYQQQFLQPL 471          

HSP 2 Score: 73.1738 bits (178), Expect = 5.115e-12
Identity = 53/171 (30.99%), Postives = 88/171 (51.46%), Query Frame = 2
Query: 7904 KQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILN-----DNFIKYLQEKSAAGIINICIPESQQ--NAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            KQ+    LS  + W G L LKN      MH++ G+  +  + +   S G  +SQ LRI QR+RL+  +++ + RR+    P  +   L + G    EE + +    +      N + YL++K AAG+I++ +  S+   N  V+H FPPC+FS  Q  +  +K   K +E+
Sbjct:  678 KQDAGGKLS--MAWNGMLLLKNSNFPASMHLLEGDLSVATSLLIDGSTGGKVSQ-LRITQRLRLDQPKIDEVSRRIKVAGPGGYAVLLAVPGSS--EETSSSDPAASTQRPLRNLVSYLKQKQAAGVISLPVGGSRDKDNTGVLHAFPPCDFS-QQFLDSSAKALAKTEED 842          
BLAST of Protein split ends vs. Ensembl Xenopus
Match: fam78b (family with sequence similarity 78 member B [Source:Xenbase;Acc:XB-GENE-6041514])

HSP 1 Score: 233.802 bits (595), Expect = 2.137e-60
Identity = 121/283 (42.76%), Postives = 179/283 (63.25%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKA--------KQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS+DTSL++GLFHE+KK+GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+         +  N F  +D         +DE+HPKAT+TLF+G L   + T  DL   F++FGEI+DID+K  +  P   +AF+QY DI SV +A++  D   + +  +KLGFGKS PTNC+WI  L  N  + +L RHF RYGP++ V+ D     AL+ ++ +E AQ A+ +T+ R  G GN+   ++VD+A+ E Q+AF   +  S Q
Sbjct:  334 GIKVQNLPVRSTDTSLKDGLFHEFKKYGKVTSVQIHGVSEERYGLVFFRQQEDQEKALNASKGKLFFGMQIEVTAWVGPETESENEFRPLD-------ERIDEFHPKATRTLFIGNLEK-TTTHLDLHNLFQRFGEIVDIDVKKVNGVP--QYAFLQYSDIGSVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWIDGLSSNITEQYLTRHFCRYGPVVKVVFDRFKGMALVLYNEIEYAQAAVKETKGRKIG-GND---VKVDFANQESQLAFYGSMESSGQ 602          

HSP 2 Score: 78.5666 bits (192), Expect = 2.490e-13
Identity = 47/147 (31.97%), Postives = 65/147 (44.22%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLY 8371
            YP+ W G L LKND   VQ+H ++GN  L   S+     G     PLRI QRMRLE  QL+G+ RR+                          + +  F+  ++     G   +C P     AYV+ IFPP EFS++        L+
Sbjct: 3312 YPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPAPEGG----PPLRIAQRMRLEATQLDGVARRM-----------------------MVRVRHPPFLSPIER----GAPQVCGP-----AYVLQIFPPWEFSESHFSRLVRDLF 3422          

HSP 3 Score: 56.9954 bits (136), Expect = 6.884e-7
Identity = 26/86 (30.23%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEPG 358
            +++ TR+LW+ NL  N  +  I + F+ +G++++++I     S G + A   F+D KS+ KA  +V  + +  L+ +Y E    PG
Sbjct:    1 MVRETRHLWVGNLPENVRDEKIIEHFKRYGRVESVKILPKRGSDGGVAAFVDFVDIKSAQKAHNAVNKMGDRDLRTDYNEPGTIPG 86          
BLAST of Protein split ends vs. Ensembl Xenopus
Match: RBM15 (RNA binding motif protein 15 [Source:NCBI gene;Acc:100490588])

HSP 1 Score: 91.6633 bits (226), Expect = 1.635e-17
Identity = 57/180 (31.67%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  899 FNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYA 1438
             N+ D DL        E   +A +TLFVG L    V ES++ + F +FG I ++DIK       T++ F+++ ++    RA        + S ++K+G+GK  PTN LW+G L        L R F R+G I  +      + A IQ++ ++ AQ A T    R    G +++R++VD+A
Sbjct:  284 LNFRDEDLAL------EIDARANRTLFVGNLDV-VVKESEIYRVFGRFGTITEVDIKRAGRGQQTTYGFIKFENLDMAHRAKVAMSGKMLRSHALKIGYGKVVPTNRLWVGGLGPWVPVTALAREFDRFGTIRQIDYRKGENWAYIQYESLDAAQAACTQM--RGFPMGGDHRRLRVDFA 454          

HSP 2 Score: 68.1662 bits (165), Expect = 2.084e-10
Identity = 43/137 (31.39%), Postives = 74/137 (54.01%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILN--DNFIKYLQEKSAAGIINICIP--ESQQNAYVIHIFPPCEFS 8335
            W G L LKN      MH++ G+  +  + +    +G  ++Q L+I QR+RL+  +L+ + RR+    P  +   L + G  +   + Q SS      N + YL++K AAG+I++ +   + + +A V+H FPPC FS
Sbjct:  673 WQGMLLLKNSNFPSNMHLLQGDLGVASSLLVEGPSGGKVAQ-LKITQRLRLDQPKLDEVTRRIRVAGPNGYAILLAIPGTSEGSSVDQASSTQRPLRNLVSYLKQKQAAGVISLPVGSNKDKDHAGVLHAFPPCNFS 808          
BLAST of Protein split ends vs. Ensembl Xenopus
Match: smpd3 (sphingomyelin phosphodiesterase 3 [Source:Xenbase;Acc:XB-GENE-1013642])

HSP 1 Score: 89.3521 bits (220), Expect = 6.441e-17
Identity = 52/161 (32.30%), Postives = 88/161 (54.66%), Query Frame = 2
Query:  959 KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYAS 1441
            +AT+ LF+G L    V+E DL+++F K+G I ++ IK        ++AF+++ ++    RA        +   ++K+G+GK  P+  LW+G L  N + A L R F R+G I  V      S A IQ++ ++ AQ A T  R    G    ++R++VD+A+
Sbjct:  271 RATRNLFIGNLDH-MVSEVDLRRAFDKYGPIEEVVIKRPGRGQGAAYAFLRFQNLDMAHRAKLAMSGRLLGRNAMKIGYGKPNPSTRLWVGGLGPNTSLAALAREFDRFGSIRTVDYVKGDSFAYIQYESLDAAQAACTQMR----GFALGDRRLRVDFAT 426          

HSP 2 Score: 60.8474 bits (146), Expect = 3.348e-8
Identity = 50/163 (30.67%), Postives = 85/163 (52.15%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNED----LIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLA-------GGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQN---AYVIHIFPPCEFSDNQL-KNCCSKLYDKLKE 8386
            W G L LKN      +H + G+ D    L+K+  +  ++G SL+Q L+I QR+RL+  +LE + R++ +       + LA       G    E   Q    L  N + YL++K AAG+I++ +  S +    + +++ FPPC+F  +QL +    +L  KL+E
Sbjct:  620 WCGHLVLKNSCFPTYLHFLEGDRDVPGALLKDRSS--TSGGSLAQ-LKIAQRLRLDQPKLEEVTRKVRQGTAGGYAVLLATQAPQNEGAIPGEPGLQRR--LLRNLVSYLKQKQAAGVISLPVGGSNKGRDPSGMLYAFPPCDF--HQLYQQSAQRLVGKLEE 775          
BLAST of Protein split ends vs. Ensembl Xenopus
Match: cep112 (centrosomal protein 112kDa [Source:Xenbase;Acc:XB-GENE-6047288])

HSP 1 Score: 52.373 bits (124), Expect = 5.273e-6
Identity = 37/120 (30.83%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  974 LFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDT-SFAFVQYYDISSVVRALRNQDNIKIDSKSV---KLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPI-MIVIP-DP 1315
            +FVG L+    ++ DLK  F KFGE+ D  IK   N   +  F F+ + D +SV + L  +++ ++D + +   K    K  P   +++G L   A +  +R +F  +G I  I +P DP
Sbjct:   54 MFVGGLSW-DTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEH-RLDGRLIDPKKAMAMKKDPIKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDP 171          
BLAST of Protein split ends vs. Ensembl Mouse
Match: Spen (spen family transcription repressor [Source:MGI Symbol;Acc:MGI:1891706])

HSP 1 Score: 243.047 bits (619), Expect = 2.515e-63
Identity = 124/283 (43.82%), Postives = 183/283 (64.66%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKA--------KQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS+DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+         +  N F  +D         +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+ +  +EDAQ A+ +T+ R  G GN   +++VD+A+ E Q+AF + + KS Q
Sbjct:  338 GIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWVGPETESENEFRPLD-------ERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYSEIEDAQAAVKETKGRKIG-GN---KIKVDFANRESQLAFYHCMEKSGQ 606          

HSP 2 Score: 124.79 bits (312), Expect = 1.620e-27
Identity = 68/139 (48.92%), Postives = 85/139 (61.15%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQL 8347
            YP+ W G L LKND   VQ+H ++GN  L   S+ L   G     PLRI QRMRLE +QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L
Sbjct: 3484 YPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGP----PLRIAQRMRLEASQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHL 3618          

HSP 3 Score: 58.151 bits (139), Expect = 2.589e-7
Identity = 27/85 (31.76%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G++++++I     S G + A   F+D KS+ KA  SV  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. Ensembl Mouse
Match: Spen (spen family transcription repressor [Source:MGI Symbol;Acc:MGI:1891706])

HSP 1 Score: 243.047 bits (619), Expect = 2.728e-63
Identity = 124/283 (43.82%), Postives = 183/283 (64.66%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKA--------KQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS+DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+         +  N F  +D         +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+ +  +EDAQ A+ +T+ R  G GN   +++VD+A+ E Q+AF + + KS Q
Sbjct:  338 GIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWVGPETESENEFRPLD-------ERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYSEIEDAQAAVKETKGRKIG-GN---KIKVDFANRESQLAFYHCMEKSGQ 606          

HSP 2 Score: 124.79 bits (312), Expect = 1.702e-27
Identity = 68/139 (48.92%), Postives = 85/139 (61.15%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQL 8347
            YP+ W G L LKND   VQ+H ++GN  L   S+ L   G     PLRI QRMRLE +QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L
Sbjct: 3461 YPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGP----PLRIAQRMRLEASQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHL 3595          

HSP 3 Score: 58.151 bits (139), Expect = 2.631e-7
Identity = 27/85 (31.76%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G++++++I     S G + A   F+D KS+ KA  SV  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. Ensembl Mouse
Match: Rbm15 (RNA binding motif protein 15 [Source:MGI Symbol;Acc:MGI:2443205])

HSP 1 Score: 97.0561 bits (240), Expect = 3.138e-19
Identity = 61/188 (32.45%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  929 PEHAMDEYHP----KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            P   +DE  P    +A +TLF+G L   +VTE+DL+++F +FG I ++DIK  S    +++ F+++ ++    RA        I    +K+G+GK+ PT  LW+G L      A L R F R+G I  +      S A IQ++ ++ A  A T    R    G  ++R++VD+A  E  YQ  ++  L
Sbjct:  356 PFREVDEISPEDDQRANRTLFLGNLDI-TVTENDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHM--RGFPLGGPDRRLRVDFADTEHRYQQQYLQPL 540          

HSP 2 Score: 65.855 bits (159), Expect = 1.020e-9
Identity = 46/161 (28.57%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILND--------NFIKYLQEKSAAGIINICIP--ESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            W G L LKN      MH++ G+  +  + +   S G  ++Q L+I QR+RL+  +L+ + RR+    P  +   L + G       + +++            N + YL++K AAG+I++ +   + ++N  V+H FPPCEFS  Q  +  +K   K +E+
Sbjct:  789 WQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQ-LKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSDTAASTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFS-QQFLDSPAKALAKSEED 947          
BLAST of Protein split ends vs. Ensembl Mouse
Match: Rbm15b (RNA binding motif protein 15B [Source:MGI Symbol;Acc:MGI:1923598])

HSP 1 Score: 93.9745 bits (232), Expect = 2.366e-18
Identity = 56/172 (32.56%), Postives = 94/172 (54.65%), Query Frame = 2
Query:  932 EHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE 1447
            E  M E   +AT+ LF+G L   SV+E +L+++F+K+G I ++ IK  +     ++AF+++ ++    RA        I    +K+G+GK+ PT  LW+G L  N + A L R F R+G I  +      S A IQ++ ++ AQ A    + R    G  ++R++VD+A  E
Sbjct:  321 EDLMPEDDQRATRNLFIGNLDH-SVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAAC--AKMRGFPLGGPDRRLRVDFAKAE 489          

HSP 2 Score: 68.1662 bits (165), Expect = 1.611e-10
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTR--PLEFCTCLTL--------AGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPES--QQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESV 8395
            W G L LKN      MH++ G++ +I   +    +G  L+Q L+I QR+RL+  +L+ + RR+ +  P  +   L +        A G  + E      +L  N + YL++K AAG+I++ +  S  + N  +++ FPPC+FS   L++    L  KL+EE +
Sbjct:  719 WNGLLVLKNSCFPTSMHILEGDQGVISGLLKDHPSGSKLTQ-LKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLAIQSTPSGPGAEGMPVVEPGLQRRLLR-NLVSYLKQKQAAGVISLPVGGSKGRDNTGMLYAFPPCDFSQQYLQSALRTL-GKLEEEHM 878          
BLAST of Protein split ends vs. Ensembl Mouse
Match: Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B [Source:MGI Symbol;Acc:MGI:1330294])

HSP 1 Score: 55.8398 bits (133), Expect = 3.113e-7
Identity = 39/123 (31.71%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  974 LFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDT-SFAFVQYYDISSVVRALRNQDNIKIDSKSV---KLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPI-MIVIP-DPEFS 1324
            +FVG L+    ++ DLK  F KFGE++D  IK   N   +  F F+ + D SSV + L +Q   ++D + +   K    K  P   +++G L   A +  +R +F ++G I  I +P DP+ +
Sbjct:   77 MFVGGLSW-DTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVL-DQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLN 197          
BLAST of Protein split ends vs. UniProt/SwissProt
Match: sp|Q8SX83|SPEN_DROME (Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 5.954e-62
Identity = 126/271 (46.49%), Postives = 175/271 (64.58%), Query Frame = 2
Query:  650 NKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            N+ L  + + NL  RSSDTSL++GLFHEYKKHGK+T V V+GQ S RYA++ FK+ +D+EKA E S  K FFG  I+ + + G++  D +  P E  +DEYHPK+T+TLF+G L    +T  +L+  F+ FGEII+IDIK Q      ++AF QY DI SVV+A+R  D   + S  +KLGFGKS PTNC+WI  +    +++FL+  F R+G +  V  D     AL+ +D V++AQ A+ D R    G     K++QVD+AS E Q AF
Sbjct:  551 NRPLA-IRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKSTRTLFIGNLEK-DITAGELRSHFEAFGEIIEIDIKKQGL---NAYAFCQYSDIVSVVKAMRKMDGEHLGSNRIKLGFGKSMPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQVQNAQAAVKDMR----GTILRRKKLQVDFASRECQDAF 812          

HSP 2 Score: 133.65 bits (335), Expect = 2.791e-29
Identity = 67/153 (43.79%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSM-NLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKE 8386
            YPV W G L LK D+  VQMH + GN ++ + S+ +L+     L   LRI QRMRLE  QLEG+ +++    E C  L L  G    ++ Q S  L   FI YLQ+K AAGI+NI IP S+Q AYV+HIFP C+F++  L+     L +++ E
Sbjct: 5400 YPVMWQGLLALKTDQAAVQMHFVHGNPNVARASLPSLVETNTPL---LRIAQRMRLEQTQLEGVAKKMQVDKEHCMLLALPCGRDHADVLQHSRNLQTGFITYLQQKMAAGIVNIPIPGSEQAAYVVHIFPSCDFANENLERAAPDLKNRVAE 5549          
BLAST of Protein split ends vs. UniProt/SwissProt
Match: sp|Q62504|MINT_MOUSE (Msx2-interacting protein OS=Mus musculus OX=10090 GN=Spen PE=1 SV=2)

HSP 1 Score: 241.121 bits (614), Expect = 6.804e-62
Identity = 124/283 (43.82%), Postives = 182/283 (64.31%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKA--------KQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+         +  N F  +D         +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+ +  +EDAQ A+ +T+ R  G GN   +++VD+A+ E Q+AF + + KS Q
Sbjct:  337 GIKVQNLPVRSIDTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWVGPETESENEFRPLD-------ERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYSEIEDAQAAVKETKGRKIG-GN---KIKVDFANRESQLAFYHCMEKSGQ 605          

HSP 2 Score: 125.176 bits (313), Expect = 1.069e-26
Identity = 68/139 (48.92%), Postives = 85/139 (61.15%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQL 8347
            YP+ W G L LKND   VQ+H ++GN  L   S+ L   G     PLRI QRMRLE +QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L
Sbjct: 3485 YPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGP----PLRIAQRMRLEASQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHL 3619          

HSP 3 Score: 58.151 bits (139), Expect = 1.969e-6
Identity = 27/85 (31.76%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G++++++I     S G + A   F+D KS+ KA  SV  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. UniProt/SwissProt
Match: sp|Q96T58|MINT_HUMAN (Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 3.880e-61
Identity = 126/295 (42.71%), Postives = 188/295 (63.73%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKA--------KQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYAD 1525
            G+ ++NL  RS+DTSL++GLFHE+KK GK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I+         +  N F  +D         +DE+HPKAT+TLF+G L   + T  DL+  F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PTNC+W+  L  N +D +L RHF RYGP++ V+ D     AL+ ++ +E AQ A+ +T+ R  G GN   +++VD+A+ E Q+AF + + KS Q D  D  +  A+
Sbjct:  336 GIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWIGPETESENEFRPLD-------ERIDEFHPKATRTLFIGNLEK-TTTYHDLRNIFQRFGEIVDIDIKKVNGVPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKGRKIG-GN---KIKVDFANRESQLAFYHCMEKSGQ-DIRDFYEMLAE 615          

HSP 2 Score: 125.561 bits (314), Expect = 7.460e-27
Identity = 74/164 (45.12%), Postives = 90/164 (54.88%), Query Frame = 2
Query: 7868 PFPKFDEKDDWLKQNK----QTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQL 8347
            P PK D       Q      Q    YP+ W G L LKND   VQ+H ++GN  L   S+ L   G     PLRI QRMRLE  QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L
Sbjct: 3480 PAPKQDSSPHLTSQRPVDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGP----PLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHL 3639          

HSP 3 Score: 57.7658 bits (138), Expect = 2.409e-6
Identity = 27/85 (31.76%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G++++++I     S G + A   F+D KS+ KA  SV  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. UniProt/SwissProt
Match: sp|Q96T37|RBM15_HUMAN (RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 7.018e-19
Identity = 62/188 (32.98%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  929 PEHAMDEYHP----KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            P   +DE  P    +A +TLF+G L   +VTESDL+++F +FG I ++DIK  S    +++ F+++ ++    RA        I    +K+G+GK+ PT  LW+G L      A L R F R+G I  +      S A IQ++ ++ A  A T    R    G  ++R++VD+A  E  YQ  ++  L
Sbjct:  357 PFREVDEISPEDDQRANRTLFLGNLDI-TVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHM--RGFPLGGPDRRLRVDFADTEHRYQQQYLQPL 541          

HSP 2 Score: 65.4698 bits (158), Expect = 9.092e-9
Identity = 46/161 (28.57%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILND--------NFIKYLQEKSAAGIINICIP--ESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            W G L LKN      MH++ G+  +  + +   S G  ++Q L+I QR+RL+  +L+ + RR+    P  +   L + G       + +++            N + YL++K AAG+I++ +   + ++N  V+H FPPCEFS  Q  +  +K   K +E+
Sbjct:  788 WQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQ-LKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFS-QQFLDSPAKALAKSEED 946          
BLAST of Protein split ends vs. UniProt/SwissProt
Match: sp|Q0VBL3|RBM15_MOUSE (RNA-binding protein 15 OS=Mus musculus OX=10090 GN=Rbm15 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.195e-18
Identity = 61/188 (32.45%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  929 PEHAMDEYHP----KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            P   +DE  P    +A +TLF+G L   +VTE+DL+++F +FG I ++DIK  S    +++ F+++ ++    RA        I    +K+G+GK+ PT  LW+G L      A L R F R+G I  +      S A IQ++ ++ A  A T    R    G  ++R++VD+A  E  YQ  ++  L
Sbjct:  356 PFREVDEISPEDDQRANRTLFLGNLDI-TVTENDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHM--RGFPLGGPDRRLRVDFADTEHRYQQQYLQPL 540          

HSP 2 Score: 65.855 bits (159), Expect = 7.133e-9
Identity = 46/161 (28.57%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILND--------NFIKYLQEKSAAGIINICIP--ESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            W G L LKN      MH++ G+  +  + +   S G  ++Q L+I QR+RL+  +L+ + RR+    P  +   L + G       + +++            N + YL++K AAG+I++ +   + ++N  V+H FPPCEFS  Q  +  +K   K +E+
Sbjct:  789 WQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQ-LKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSDTAASTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFS-QQFLDSPAKALAKSEED 947          
BLAST of Protein split ends vs. TrEMBL
Match: A0A1S8WW92 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_05327 PE=4 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 7.428e-99
Identity = 163/270 (60.37%), Postives = 203/270 (75.19%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRL 1474
            GLLI  LS RSSDT+LREGLFHE+KKHGKITSV + GQA  RY I++FKRSED  +A EAS+GKVFFG  I    H+G    DPDLCPPEHA+DEYHPKATKTLFVG L + ++T+ +LK +F+ +GEII+IDIK Q++QP TS+AFVQ+ DI SVVRAL +QD+I++ +K VKLGFGKSQPTN +W+ NL     +AFL R F RYG +  V+ D + S AL+ FD VE AQRAL +TR R+       +R+QVD+A  E Q+AFM RL
Sbjct:   24 GLLIRRLSLRSSDTNLREGLFHEFKKHGKITSVIIRGQAEERYCILTFKRSEDAARALEASRGKVFFGTAISVSLHDGIESEDPDLCPPEHALDEYHPKATKTLFVGNLCSSTITQEELKNTFRGYGEIIEIDIKIQASQPGTSYAFVQFNDIKSVVRALSDQDSIRVGNKVVKLGFGKSQPTNVVWLDNLP-AVTEAFLARQFGRYGHLTHVVLDRKSSRALLYFDTVEMAQRALNETRNRA----IVGRRVQVDFAGYECQVAFMRRL 288          
BLAST of Protein split ends vs. TrEMBL
Match: A0A2H1C3N5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_11013 PE=4 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 2.533e-98
Identity = 173/315 (54.92%), Postives = 219/315 (69.52%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLI---SYTKYLGLLEETR 1600
            GL I +L  RSSDT+LREGLFHEYKKHGKITSV + GQ   RY I++FKRSED E+AFE S+GKVFFG  I    H G +  DPDLCPPEHA+DEYHPKATKTLFVG L + ++T+ +L+++F  +GEII+IDIK Q+NQP TS+AFVQ+ DI SVVRAL  Q+ I++ +K VKLGFGKSQPTN +W+ NL    N++FL R F RYG +  V+ D +   AL+ FD VE AQRAL +TR R+       +++Q+DYA  E Q+AF+ RL K      +D      D Y+ E+IQ LL    SY   L LL+  R
Sbjct:  181 GLQIRHLPLRSSDTNLREGLFHEYKKHGKITSVVIRGQGEDRYGIVTFKRSEDAERAFEVSRGKVFFGTPISVSLHEGIDSEDPDLCPPEHALDEYHPKATKTLFVGNLCSSTITQDELRRTFMMYGEIIEIDIKIQANQPGTSYAFVQFSDIKSVVRALSKQETIRVGNKPVKLGFGKSQPTNVVWLDNLAPTVNESFLARQFGRYGHLTHVLLDRKSRRALLYFDTVEMAQRALNETRNRT----LIGRKVQLDYAGYECQVAFVRRLAK------YDGFSQVYDNYR-ERIQELLALWPSYGNVLPLLDRQR 484          

HSP 2 Score: 98.2117 bits (243), Expect = 7.414e-17
Identity = 43/84 (51.19%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  113 MKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVAFIDCKSSTKALESVKTLMEVPLKLEYCEANGEPGIN 364
            M+ TRYLWI+NL     E DIR   QSHGKIQ++RIH    +  A+VAF+D KS+T+A+ES   L ++ L L+YCE++G P  N
Sbjct:    1 MRATRYLWISNLPVRTSEQDIRDVLQSHGKIQSVRIHSGETTCSAVVAFVDTKSATRAVESTVRLNKIKLALQYCESSGVPASN 84          
BLAST of Protein split ends vs. TrEMBL
Match: A0A419PU62 (Msx2-interacting protein OS=Clonorchis sinensis OX=79923 GN=Spen PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 7.696e-91
Identity = 186/353 (52.69%), Postives = 237/353 (67.14%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKY-LGLLEETR---PQSFDRYENKS-DYEDPYDEVYGTRQSRHRKSAGGHQ 1708
            GLLI  LS RSSDT+LREGLFHE+KKHGKITSV + GQA  RY I++FKRSED  +A EAS+GKVFFG  I    H+G    DPDLCPPEHA+DEYHPKATKTLFVG L + ++T+ +LK +F+ +GEII+IDIK Q++QP TS+AFVQ+ DI SVVRAL +QD+I++ +K VKLGFGKSQPTN +W+ NL     +AFL R F RYG +  V+ D + S AL+ FD VE AQRAL +TR R+       +R+QVD+A  E Q+AFM RL       S + L    D Y+ E++Q LL  +  Y L LL   R     + D ++++S DY  P       R S  + S   HQ
Sbjct:   68 GLLIRRLSLRSSDTNLREGLFHEFKKHGKITSVIIRGQAEERYCILTFKRSEDAARALEASRGKVFFGTSISVSLHDGIESEDPDLCPPEHALDEYHPKATKTLFVGNLCSSTITQEELKNTFRGYGEIIEIDIKIQASQPGTSYAFVQFNDIKSVVRALSDQDSIRVGNKVVKLGFGKSQPTNVVWLDNLP-PVTEAFLARQFGRYGHLTHVVLDRKSSRALLYFDTVEMAQRALNETRNRA----IVGRRVQVDFAGYECQVAFMRRL------GSQENLGQAYDDYR-ERLQELLALWPSYGLPLLGRQRYLTEMAKDNHDSESDDYGAPCHRRSTKRASSKKHSGTDHQ 408          

HSP 2 Score: 164.466 bits (415), Expect = 3.141e-36
Identity = 83/182 (45.60%), Postives = 114/182 (62.64%), Query Frame = 2
Query: 7898 WLKQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQP--------LRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAG-------GDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESVP 8398
            W   + +T   YPV W G+L LKN+EVFV MH ++GN+ L+K+ M +IS   S            LRIVQRMRL+P+QL+G+QR+L +  +FC CLTLA           + E  + + +L DNFIKY+ +K AAGI+N+C P + QN YVIHIFPPC+FS  QL+     L+ +L + S P
Sbjct: 2825 WSSGSSETQ-DYPVGWRGRLSLKNEEVFVHMHYLSGNQGLLKDCMGVISEQNSSPSEQDMSTLPLLRIVQRMRLDPSQLDGVQRKLRQVNDFCMCLTLAATSPMTPESSAVGETIRMNQVLCDNFIKYMVDKCAAGIVNVCNPFTNQNLYVIHIFPPCDFSRCQLEGTSPALHRQLTQTSTP 3005          
BLAST of Protein split ends vs. TrEMBL
Match: G7YEN8 (Msx2-interacting protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_106084 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 7.719e-91
Identity = 186/353 (52.69%), Postives = 237/353 (67.14%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKY-LGLLEETR---PQSFDRYENKS-DYEDPYDEVYGTRQSRHRKSAGGHQ 1708
            GLLI  LS RSSDT+LREGLFHE+KKHGKITSV + GQA  RY I++FKRSED  +A EAS+GKVFFG  I    H+G    DPDLCPPEHA+DEYHPKATKTLFVG L + ++T+ +LK +F+ +GEII+IDIK Q++QP TS+AFVQ+ DI SVVRAL +QD+I++ +K VKLGFGKSQPTN +W+ NL     +AFL R F RYG +  V+ D + S AL+ FD VE AQRAL +TR R+       +R+QVD+A  E Q+AFM RL       S + L    D Y+ E++Q LL  +  Y L LL   R     + D ++++S DY  P       R S  + S   HQ
Sbjct:  141 GLLIRRLSLRSSDTNLREGLFHEFKKHGKITSVIIRGQAEERYCILTFKRSEDAARALEASRGKVFFGTSISVSLHDGIESEDPDLCPPEHALDEYHPKATKTLFVGNLCSSTITQEELKNTFRGYGEIIEIDIKIQASQPGTSYAFVQFNDIKSVVRALSDQDSIRVGNKVVKLGFGKSQPTNVVWLDNLP-PVTEAFLARQFGRYGHLTHVVLDRKSSRALLYFDTVEMAQRALNETRNRA----IVGRRVQVDFAGYECQVAFMRRL------GSQENLGQAYDDYR-ERLQELLALWPSYGLPLLGRQRYLTEMAKDNHDSESDDYGAPCHRRSTKRASSKKHSGTDHQ 481          

HSP 2 Score: 164.851 bits (416), Expect = 2.856e-36
Identity = 83/182 (45.60%), Postives = 114/182 (62.64%), Query Frame = 2
Query: 7898 WLKQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQP--------LRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAG-------GDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESVP 8398
            W   + +T   YPV W G+L LKN+EVFV MH ++GN+ L+K+ M +IS   S            LRIVQRMRL+P+QL+G+QR+L +  +FC CLTLA           + E  + + +L DNFIKY+ +K AAGI+N+C P + QN YVIHIFPPC+FS  QL+     L+ +L + S P
Sbjct: 2878 WSSGSSETQ-DYPVGWRGRLSLKNEEVFVHMHYLSGNQGLLKDCMGVISEQNSSPSEQDMSTLPLLRIVQRMRLDPSQLDGVQRKLRQVNDFCMCLTLAATSPMTPESSAVGETIRMNQVLCDNFIKYMVDKCAAGIVNVCNPFTNQNLYVIHIFPPCDFSRCQLEGTSPALHRQLTQTSTP 3058          

HSP 3 Score: 68.5514 bits (166), Expect = 4.212e-7
Identity = 29/55 (52.73%), Postives = 42/55 (76.36%), Query Frame = 2
Query:  194 HGKIQTIRIHKNNNSRGAIVAFIDCKSSTKALESVKTLMEVPLKLEYCEANGEPG 358
            HGKIQ +RIH +  S GA+VAF+D +S+T+A++S   L +V L L+YCE++G PG
Sbjct:    1 HGKIQNVRIHPDGLSYGAVVAFVDTQSATRAIQSTVRLNKVSLALQYCESSGIPG 55          
BLAST of Protein split ends vs. TrEMBL
Match: A0A4S2L2J2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010027 PE=4 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 4.631e-90
Identity = 186/353 (52.69%), Postives = 237/353 (67.14%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKY-LGLLEETR---PQSFDRYENKS-DYEDPYDEVYGTRQSRHRKSAGGHQ 1708
            GLLI  LS RSSDT+LREGLFHE+KKHGKITSV + GQA  RY I++FKRSED  +A EAS+GKVFFG  I    H+G    DPDLCPPEHA+DEYHPKATKTLFVG L + ++T+ +LK +F+ +GEII+IDIK Q++QP TS+AFVQ+ DI SVVRAL +QD+I++ +K VKLGFGKSQPTN +W+ NL     +AFL R F RYG +  V+ D + S AL+ FD VE AQRAL +TR R+       +R+QVD+A  E Q+AFM RL       S + L    D Y+ E++Q LL  +  Y L LL   R     + D ++++S DY  P       R S  + S   HQ
Sbjct:   24 GLLIRRLSLRSSDTNLREGLFHEFKKHGKITSVIIRGQAEERYCILTFKRSEDAARALEASRGKVFFGTSISVSLHDGIESEDPDLCPPEHALDEYHPKATKTLFVGNLCSSTITQEELKNTFRGYGEIIEIDIKIQASQPGTSYAFVQFNDIKSVVRALSDQDSIRVGNKVVKLGFGKSQPTNVVWLDNLP-PVTEAFLARQFGRYGHLTHVVLDRKSSRALLYFDTVEMAQRALNETRNRA----IVGRRVQVDFAGYECQVAFMRRL------GSQENLGQAYDDYR-ERLQELLALWPSYGLPLLGRQRYLTEMAKDNHDSESDDYGAPCHRRSTKRASSKKHSGTDHQ 364          

HSP 2 Score: 163.696 bits (413), Expect = 6.015e-36
Identity = 80/171 (46.78%), Postives = 110/171 (64.33%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQP--------LRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAG-------GDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESVP 8398
            YPV W G+L LKN+EVFV MH ++GN+ L+K+ M +IS   S            LRIVQRMRL+P+QL+G+QR+L +  +FC CLTLA           + E  + + +L DNFIKY+ +K AAGI+N+C P + QN YVIHIFPPC+F+  QL+     L+ +L + S P
Sbjct: 2790 YPVGWRGRLSLKNEEVFVHMHYLSGNQGLLKDCMGVISEQNSSPSEQDVSTLPLLRIVQRMRLDPSQLDGVQRKLRQANDFCMCLTLAATPPMTPESSAVGETIRMNQVLCDNFIKYMVDKCAAGIVNVCNPFTNQNLYVIHIFPPCDFARCQLEGTSPALHRQLTQTSTP 2960          
BLAST of Protein split ends vs. Ensembl Cavefish
Match: spen (spen family transcriptional repressor [Source:NCBI gene;Acc:103025061])

HSP 1 Score: 229.95 bits (585), Expect = 2.105e-59
Identity = 122/285 (42.81%), Postives = 183/285 (64.21%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNY-IDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ--FDSHDLL 1510
            G+ ++NL  RS+DTSL++GLFHE+KKHGK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I      G     + +  P +  +DE+HPKAT+TLF+G L   + T  DL   F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PT C+W+  L  N  + +L RHF RYG ++ V+ D     AL+ ++ +E AQ A+ +T+    G GN   +++VD+A++E QMAF   ++ S Q   D +D+L
Sbjct:  385 GIKVQNLPVRSTDTSLKDGLFHEFKKHGKVTSVQIHGASEERYGLVFFRQQEDQEKALSASKGKLFFGMQIDVTAWTGPETESENEFRPLDERIDEFHPKATRTLFIGNLEK-TTTYHDLLNIFQRFGEIVDIDIKKLNGAP--QYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTTCVWLDGLASNITEQYLTRHFCRYGHVVKVVFDRLKGMALVLYNNIECAQAAVKETKGWKIG-GN---KIKVDFANHESQMAFYRSMQASGQDIRDFYDIL 662          

HSP 2 Score: 127.487 bits (319), Expect = 2.208e-28
Identity = 67/146 (45.89%), Postives = 85/146 (58.22%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKL 8368
            YP+ W G L LKND   VQ+H ++GN  L   S+     G  L    RI QRMRLE +QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L +    L
Sbjct: 3357 YPIVWQGHLALKNDSAAVQLHFVSGNNVLAHRSLPPPEGGPPL----RIAQRMRLEASQLEGVARRMTVESDYCLLLALPCGLDQEDVFNQTHALKTGFITYLQAKQAAGIINVPNPGSNQPAYVVQIFPPCEFSESHLSHLAPDL 3498          

HSP 3 Score: 56.225 bits (134), Expect = 7.190e-7
Identity = 25/85 (29.41%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G+++++++     S G + A   F+D KS+ KA  S+  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKVLPKRGSEGGVAAFVDFVDIKSAQKAHNSINKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. Ensembl Cavefish
Match: spen (spen family transcriptional repressor [Source:NCBI gene;Acc:103025061])

HSP 1 Score: 218.779 bits (556), Expect = 4.880e-56
Identity = 117/274 (42.70%), Postives = 175/274 (63.87%), Query Frame = 2
Query:  698 SDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNY-IDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ--FDSHDLL 1510
            +DTSL++GLFHE+KKHGK+TSV + G +  RY ++ F++ ED EKA  AS+GK+FFG  I      G     + +  P +  +DE+HPKAT+TLF+G L   + T  DL   F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PT C+W+  L  N  + +L RHF RYG ++ V+ D     AL+ ++ +E AQ A+ +T+    G GN   +++VD+A++E QMAF   ++ S Q   D +D+L
Sbjct:  443 ADTSLKDGLFHEFKKHGKVTSVQIHGASEERYGLVFFRQQEDQEKALSASKGKLFFGMQIDVTAWTGPETESENEFRPLDERIDEFHPKATRTLFIGNLEK-TTTYHDLLNIFQRFGEIVDIDIKKLNGAPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTTCVWLDGLASNITEQYLTRHFCRYGHVVKVVFDRLKGMALVLYNNIECAQAAVKETKGWKIG-GN---KIKVDFANHESQMAFYRSMQASGQDIRDFYDIL 709          

HSP 2 Score: 127.487 bits (319), Expect = 2.251e-28
Identity = 67/146 (45.89%), Postives = 85/146 (58.22%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKL 8368
            YP+ W G L LKND   VQ+H ++GN  L   S+     G  L    RI QRMRLE +QLEG+ RR+T   ++C  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L +    L
Sbjct: 3404 YPIVWQGHLALKNDSAAVQLHFVSGNNVLAHRSLPPPEGGPPL----RIAQRMRLEASQLEGVARRMTVESDYCLLLALPCGLDQEDVFNQTHALKTGFITYLQAKQAAGIINVPNPGSNQPAYVVQIFPPCEFSESHLSHLAPDL 3545          

HSP 3 Score: 56.225 bits (134), Expect = 7.892e-7
Identity = 25/85 (29.41%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  N  E  I + F+ +G+++++++     S G + A   F+D KS+ KA  S+  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKVLPKRGSEGGVAAFVDFVDIKSAQKAHNSINKMGDRDLRTDYNEPGTIP 85          
BLAST of Protein split ends vs. Ensembl Cavefish
Match: rbm15 (RNA binding motif protein 15 [Source:NCBI gene;Acc:103043033])

HSP 1 Score: 101.679 bits (252), Expect = 7.455e-21
Identity = 57/174 (32.76%), Postives = 98/174 (56.32%), Query Frame = 2
Query:  959 KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            +A +TLF+G L   +VTESDL+++F +FG I ++DIK  +   ++++ F+++ ++    RA  +     +   ++K+G+GK+ PT  LW+G L      A L R F R+G I  +      + A IQ++ ++ AQ A T    R    G  ++R++VD+A  E  YQ  F+  L
Sbjct:  304 RANRTLFLGNLDI-TVTESDLRRAFDRFGTITEVDIKRPTRGQNSTYGFLKFENLDMAHRAKISMSGKVVGRNAIKIGYGKATPTTRLWVGGLGLWVPLAALAREFDRFGTIRTIDYRKGDTWAYIQYESLDAAQAACTHM--RGFPLGGPDRRLRVDFADTEHRYQQQFLQPL 474          

HSP 2 Score: 67.3958 bits (163), Expect = 2.499e-10
Identity = 48/161 (29.81%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDKLEELTQTSSILND--------NFIKYLQEKSAAGIINICIPESQQ--NAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            W G L LKN      MH++ G+  +  + +   S G  ++Q LRI QR+RL+  +++ + RR+    P  +   L + G  +    + +SS            N + YL++K AAG+I++ +  S+   N  V+H FPPC+FS  Q  +  +K   K +E+
Sbjct:  693 WNGMLLLKNSNFPASMHILDGDLSVASSLLVDGSTGGKVTQ-LRITQRLRLDQPKMDEVSRRIKVAGPGGYAVLLAVPGSSEDTSSSSSSSADPAASTQRPLRNLVSYLKQKQAAGVISLPVGGSRDKDNTGVLHAFPPCDFS-QQFLDSSAKALAKTEED 851          
BLAST of Protein split ends vs. Ensembl Cavefish
Match: rbm15b (RNA binding motif protein 15B [Source:ZFIN;Acc:ZDB-GENE-080204-91])

HSP 1 Score: 88.1965 bits (217), Expect = 5.772e-17
Identity = 51/163 (31.29%), Postives = 88/163 (53.99%), Query Frame = 2
Query:  959 KATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE 1447
            +AT+ LF+G L   +V+E++L++ F+K+G I ++ IK  +     ++AF+++ ++    RA             VK+G+GK+ PT  LW+G L  N + A L R F R+G I  +      + A I ++ ++ AQ A      R    G  N+R++VD+A  E
Sbjct:  202 RATRNLFIGNLDH-NVSEAELRQGFEKYGVIEEVVIKRPARGQGCAYAFIKFQNLDMAHRAKVAMQGRVFGGNQVKIGYGKANPTTRLWVGGLGPNVSLAALAREFDRFGSIRTIDYVKGDNFAYIHYESLDAAQAACAQM--RGFPLGGPNRRLRVDFAKAE 361          
BLAST of Protein split ends vs. Ensembl Cavefish
Match: ENSAMXT00000047453.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18379390:18384314:1 gene:ENSAMXG00000039278.1 transcript:ENSAMXT00000047453.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 7.205e-9
Identity = 24/85 (28.24%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  +  E  I + F+ +G+++++++ +   S G + A   F+D KS+ KA  +V  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPEHVREEKIVEHFKRYGRVESVKVLRKRGSEGGVAAFVDFVDIKSAQKAHNAVNKMGDRDLRTDYNEPGSVP 85          
BLAST of Protein split ends vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 53.9138 bits (128), Expect = 1.805e-7
Identity = 54/222 (24.32%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  668 LLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVM-----GQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLI-------KAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGK--SQPTNCLWIGNLQRNANDAFLRRHFRRYGP 1291
            + + +LS   S   LR      +   GKI+   V+     G++ G Y  +SF +  D E A +   G+   G  I       K     G    DP     E  +++  P    T++ G +T G +TE  ++++F  FG+I++I +      PD  ++F+++    S   A+ + +   I+  SVK  +GK  S P N       Q+ +   + ++ + ++GP
Sbjct:    5 VFVGDLSPEISTDDLRAA----FAPFGKISDARVVKDLATGKSKG-YGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNC-TVYCGGITQG-LTEQLMRQTFLLFGQILEIRVF-----PDKGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASDPVNQF----QQQFSQVGYTQQPWTQWGP 210          
BLAST of Protein split ends vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 55.8398 bits (133), Expect = 6.164e-8
Identity = 53/204 (25.98%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  866 GNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFG------KSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMI--VIPDPEFSCA----LIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYAS 1441
            GN  +A+ + G N  DP + P  +A+      + + L+VG L   ++TE  LK+ F+  G I +I I    N  + ++AFV+Y+       AL+  +  +I++  VK+ +        S  T  L++G+L  N +D  LR  F+ +   +   V+ D +   +     + F   +DAQ A+ D+ +  + NG   + +++++A+
Sbjct:   44 GNSEQAEDNQGEN--DPSVVP-ANAITGGRETSDRVLYVGNLDK-AITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAM-DSMQGQDLNG---RPLRINWAA 239          
BLAST of Protein split ends vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 49.2914 bits (116), Expect = 6.465e-6
Identity = 42/158 (26.58%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  971 TLFVGKLTTGSVTESDLKKSFKKFGEIIDID-IKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSV-----------------KLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIV-IPD-PEF----SCALIQFDCVEDAQRAL 1372
            T+FVG+L+  S+ +  LKK F+  G +I    I  +       + +V + + S   +A++     +ID + +                 K G   S+P++ L++GNL  NA+   +   F ++G ++ V IP  PE         +QF  +EDA++AL
Sbjct:  169 TIFVGRLSW-SIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKAL 325          
BLAST of Protein split ends vs. Ensembl Nematostella
Match: EDO40891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y9])

HSP 1 Score: 164.466 bits (415), Expect = 9.030e-45
Identity = 83/213 (38.97%), Postives = 133/213 (62.44%), Query Frame = 2
Query:  701 DTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQ-SNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALI 1336
            D S+REGL+HE+KKHG++T + + G    R AII F+R E+ E+A E  QGK+F G  ++ +  +G +Y    +    ++ DE+ P  T+TLFVG +   + T  DLK++F+++GE+ID+DIK Q  N P   +AFVQ+ ++SS ++A R  D   +    VK+GFGK  P N +W+G +  + ++  + RHF RYG +  V+ +   + AL+
Sbjct:   70 DGSIREGLYHEFKKHGEVTRIYIHGTGGSRSAIIYFRRPEEAERALEVCQGKMFLGAEMQIQHWHGNSYALTYI--SNYSEDEFDPGCTRTLFVGNIEK-TTTYGDLKEAFERYGEVIDVDIKKQPGNNP---YAFVQFAELSSAIQARRKMDREYVGRNRVKVGFGKVNPINTIWVGGVTNSLSEQQVERHFGRYGRVTKVVINRVTNQALV 276          
BLAST of Protein split ends vs. Ensembl Nematostella
Match: EDO40890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y8])

HSP 1 Score: 120.168 bits (300), Expect = 9.875e-31
Identity = 69/152 (45.39%), Postives = 90/152 (59.21%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQ---SLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTL-AGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYD 8374
            YPV W G + LKND   VQMH ++GN  L + S+      Q   ++  PLRI QRM+LE +QLEG+ RR+    + C  L L  G D L+   QT + L + FI YLQ+K AAGIIN+  P S Q +YV+HIFPPC+F+   L      L D
Sbjct:    8 YPVVWQGLVALKNDTAAVQMHYLSGNSRLAEASLPQAPAAQAMATVPPPLRIAQRMKLEQSQLEGVVRRMQCEADHCLLLALPCGRDPLDVHAQTRA-LKNGFINYLQQKQAAGIINVARPGSVQPSYVLHIFPPCDFAQEHLARVSPDLLD 158          
BLAST of Protein split ends vs. Ensembl Nematostella
Match: EDO49695 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG09])

HSP 1 Score: 107.842 bits (268), Expect = 1.462e-23
Identity = 83/299 (27.76%), Postives = 135/299 (45.15%), Query Frame = 2
Query:  710 LREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSED---MEKAFEASQGKVFF---------------------------GNLIKAKQH---------------------NGFNYIDP--DLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE 1447
            ++E +FHE+KK G I SV + G+ + RYA++ F+  +D    ++A E     + F                            + ++ KQ                       G N+  P  +  PPE       PKAT+TLFVG L TG ++  DL+ SF+KFG ++D+DIK  +     ++AFV++ D+    +A        I    +K+G+G+SQ T  LW+G L    +   L R F R+G I  +        A I +D ++ A  A  + R    G    ++R+++D+A  E
Sbjct:    1 MKESIFHEFKKFGDI-SVHLFGRGNDRYAVLYFRSLDDAKETKRALERRSRTILFDRPLRIEYNLYPERTSNHSPGDYYHRSASPVRWKQRASNPPPFEFDRGRGDYDRRNRGGGNFTPPQQEYIPPEE-----DPKATRTLFVGNLETG-ISCQDLRLSFEKFGVVLDVDIKRPARGQGNTYAFVKFADLDVAAKAKCAMQGQCIGRNHIKIGYGRSQQTTRLWVGGLGPWISIPELEREFDRFGAIRRIDYRKGGDHAYILYDSLDAASVAAREMR----GFQMGDRRLRIDFADKE 288          

HSP 2 Score: 82.8037 bits (203), Expect = 1.098e-15
Identity = 53/148 (35.81%), Postives = 80/148 (54.05%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILND----NFIKYLQEKSAAGIINICI-PESQQNAY----VIHIFPPCEFSDNQL 8347
            + V W G L LKN    V+MH++ GN ++   + +LI N  S    LRI QR+RL+  +LE + RR+        CL LA      +L +++  L      N + YL++K AAG++N+ + P +  NA     V+H FPPC+FS   L
Sbjct:  429 FAVAWKGSLILKNSAFPVRMHLVGGNPEI---ADSLIRNDGSTKSSLRITQRLRLDQPKLEEVSRRINTAGASGHCLLLALPGTQIQLPESTEELQHRPLRNLMTYLKQKQAAGVVNLPVSPSNSTNAKDDVGVLHAFPPCQFSHEHL 573          
BLAST of Protein split ends vs. Ensembl Medaka
Match: si:ch1073-335m2.2 (spen family transcriptional repressor [Source:NCBI gene;Acc:101160467])

HSP 1 Score: 228.024 bits (580), Expect = 6.407e-59
Identity = 120/276 (43.48%), Postives = 177/276 (64.13%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNY-IDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            G+ ++NL  RS+DTSL++GLFHE+KK+GK+TSV + G +  RY ++ F++ ED EKA   S+GK+FFG LI+    NG     + +  P +  +DE+HPKAT+TLF+G L   + +   L   F++FGEI+DIDIK  +  P   +AFVQY DI+SV +A++  D   + S  +KLGFGKS PT C+W+  L  N  + +L RHF RYG ++ V+ D     ALI ++  + AQ A+ +T+    G GN   +++VD+AS E QMAF   ++ S Q
Sbjct:  331 GIKVQNLPVRSTDTSLKDGLFHEFKKYGKVTSVQIHGASEDRYGLVFFRQQEDQEKALSVSKGKLFFGMLIEVTAWNGPETESENEFRPLDGRIDEFHPKATRTLFIGNLEK-TTSYQQLLDIFQRFGEIVDIDIKKVNGVP--QYAFVQYSDIASVCKAIKKMDGEYLGSNRLKLGFGKSMPTTCVWLDGLAPNITEQYLTRHFCRYGHVVKVVFDRLKGMALILYNNTDFAQAAVRETKGWKIG-GN---KIKVDFASQESQMAFYRSMQASGQ 599          

HSP 2 Score: 122.865 bits (307), Expect = 5.762e-27
Identity = 68/154 (44.16%), Postives = 92/154 (59.74%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEES 8392
            YP+ W G L LKND   VQ+H + GN+ L   S+ +   G  L    RIVQRMRLE +QLE + RR+T   ++C  L L  G   +++ + +  L + FI YLQ+K AAGIINI  P S Q AYV+ IFPPCEFS++ L      L +++   S
Sbjct: 3014 YPIVWQGLLALKNDTAAVQLHFVCGNKALGHRSLPMQEGGALL----RIVQRMRLEASQLESVARRMTGDSDYCLLLALPCGRDQDDVLKQTQALKNAFINYLQKKLAAGIINIPNPGSNQPAYVLQIFPPCEFSESHLSQLAPDLLNRISSIS 3163          

HSP 3 Score: 56.225 bits (134), Expect = 7.459e-7
Identity = 24/85 (28.24%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  110 IMKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVA---FIDCKSSTKALESVKTLMEVPLKLEYCEANGEP 355
            +++ TR+LW+ NL  +  E  I + F+ +G+++++++ +   S G + A   F+D KS+ KA  +V  + +  L+ +Y E    P
Sbjct:    1 MVRETRHLWVGNLPEHVREEKIVEHFKRYGRVESVKVLRKRGSEGGVAAFVDFVDIKSAQKAHNAVNKMGDRDLRTDYNEPGSVP 85          
BLAST of Protein split ends vs. Ensembl Medaka
Match: spen (msx2-interacting protein-like [Source:NCBI gene;Acc:101159000])

HSP 1 Score: 154.066 bits (388), Expect = 2.024e-36
Identity = 80/188 (42.55%), Postives = 118/188 (62.77%), Query Frame = 2
Query:  926 PPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            P +  +DE+HPKAT+TLF+G L   + T  DL   F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PT C+W+  L  N  + FL RHF RYG ++ V+ D     ALI ++ +E AQ A+ DT+    G   +  +++VD+A+ E QMAF   ++ S Q
Sbjct:   21 PLDERIDEFHPKATRTLFIGNLEK-TTTYHDLLNIFQRFGEIVDIDIKKVNGAPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTTCVWLDGLASNTTEQFLTRHFCRYGHVVKVVLDRMKGMALILYNNIEYAQAAVKDTK----GWKLSGSKIKVDFANQESQMAFYRSMQASGQ 201          

HSP 2 Score: 101.293 bits (251), Expect = 1.821e-20
Identity = 57/123 (46.34%), Postives = 74/123 (60.16%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNA 8299
            YP+ W G L LKND+  VQ+H ++GN  L + S+  +  G SL   LRIVQRMRLE +QL+ + RR+T   +FC  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q A
Sbjct: 2878 YPIVWQGLLALKNDQAAVQLHFVSGNTLLAQRSLPPLEGG-SL---LRIVQRMRLEVSQLDSVTRRMTVENDFCLLLALPCGRDQEDVLSQTQALKSGFITYLQAKQAAGIINVPNPGSNQVA 2996          
BLAST of Protein split ends vs. Ensembl Medaka
Match: spen (msx2-interacting protein-like [Source:NCBI gene;Acc:101159000])

HSP 1 Score: 153.68 bits (387), Expect = 2.119e-36
Identity = 80/188 (42.55%), Postives = 118/188 (62.77%), Query Frame = 2
Query:  926 PPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQ 1489
            P +  +DE+HPKAT+TLF+G L   + T  DL   F++FGEI+DIDIK  +  P   +AF+QY DI+SV +A++  D   + +  +KLGFGKS PT C+W+  L  N  + FL RHF RYG ++ V+ D     ALI ++ +E AQ A+ DT+    G   +  +++VD+A+ E QMAF   ++ S Q
Sbjct:   21 PLDERIDEFHPKATRTLFIGNLEK-TTTYHDLLNIFQRFGEIVDIDIKKVNGAPQ--YAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTTCVWLDGLASNTTEQFLTRHFCRYGHVVKVVLDRMKGMALILYNNIEYAQAAVKDTK----GWKLSGSKIKVDFANQESQMAFYRSMQASGQ 201          

HSP 2 Score: 130.568 bits (327), Expect = 2.588e-29
Identity = 69/146 (47.26%), Postives = 89/146 (60.96%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKL 8368
            YP+ W G L LKND+  VQ+H ++GN  L + S+  +  G SL   LRIVQRMRLE +QL+ + RR+T   +FC  L L  G   E++   +  L   FI YLQ K AAGIIN+  P S Q AYV+ IFPPCEFS++ L      L
Sbjct: 2878 YPIVWQGLLALKNDQAAVQLHFVSGNTLLAQRSLPPLEGG-SL---LRIVQRMRLEVSQLDSVTRRMTVENDFCLLLALPCGRDQEDVLSQTQALKSGFITYLQAKQAAGIINVPNPGSNQPAYVVQIFPPCEFSESHLSRLAPDL 3019          
BLAST of Protein split ends vs. Ensembl Medaka
Match: rbm15 (RNA binding motif protein 15 [Source:NCBI gene;Acc:101159584])

HSP 1 Score: 97.0561 bits (240), Expect = 2.003e-19
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  917 DLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE--YQMAFMNRL 1474
            DL  PE        +A +TLF+G L   ++ E+DL+++F +FG I ++DIK  S    +++ F+++ ++    RA  +     +    +K+G+GK+ PT  LW+G L      A L R F R+G I  +      + A IQ++ ++ AQ A T    R    G   +R++VD+A  E  YQ  F+  L
Sbjct:  287 DLISPEDDQ-----RANRTLFLGNLDI-NIAEADLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMAHRAKLSMSGKIVGRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDTWAYIQYESLDAAQAAWTHM--RGFPLGGPERRLRVDFADTEHRYQQQFLQPL 466          

HSP 2 Score: 71.2478 bits (173), Expect = 1.515e-11
Identity = 49/159 (30.82%), Postives = 83/159 (52.20%), Query Frame = 2
Query: 7937 VRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRL--TRPLEFCTCLTLAGGDK----LEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQ--QNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEE 8389
            V W G L LKN      MH++ G+  +  + +   S G+ +S+ L+I QR+RL+  +L+ + RR+    P  +   L + G  +     + +  T   L  N + YL +K AAG+I++ +  S+   N  V+H FPPC+FS  Q  +  +K   K +E+
Sbjct:  679 VAWRGMLLLKNSNFPASMHLLEGDYGVASDLLIDGSTGRQVSE-LKITQRLRLDQPKLDEVSRRIKVAGPGGYAILLAVPGSTEDSSSSDPMASTQRPLR-NLVSYLNQKQAAGVISLPVGGSRDKDNTGVLHAFPPCDFS-QQFLDSSAKALAKSEED 834          
BLAST of Protein split ends vs. Ensembl Medaka
Match: rbm15b (RNA binding motif protein 15B [Source:NCBI gene;Acc:101172726])

HSP 1 Score: 93.2041 bits (230), Expect = 2.658e-18
Identity = 71/232 (30.60%), Postives = 111/232 (47.84%), Query Frame = 2
Query:  755 TSVTVMGQASGR-YAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNE 1447
            T V+ M     R +A+ S   S D E+  +      ++G L       G  Y  P +   E    E   +AT  LF+G L  G+VTE++L++ F K+G I D+ IK  +     ++AFV++ ++    RA        I    +K+G+GK+ PT  LW+G L    +   L R F R+G I  +      S A IQ++ ++ AQ A T    R    G   +R++VD+A  E
Sbjct:  212 TGVSSMRDLRARHFALESLGLSRDRERLLD------YYGML----DERGRPYAFPPMPVVEDLKPEDDQRATSNLFIGNLD-GNVTEAELRRGFDKYGIIEDVVIKRPARGQGGAYAFVKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGKANPTTRLWVGGLGPGNSLTALAREFDRFGSIRNIDYVKGDSFAYIQYESLDAAQAACTQM--RGFPLGGPERRLRVDFAKVE 430          

HSP 2 Score: 67.781 bits (164), Expect = 1.797e-10
Identity = 46/162 (28.40%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 7943 WTGKLCLKNDEVFVQMHMIAGNEDLI----KNSMNLISNGQSLSQP--LRIVQRMRLEPNQLEGLQRR--LTRPLEFCTCLTLAGGDKLEELTQTSSI---LNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESV 8395
            W G   LKN     +++M+ G    +    K+S+NL    Q+ +QP  L+I QR+R++  +L+ + RR  L RP  F   L L G    +       +   L  + + YL+ K AAG++ +   +      +++ FPP EFS  Q      +    L EE +
Sbjct:  665 WQGFFALKNSSFPTELYMLEGGASFLSGVLKDSLNL----QNRNQPSQLKIAQRLRMDQTRLDEVSRRIKLGRPDGFAILLALQGAIDRQAPAPEPGLQIRLLRHLVTYLRNKEAAGVVGLPATKEGGTGGMLYAFPPGEFS-QQFLQAARRTVGNLDEEHM 821          
BLAST of Protein split ends vs. Planmine SMEST
Match: SMESG000016300.1 (SMESG000016300.1)

HSP 1 Score: 4450.2 bits (11541), Expect = 0.000e+0
Identity = 2741/2763 (99.20%), Postives = 2752/2763 (99.60%), Query Frame = 2
Query:  113 MKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVAFIDCKSSTKALESVKTLMEVPLKLEYCEANGEPGINYLGNNGNSSENQKIIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDDCSKYPGIQQSKRVXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXQCLNKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKYLGLLEETRPQSFDRYENKSDYEDPYDEVYGTRQSRHRKSAGGHQRLYGSDNYGLEEEYSDDYRYSKSSVRHYEDYSPTHSPVRYSRSSQKFSTEQYNSRKSNYRYNSDYYDAKRDPVASSNSYYPHRRSPEPGFIXXXXXXXXXXXXXXXADYCVENSRFNLPTKRYRQTSKEFRSSRSKVADNHETRSARFERNSENRSWNKSNRYDYNGYAHYXXXXXXXXXXXXXXXPHSRHSMSQQRSYRNESAKKTRSHKIANNASVTEHIRLSTQKSSSKPASNXXXXXXXXXXXXXXXXXXXXXXGIALLDSVKSSINSTNIGNAAASQSADTLSKLERERAKLLQELSMLSEDGSGVGLGXXXXXXXXXXXXXDLETRSGSHKSQKKHASPLVGSEFSQPVKRSSGLESKLAAVASGIIPSPTPDCQSQSQFLFSDSYKTVKDSLDFGKENQIKLETLSTNSLDVIVKLEPILPTKDVIILNSSMDLFGVECSVSKVSQSVTLPSNMDVXXXXXXXXXXXXXXXNQCRDPRLSSTNYNIRXXXXXXXXXXXXEHNLPLLXXXXXXXXXXXXXXXXXXXXXXXXXXXVLSHYQDAGIATSATQNPHLQFSTTVMPLITSNYKDSTSDSDLDHFSNIDNEVDKRIRELDAKLNRNEQTVRTLDYSKFRIRKKVCDIGNCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVGYSGGITRDNNSNTSEFIKTMLNQTKPKNYHLLADSLPSSDHLTCNYSTVVSTNSSLPFRTVDLGANDIERRTLYSRFGSLSSNNLPLLDTKLSVDTTHLSPTINXXXXXXXXXXXXXXXXXXXXVLXXXXXXXXXXXXXXXXXLYDSNQPMKSILXXXXXXXXXXXXXXXXXXXXXXFKASLSLLDCSSSNESKSVPKKSFNPIKRKSQSESEDSVEYSKPSKKIKIESGPTLDDSLFPTYPSAPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIDKSRVSKKSAKINQSNHSNQXXXXXXXXXXXXXXXXXXXXXXXXXVGSNRKNXXXXXXXXXXXXXXXXXXXFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGNYESMYDKIKRRNSTKSVSSGKKRRNKHLNSLTNXXXXXXXXXXXXEYWVSKSSKKCIPPKRKRARXXXXXXXXXXXXXXCKTTPCGKSQEPHLSSDYSDIKSDIVHQNNFYHMKADENTKDESVTDESKAPAESFNLXXXXXXXXXXXPKYVKDASLISINKEAECNNFAAQSILASYRTRSLHRPNDGPLKKRPIAEPIILSEDLPYLEKQPDDEFITTSPTSINEEPPSQLESMYDVPQSQQTNILEEVVLDDHQDSLDVVEVEYGSHDLGNDQNPIDIDPPLPADVDSASHILMTMKTQPNIELEYANVTTTTSNEPDHQIQSVAEHLISLAQNSIVSSIGFPQPESAVIVTEEEKQSQIASTRACKVSNPNSKQKDYEVTTYVKNIIDKIKKETDLANLMNKDKLVCKRNKKLPGSTVGLPKPQPITQESRPTVPGEPDHTNIRVTTAPIVQPIEPVTALSNSAVNTMLSVSQSLHEPLQQKTQLIKPIETKKPIPLEENVSTPSTGRRTRHNSAKSDCQLQSLDETIXXXXXXXXXXXXXXXXXXXXTLDGDINPEGETGKSNSNDIHSAIKSGCDLTSLEETMNEVIHKMSSGPSCSVANSSAQSVMADSEAANRPITNNIKVSIPNHELSKQKKVNVNHVKPPMYQLSGNMGSITNLLLGIPSILTVNCQTNALGQNKMPSQLTLPISKLAVSTIQSNIVSASTLVPSSITLHNQQNTITSVQSTEVMMTKLNSLTPIMIPAPLRNLTPLAHNNNSNLANQSLITSGRPLSNPVCGTIMXXXXXXXXXXXXXXKLINVTVPIPNNKPITSPINVVPRSPITPNPGLNLSKMPNSVDMISNYILLQRQVNQTKSKLPNLCXXXXXXXXXXXXXXXXXXXXXXVPTGLTASISNTGHSIILSQLTHANSVLSPINTAYLTASVNRTTNSAGNLLQSLPTTNCLSAGIPSNSVVXXXXXXXXXTQSVILRPMNIPFPKFDEKDDWLKQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESVP 8398
            MKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVAFIDCKSSTKALESVKTLMEVPLKLEYCEANGEPGINYLGNNGNSSENQKIIEKSNHKQSTKTSTSSRSRSNSSNTSSFGSSIDDCSKYPGIQQSKRVDENSNNYDSNDNEKDKLSNNNNNN   HEADKQCLNKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKYLGLLEETRPQSFDRYENKSDYEDPYDEVYGTRQSRHRKSAGGHQRLYGSDNYGL+EEYSDDYRYSKSSVRHYEDYSPTHSPVRYSRSSQKFSTEQYNSRKSNYRYNSDYYDAKRDPVASSNSYYPHRRSPEPGFIHSNHNRSYSPSPSSSADYCVENSRFNLPTKRYRQTSKEFRSSRSKVADNHETRSARFERNSENRSWNKSNRYDYNGYAHYRSKSKSHSRLSGSNSPHSRHSMSQQRSYRNESAKKTRSHKIANNASVTEHIRLSTQKSSSKPASNSKLTPSTYSTKTSSNNSNADTSGIALLDSVKSSINSTNIGNAAASQSADTLSKLERERAKLLQELSMLSEDGSGVGLGSISKSNKSSSKLSDLETRSGSHKSQKKHASPLVGSEFSQPVKRSSGLESKLAAVASGIIPSPTPDCQSQSQFLFSDSYKTVKDS+DFGKENQIKLETLSTNSLDVIVKLEPILPTKDVIILNSSMDLFGVECSVSKVS+SVTLPSNMDVTCSDSLASTTSSSVTNQCRDPRLSSTNYNIRSLSSSLCPLSP+EHNLPLLTAISMTTTSTATSATSATIATIVNTTSVLS+YQDAGIA SATQNPHLQFSTTVMPLITSNYKDSTSDSDLDHFSNIDNEVDKRIRELDAKLNRNEQTVRTLDYSKFRIRKKVCDIGNCSASYNSSSSGLISSPTCLSAPTPSLSVTSSLLDVGYSGGITRDNNSNTSEFIKTMLNQTKPKNYHLLADSLPSSDHLTCNYSTVVSTNSSLPFRTVDLGANDIERRTLYSRFGSLSSNNLPLLDTKLSVDTTHLSPTINTHSSKFVSTTSSISNSKMPSVLTISPTATTSSTTSTPTILYDSNQPMKSILKKSIPTTPTSSKPPSDTPATSKFKASLSLLDCSSSNESKSVPKKSFNPIKRKSQSESEDSVEYSKPSKKIKIESGPTLDDSLFPTYPSAPIKKLKKSSKNSLSSSSSAHLSKYDSKNSIPSKRSPSSIIYSNSSSTRNSIGIDKSRVSKKSAKINQSNHSNQKSTKLYKDKKKTSSKLSINKKSKSKVGSNRKNKQMKAEKVKKSSKRNKEKEFYDNNIDNAIKDDEIEDDNNDDLSEFDDDFDKESGSSDNGNYESMYDKIKRRNSTKSVSSGKKRRNKHLNSLTNAASSDAMDSDDSEYWVSKSSKKCIPPKRKRARLSDLSSSHFSDSNSCKTTPCGKSQEPHLSSDYSDIKSDIVHQNNFYHMKADENTKDESVTDESKAPAESFNLSSPHNSSQCSSPKYVKDASLISINKEAECNNFAAQSILASYRTRSLHRPNDGPLKKRPIAEPIILSEDLPYLEKQPDDEFITTSPTSINEEPPSQLESMYDVPQSQQTNILEEVVLDDHQDSLDVVEVEYGSHDLGNDQNPIDIDPPLPADVDSASHILMTMKTQPNIELEYA+VTTTTSNEPDHQIQSVAEHLISLAQNSIVSSIGFPQPESAVIVTEEEKQSQIASTRACKVSNPNSKQKDYEVTTYVKNIIDKIKKETDLANLMNKDKLVCKRNKKLPGSTVGLPKPQPITQESRPTVPGEPDHTNIRV TAPIVQPIEPVTALSNSAVNTMLSVSQSLHEPLQQKTQLIKPIETKK IPLEENVSTPSTGRRTRHNSAKSDCQLQSLDETIDNVVKSSMSSSVSDAVSNKSTLDGDINPEGETGKSNSNDIHSAIKSGCDLTSLEETMNEVIHKMSSGPSCSVANSSAQSVMADSEAANRPITNNIKVSIPNHELSKQKKVNVNHVKPPMYQLSGNMGSITNLLLGIPSILTVNCQTNALGQNKMPSQLTLPISKLAVSTIQSNIVSASTLVPSSITLHNQQNTITSVQSTEVMMTKLNSLTPIMIPAPLRNLTPLAHNNNSNLANQSLITSGRPLSNPVCGTIMSASNSNLPSDNSSSKLINVTVPIPNNKPITSPINVVPRSPITPNPGLNLSKMPNSVDMISNYILLQRQVNQTKSKLPNLC Q +++++NNN   GGGGGSQNVPTGLTASISNTGHSIILSQLTHANSVLSPINTAYLTASVNRTTNSAGNLLQSLPTTNCLSAGIPSNSVVAAAAAAAAATQSVILRPMNIPFPKFDEKDDWLKQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESVP
Sbjct:    1 MKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVAFIDCKSSTKALESVKTLMEVPLKLEYCEANGEPGINYLGNNGNSSENQKIIEKSNHKQSTKTSTSSRSRSNSSNTSSFGSSIDDCSKYPGIQQSKRVDENSNNYDSNDNEKDKLSNNNNNNNEPHEADKQCLNKELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVFFGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAFMNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKYLGLLEETRPQSFDRYENKSDYEDPYDEVYGTRQSRHRKSAGGHQRLYGSDNYGLDEEYSDDYRYSKSSVRHYEDYSPTHSPVRYSRSSQKFSTEQYNSRKSNYRYNSDYYDAKRDPVASSNSYYPHRRSPEPGFIHSNHNRSYSPSPSSSADYCVENSRFNLPTKRYRQTSKEFRSSRSKVADNHETRSARFERNSENRSWNKSNRYDYNGYAHYRSKSKSHSRLSGSNSPHSRHSMSQQRSYRNESAKKTRSHKIANNASVTEHIRLSTQKSSSKPASNSKLTPSTYSTKTSSNNSNADTSGIALLDSVKSSINSTNIGNAAASQSADTLSKLERERAKLLQELSMLSEDGSGVGLGSISKSNKSSSKLSDLETRSGSHKSQKKHASPLVGSEFSQPVKRSSGLESKLAAVASGIIPSPTPDCQSQSQFLFSDSYKTVKDSIDFGKENQIKLETLSTNSLDVIVKLEPILPTKDVIILNSSMDLFGVECSVSKVSESVTLPSNMDVTCSDSLASTTSSSVTNQCRDPRLSSTNYNIRSLSSSLCPLSPAEHNLPLLTAISMTTTSTATSATSATIATIVNTTSVLSYYQDAGIAASATQNPHLQFSTTVMPLITSNYKDSTSDSDLDHFSNIDNEVDKRIRELDAKLNRNEQTVRTLDYSKFRIRKKVCDIGNCSASYNSSSSGLISSPTCLSAPTPSLSVTSSLLDVGYSGGITRDNNSNTSEFIKTMLNQTKPKNYHLLADSLPSSDHLTCNYSTVVSTNSSLPFRTVDLGANDIERRTLYSRFGSLSSNNLPLLDTKLSVDTTHLSPTINTHSSKFVSTTSSISNSKMPSVLTISPTATTSSTTSTPTILYDSNQPMKSILKKSIPTTPTSSKPPSDTPATSKFKASLSLLDCSSSNESKSVPKKSFNPIKRKSQSESEDSVEYSKPSKKIKIESGPTLDDSLFPTYPSAPIKKLKKSSKNSLSSSSSAHLSKYDSKNSIPSKRSPSSIIYSNSSSTRNSIGIDKSRVSKKSAKINQSNHSNQKSTKLYKDKKKTSSKLSINKKSKSKVGSNRKNKQMKAEKVKKSSKRNKEKEFYDNNIDNAIKDDEIEDDNNDDLSEFDDDFDKESGSSDNGNYESMYDKIKRRNSTKSVSSGKKRRNKHLNSLTNAASSDAMDSDDSEYWVSKSSKKCIPPKRKRARLSDLSSSHFSDSNSCKTTPCGKSQEPHLSSDYSDIKSDIVHQNNFYHMKADENTKDESVTDESKAPAESFNLSSPHNSSQCSSPKYVKDASLISINKEAECNNFAAQSILASYRTRSLHRPNDGPLKKRPIAEPIILSEDLPYLEKQPDDEFITTSPTSINEEPPSQLESMYDVPQSQQTNILEEVVLDDHQDSLDVVEVEYGSHDLGNDQNPIDIDPPLPADVDSASHILMTMKTQPNIELEYASVTTTTSNEPDHQIQSVAEHLISLAQNSIVSSIGFPQPESAVIVTEEEKQSQIASTRACKVSNPNSKQKDYEVTTYVKNIIDKIKKETDLANLMNKDKLVCKRNKKLPGSTVGLPKPQPITQESRPTVPGEPDHTNIRVATAPIVQPIEPVTALSNSAVNTMLSVSQSLHEPLQQKTQLIKPIETKKSIPLEENVSTPSTGRRTRHNSAKSDCQLQSLDETIDNVVKSSMSSSVSDAVSNKSTLDGDINPEGETGKSNSNDIHSAIKSGCDLTSLEETMNEVIHKMSSGPSCSVANSSAQSVMADSEAANRPITNNIKVSIPNHELSKQKKVNVNHVKPPMYQLSGNMGSITNLLLGIPSILTVNCQTNALGQNKMPSQLTLPISKLAVSTIQSNIVSASTLVPSSITLHNQQNTITSVQSTEVMMTKLNSLTPIMIPAPLRNLTPLAHNNNSNLANQSLITSGRPLSNPVCGTIMSASNSNLPSDNSSSKLINVTVPIPNNKPITSPINVVPRSPITPNPGLNLSKMPNSVDMISNYILLQRQVNQTKSKLPNLC-QQSTSNDNNNNGSGGGGGSQNVPTGLTASISNTGHSIILSQLTHANSVLSPINTAYLTASVNRTTNSAGNLLQSLPTTNCLSAGIPSNSVVAAAAAAAAATQSVILRPMNIPFPKFDEKDDWLKQNKQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLSQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCSKLYDKLKEESVP 2762          
BLAST of Protein split ends vs. Planmine SMEST
Match: SMESG000078393.1 (SMESG000078393.1)

HSP 1 Score: 155.992 bits (393), Expect = 3.133e-37
Identity = 75/144 (52.08%), Postives = 99/144 (68.75%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSL----SQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPE-SQQNAYVIHIFPPCEFSDNQL 8347
            YP+ W GKL LKN+E  V +H + GN +L+   M+L+    SL    +  L+IVQRMRL+ +QLEG+QRR+    EFC  L L GGD + +  + S IL + FIKY+++K AAGIIN+C PE SQQ  YV+HIFPPC+FS NQL
Sbjct: 2411 YPLVWEGKLSLKNEEAKVALHFVHGNTELLNACMHLLIFSGSLQWNNTGSLKIVQRMRLDLSQLEGVQRRMQNANEFCIGLALPGGDDINQWVKQSQILEEGFIKYMRDKGAAGIINVCHPENSQQGLYVVHIFPPCDFSINQL 2554          

HSP 2 Score: 115.161 bits (287), Expect = 8.103e-25
Identity = 85/291 (29.21%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  665 GLLIENLSQRSSDTSLREGLFHEYKKHGK--------ITSVTV---MGQASGRYAIISFKRSEDMEKAFE-ASQGKVFFGNLIKAKQHNGFNYIDPD---LCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSF---AFVQYYDISSVVRALRNQDNI-------KIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            G+ +  LS + S++S+R  L  ++    K        I S+ +    G +  R+AI++F  S D EKA + AS+ +         + H G++  D D   +      +DE+HPKA++TL +  L         L + F K G+++DI+IK     P       A VQ+ DIS VV+ L +  ++        I S S    FG S PTNC+W+G +  + N+  +  +F R+G ++ V+ D +   AL+  D    AQ+++   + +++  G    R+Q+DYAS E Q   
Sbjct:   66 GIKVSRLSLQCSESSIRHSLIQQFGIQNKNSQNRNYNIKSIVLESAAGPSPTRWAIVTFVTSYDAEKALQMASKSQ-------SVELHPGYDLFDFDELNITANPQGLDEFHPKASRTLQISNLPQHLNNFKILYEYFSKLGKVLDIEIK-----PKLVLHASALVQFSDISKVVKILVSPRSVLKCLVGSSITS-STSFQFGPSFPTNCIWLGQISNSINENQITEYFSRFGHVLEVVQDVKQQKALVYLDNAFAAQQSIIHLKRKNSFLG--TCRVQIDYASLECQATI 341          
BLAST of Protein split ends vs. Planmine SMEST
Match: SMESG000078393.1 (SMESG000078393.1)

HSP 1 Score: 155.992 bits (393), Expect = 3.145e-37
Identity = 75/144 (52.08%), Postives = 99/144 (68.75%), Query Frame = 2
Query: 7931 YPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSL----SQPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSILNDNFIKYLQEKSAAGIINICIPE-SQQNAYVIHIFPPCEFSDNQL 8347
            YP+ W GKL LKN+E  V +H + GN +L+   M+L+    SL    +  L+IVQRMRL+ +QLEG+QRR+    EFC  L L GGD + +  + S IL + FIKY+++K AAGIIN+C PE SQQ  YV+HIFPPC+FS NQL
Sbjct: 2276 YPLVWEGKLSLKNEEAKVALHFVHGNTELLNACMHLLIFSGSLQWNNTGSLKIVQRMRLDLSQLEGVQRRMQNANEFCIGLALPGGDDINQWVKQSQILEEGFIKYMRDKGAAGIINVCHPENSQQGLYVVHIFPPCDFSINQL 2419          

HSP 2 Score: 93.5893 bits (231), Expect = 2.583e-18
Identity = 63/204 (30.88%), Postives = 103/204 (50.49%), Query Frame = 2
Query:  890 HNGFNYIDPD---LCPPEHAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQSNQPDTSF---AFVQYYDISSVVRALRNQDNI-------KIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF 1462
            H G++  D D   +      +DE+HPKA++TL +  L         L + F K G+++DI+IK     P       A VQ+ DIS VV+ L +  ++        I S S    FG S PTNC+W+G +  + N+  +  +F R+G ++ V+ D +   AL+  D    AQ+++   + +++  G    R+Q+DYAS E Q   
Sbjct:   11 HPGYDLFDFDELNITANPQGLDEFHPKASRTLQISNLPQHLNNFKILYEYFSKLGKVLDIEIK-----PKLVLHASALVQFSDISKVVKILVSPRSVLKCLVGSSITS-STSFQFGPSFPTNCIWLGQISNSINENQITEYFSRFGHVLEVVQDVKQQKALVYLDNAFAAQQSIIHLKRKNSFLG--TCRVQIDYASLECQATI 206          
BLAST of Protein split ends vs. Planmine SMEST
Match: SMESG000001341.1 (SMESG000001341.1)

HSP 1 Score: 93.5893 bits (231), Expect = 8.565e-19
Identity = 88/289 (30.45%), Postives = 131/289 (45.33%), Query Frame = 2
Query:  653 KELCGLLIENLSQRSSDTSLREGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVF------FGNLIKAKQHNG-FNYIDPD---LCPPE----------------HAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQS-NQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYA 1438
            K LC   + NL  + ++  +   L  EY + G+  +V V      R A I+FK SE+   A  A    V          ++ +K   G  NY +PD      P                 H   E  PKAT+TLFVG L++  + + DL++ F+K+G I DIDIK  +    + S+AFV+Y ++    RA  N     I +   K+G+GK  PT CLW+G L        L + F  +G I  +        A I F+ VE A  A  + R    G+    KR++VD++
Sbjct:   53 KSLC---VRNLHSKLTNEDIETLLSREYSQFGEF-NVKVAQFNGERVAYINFKYSENARSARYAKPKPVICEKQCTVDPVLASKYRYGPGNYDEPDRRRAGSPRIRNDSDKKDKFPHHLYHIEPEDDPKATRTLFVGNLSS-EIEDHDLREHFEKYGVIEDIDIKRPAKGTTNNSYAFVKYANLDMAHRAKVNMSGKIIRNFQCKIGYGKVTPTKCLWVGGLGPWVQYDVLEKAFSHFGTIQEIDWPLNKQYAYILFENVESAVAACDNLRGFKLGDA--VKRIRVDFS 334          
BLAST of Protein split ends vs. Planmine SMEST
Match: SMESG000001341.1 (SMESG000001341.1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.033e-18
Identity = 60/169 (35.50%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  935 HAMDEYHPKATKTLFVGKLTTGSVTESDLKKSFKKFGEIIDIDIKTQS-NQPDTSFAFVQYYDISSVVRALRNQDNIKIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPDPEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYA 1438
            H   E  PKAT+TLFVG L++  + + DL++ F+K+G I DIDIK  +    + S+AFV+Y ++    RA  N     I +   K+G+GK  PT CLW+G L        L + F  +G I  +        A I F+ VE A  A  + R    G+    KR++VD++
Sbjct:   47 HIEPEDDPKATRTLFVGNLSS-EIEDHDLREHFEKYGVIEDIDIKRPAKGTTNNSYAFVKYANLDMAHRAKVNMSGKIIRNFQCKIGYGKVTPTKCLWVGGLGPWVQYDVLEKAFSHFGTIQEIDWPLNKQYAYILFENVESAVAACDNLRGFKLGDA--VKRIRVDFS 212          
The following BLAST results are available for this feature:
BLAST of Protein split ends vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPEN1.296e-6543.00spen family transcriptional repressor [Source:HGNC... [more]
SPEN8.080e-6242.71spen family transcriptional repressor [Source:HGNC... [more]
SPEN6.518e-5945.22spen family transcriptional repressor [Source:HGNC... [more]
RBM151.106e-1932.98RNA binding motif protein 15 [Source:HGNC Symbol;A... [more]
RBM151.116e-1932.98RNA binding motif protein 15 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Protein split ends vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
din-11.290e-1931.08Daf-12-interacting protein 1 [Source:UniProtKB/Sw... [more]
din-11.290e-1931.08Daf-12-interacting protein 1 [Source:UniProtKB/Sw... [more]
din-11.445e-1830.92Daf-12-interacting protein 1 [Source:UniProtKB/Sw... [more]
din-11.445e-1830.92Daf-12-interacting protein 1 [Source:UniProtKB/Sw... [more]
din-18.143e-1730.92Daf-12-interacting protein 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Protein split ends vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spen5.641e-6346.49gene:FBgn0016977 transcript:FBtr0078121[more]
spen5.939e-6346.49gene:FBgn0016977 transcript:FBtr0078122[more]
spen5.966e-6346.49gene:FBgn0016977 transcript:FBtr0078123[more]
spen6.164e-6346.49gene:FBgn0016977 transcript:FBtr0332337[more]
spen6.497e-6346.49gene:FBgn0016977 transcript:FBtr0306341[more]
back to top
BLAST of Protein split ends vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-335m2.21.482e-5943.12si:ch1073-335m2.2 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
spen7.302e-5943.12spen family transcriptional repressor [Source:ZFIN... [more]
spen5.120e-3046.58spen family transcriptional repressor [Source:ZFIN... [more]
rbm151.610e-1931.61RNA binding motif protein 15 [Source:ZFIN;Acc:ZDB-... [more]
rbm151.610e-1931.61RNA binding motif protein 15 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein split ends vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam78b2.137e-6042.76family with sequence similarity 78 member B [Sourc... [more]
RBM151.635e-1731.67RNA binding motif protein 15 [Source:NCBI gene;Acc... [more]
smpd36.441e-1732.30sphingomyelin phosphodiesterase 3 [Source:Xenbase;... [more]
cep1125.273e-630.83centrosomal protein 112kDa [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Protein split ends vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spen2.515e-6343.82spen family transcription repressor [Source:MGI Sy... [more]
Spen2.728e-6343.82spen family transcription repressor [Source:MGI Sy... [more]
Rbm153.138e-1932.45RNA binding motif protein 15 [Source:MGI Symbol;Ac... [more]
Rbm15b2.366e-1832.56RNA binding motif protein 15B [Source:MGI Symbol;A... [more]
Hnrnpab3.113e-731.71heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
back to top
BLAST of Protein split ends vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8SX83|SPEN_DROME5.954e-6246.49Protein split ends OS=Drosophila melanogaster OX=7... [more]
sp|Q62504|MINT_MOUSE6.804e-6243.82Msx2-interacting protein OS=Mus musculus OX=10090 ... [more]
sp|Q96T58|MINT_HUMAN3.880e-6142.71Msx2-interacting protein OS=Homo sapiens OX=9606 G... [more]
sp|Q96T37|RBM15_HUMAN7.018e-1932.98RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q0VBL3|RBM15_MOUSE2.195e-1832.45RNA-binding protein 15 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Protein split ends vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WW927.428e-9960.37Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A2H1C3N52.533e-9854.92Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A419PU627.696e-9152.69Msx2-interacting protein OS=Clonorchis sinensis OX... [more]
G7YEN87.719e-9152.69Msx2-interacting protein (Fragment) OS=Clonorchis ... [more]
A0A4S2L2J24.631e-9052.69Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Protein split ends vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spen2.105e-5942.81spen family transcriptional repressor [Source:NCBI... [more]
spen4.880e-5642.70spen family transcriptional repressor [Source:NCBI... [more]
rbm157.455e-2132.76RNA binding motif protein 15 [Source:NCBI gene;Acc... [more]
rbm15b5.772e-1731.29RNA binding motif protein 15B [Source:ZFIN;Acc:ZDB... [more]
ENSAMXT00000047453.17.205e-928.24pep primary_assembly:Astyanax_mexicanus-2.0:22:183... [more]
back to top
BLAST of Protein split ends vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tia1l1.805e-724.32cytotoxic granule-associated RNA binding protein 1... [more]
back to top
BLAST of Protein split ends vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PUB16.164e-825.98Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NSR16.465e-626.58Nucleolar protein that binds nuclear localization ... [more]
back to top
BLAST of Protein split ends vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO408919.030e-4538.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408909.875e-3145.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496951.462e-2327.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein split ends vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-335m2.26.407e-5943.48spen family transcriptional repressor [Source:NCBI... [more]
spen2.024e-3642.55msx2-interacting protein-like [Source:NCBI gene;Ac... [more]
spen2.119e-3642.55msx2-interacting protein-like [Source:NCBI gene;Ac... [more]
rbm152.003e-1931.38RNA binding motif protein 15 [Source:NCBI gene;Acc... [more]
rbm15b2.658e-1830.60RNA binding motif protein 15B [Source:NCBI gene;Ac... [more]
back to top
BLAST of Protein split ends vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016300.10.000e+099.20SMESG000016300.1[more]
SMESG000078393.13.133e-3752.08SMESG000078393.1[more]
SMESG000078393.13.145e-3752.08SMESG000078393.1[more]
SMESG000001341.18.565e-1930.45SMESG000001341.1[more]
SMESG000001341.16.033e-1835.50SMESG000001341.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027416 ID=SMED30027416|Name=Protein split ends|organism=Schmidtea mediterranea sexual|type=transcript|length=8912bp
GATTACTCTATTTTAGCATTGCATTTGTAAATAATTTCTAATTCGTGATT
TATAGAATTGGATATATAGTGCACCTTTTATGTTTACTTGAGTGGAATAC
TTTATTTTGATAATGAAAATTACTCGTTATTTGTGGATTAATAATTTATC
AAACAATTGCGAAGAAAATGATATTCGTCAGTCATTTCAGAGCCATGGAA
AAATTCAAACGATAAGAATTCACAAAAATAATAATTCTCGAGGTGCTATA
GTTGCATTTATCGATTGTAAATCATCGACAAAAGCTTTAGAAAGTGTCAA
AACACTAATGGAAGTTCCATTGAAATTAGAATATTGTGAAGCGAACGGTG
AGCCAGGGATAAATTACCTTGGAAATAATGGCAACAGTTCAGAAAATCAA
AAAATTATTGAGAAAAGTAATCATAAACAATCAACAAAAACAAGCACGTC
GTCGCGATCAAGAAGCAACAGCAGCAACACAAGCAGCTTTGGATCATCAA
TTGATGATTGTTCAAAGTATCCGGGAATTCAACAGTCGAAACGAGTGGAT
GAAAACAGCAATAATTACGATTCGAATGACAATGAGAAGGATAAATTGTC
CAACAATAACAACAACAATGAGTCGCACGAGGCCGACAAACAATGCCTCA
ACAAGGAATTGTGCGGATTATTGATTGAAAATCTCTCCCAACGTTCCTCG
GACACGAGTTTGCGGGAGGGATTATTTCACGAGTACAAAAAGCATGGGAA
AATTACCTCAGTCACGGTAATGGGCCAAGCCAGTGGGCGTTATGCGATTA
TTTCTTTCAAAAGAAGCGAAGATATGGAGAAAGCGTTCGAAGCGTCTCAG
GGGAAAGTATTTTTTGGCAACTTAATCAAAGCTAAACAGCACAATGGATT
CAATTACATCGATCCAGACCTCTGTCCACCGGAGCACGCCATGGACGAGT
ACCATCCGAAGGCGACGAAAACTTTGTTCGTCGGGAAACTCACCACCGGA
TCGGTGACAGAGTCGGATTTGAAGAAATCCTTCAAGAAATTCGGAGAAAT
CATTGATATCGACATTAAAACCCAAAGCAATCAACCCGACACTTCGTTTG
CTTTCGTGCAATATTATGATATTTCCAGCGTTGTTCGTGCGCTACGCAAT
CAAGACAACATCAAAATCGATAGCAAATCCGTCAAGTTGGGATTCGGAAA
GAGCCAGCCGACGAATTGTTTGTGGATTGGAAACTTGCAACGCAACGCAA
ATGACGCATTCCTTCGGCGGCATTTCCGTCGATATGGACCGATCATGATT
GTGATACCCGATCCGGAATTCTCATGTGCATTGATACAGTTTGATTGCGT
TGAGGATGCTCAACGCGCCTTGACCGACACAAGGGAGCGCTCTAACGGCA
ACGGCAACAATAACAAGAGGATGCAAGTTGATTACGCGAGCAACGAATAT
CAAATGGCATTCATGAATCGGCTGAGGAAGTCCTGCCAATTCGATTCCCA
CGATTTGCTGAAAACCTATGCCGATCCTTATCAGACGGAGAAAATCCAGA
ATCTGCTGATTTCTTACACGAAATATCTCGGCTTGCTGGAGGAAACGAGA
CCACAATCATTCGATAGGTACGAGAACAAGAGCGATTATGAAGACCCATA
CGATGAAGTGTATGGGACGCGACAATCTCGCCATAGGAAATCGGCAGGTG
GCCATCAACGGTTATATGGAAGCGATAATTACGGATTGGAAGAAGAATAT
AGTGACGATTATCGATACTCGAAATCTTCAGTCAGACATTATGAGGATTA
TTCGCCAACTCATTCTCCGGTGAGATATTCTCGCTCTAGCCAGAAATTCT
CTACAGAACAATACAATTCTCGCAAATCGAATTACAGATACAATAGTGAT
TATTATGATGCAAAACGAGATCCTGTGGCTAGTTCAAATTCATATTATCC
CCACCGACGCAGCCCCGAGCCAGGATTTATACATTCCAATCATAATCGCA
GCTACAGTCCGTCGCCGTCGTCATCAGCAGATTATTGCGTTGAGAATTCC
CGTTTCAATTTGCCAACGAAGCGCTACCGACAGACAAGCAAAGAGTTTCG
GTCGAGCCGATCAAAAGTTGCTGATAATCATGAAACTCGCAGTGCGCGAT
TCGAGAGAAACTCGGAAAATCGCAGTTGGAACAAGTCAAATAGATACGAC
TACAACGGATATGCTCATTACCGATCAAAATCCAAGAGTCATTCTCGCTT
GTCTGGCAGCAATTCGCCTCATTCTCGTCATTCAATGAGCCAACAGCGCA
GCTATAGGAATGAATCAGCGAAAAAGACTCGGTCACATAAAATTGCCAAC
AATGCCAGCGTCACCGAACATATCCGATTGTCGACACAAAAGTCGAGCTC
AAAGCCGGCAAGCAACTCTAAATTGACTCCGTCGACATATAGCACCAAAA
CAAGCAGCAATAACAGCAATGCTGACACGTCGGGGATAGCGTTACTGGAC
TCTGTTAAATCATCAATTAATTCCACAAACATCGGCAATGCGGCTGCCTC
ACAGTCGGCAGATACGTTATCGAAATTGGAACGAGAACGAGCGAAATTGT
TACAGGAATTGTCCATGTTAAGTGAGGATGGTAGCGGTGTGGGTTTAGGT
AGCATCAGCAAGAGTAATAAATCCTCATCGAAACTCAGTGACCTAGAAAC
CCGGAGCGGCAGCCACAAGTCACAGAAGAAACACGCTTCACCACTCGTTG
GCAGCGAATTTAGCCAACCCGTGAAACGGTCTAGCGGGCTCGAATCGAAA
CTCGCAGCAGTAGCAAGTGGAATAATTCCATCACCGACGCCAGATTGTCA
GAGCCAGTCTCAATTCCTCTTCTCCGACTCGTACAAGACGGTCAAGGACT
CGCTCGATTTCGGCAAGGAAAACCAAATTAAATTGGAAACATTATCGACA
AACTCACTGGATGTAATCGTTAAGTTGGAACCGATTTTACCAACAAAGGA
TGTGATTATACTAAATTCCAGCATGGATTTATTTGGTGTCGAGTGTTCCG
TGTCAAAGGTTTCTCAATCTGTGACTCTGCCATCAAATATGGATGTTACT
TGTAGCGATTCTCTCGCCTCAACTACATCGAGCTCTGTCACCAATCAGTG
TCGAGATCCGAGATTGAGCTCGACCAATTACAATATTCGTTCATTATCGT
CTTCGCTCTGTCCTCTCTCTCCATCTGAGCACAATTTACCCCTGTTGACA
GCGATCTCAATGACCACCACCTCCACCGCAACCTCTGCTACCTCGGCCAC
CATCGCAACCATAGTCAATACGACATCGGTATTGTCACATTATCAAGATG
CCGGCATTGCCACCTCAGCAACCCAGAATCCACACCTCCAATTCTCCACC
ACCGTGATGCCCCTCATCACGAGCAACTACAAGGATTCTACCAGTGATTC
CGATCTCGATCATTTCAGCAACATTGACAACGAGGTCGATAAACGGATTC
GTGAACTCGACGCGAAATTGAATCGCAACGAACAAACTGTTCGCACCTTG
GATTATAGCAAATTCCGAATTAGGAAAAAAGTTTGTGATATTGGAAATTG
TTCAGCGTCCTACAACAGCAGTAGCAGTGGATTAATTTCCTCGCCGACTT
GTTTATCGGCACCTACTCCGTCTCTGTCCGTCACGTCAAGCCTGCTCGAT
GTCGGCTATTCCGGCGGCATTACTCGTGACAACAATTCCAACACCTCGGA
ATTTATCAAGACCATGCTCAATCAGACGAAGCCAAAAAACTATCATTTGT
TGGCGGATTCATTGCCTTCCTCTGATCATTTGACGTGTAATTATTCGACA
GTTGTATCCACTAATTCCTCTCTCCCGTTTCGAACCGTCGATCTTGGAGC
TAATGATATTGAACGACGAACTCTATATTCACGATTTGGATCGTTGAGTT
CTAACAATCTTCCTTTATTAGACACGAAGCTCAGTGTCGACACGACTCAT
TTAAGCCCGACAATCAACACTCATAGTTCTAAATTTGTGTCGACAACAAG
CTCTATTTCAAACTCTAAAATGCCATCAGTTCTCACAATTTCTCCGACGG
CAACAACCAGCAGCACTACATCTACTCCTACAATCCTATACGATTCAAAT
CAGCCTATGAAATCCATCCTGAAGAAATCCATTCCAACAACACCAACTAG
CTCCAAGCCACCTTCAGATACCCCTGCAACCAGCAAGTTCAAGGCTTCAT
TATCATTACTCGACTGTAGCAGTTCCAATGAGTCGAAATCCGTCCCAAAA
AAATCCTTCAATCCTATCAAACGAAAATCGCAATCCGAATCAGAAGACAG
CGTGGAATATTCTAAACCGTCAAAAAAAATCAAAATCGAATCAGGTCCGA
CTTTAGACGATTCACTCTTTCCCACATATCCCTCAGCACCGATTAAGAAA
CTGAAAAAGTCATCAAAAAATTCTTTATCGTCTTCATCGTCAGCACACCT
GTCAAAATACGACAGTAAAAATTCCATTCCGTCCAAGAGGTCTCCATCGA
GTATTATCTATTCCAATAGCTCCAGCACTAGAAACAGCATTGGCATTGAT
AAATCTCGAGTTTCTAAGAAATCTGCCAAAATCAACCAATCAAATCACTC
GAATCAGAAATCAACAAAATTATATAAAGATAAGAAGAAAACAAGTTCTA
AATTATCGATTAATAAAAAATCAAAATCCAAAGTTGGTTCAAATCGGAAA
AATAAACAAATGAAAGCTGAGAAAGTAAAAAAATCGTCAAAGCGAAATAA
AGAAAAGGAATTTTATGACAATAATATTGACAATGCTATTAAAGACGACG
AAATTGAGGATGACAACAACGACGATTTGAGTGAATTTGACGATGATTTC
GACAAGGAAAGCGGCTCGTCAGATAACGGTAATTACGAATCAATGTATGA
CAAAATCAAGCGCCGGAATAGCACCAAATCGGTGTCGTCGGGTAAAAAGC
GACGCAACAAGCATTTGAATTCACTGACAAACGCCGCAAGTTCCGATGCC
ATGGATAGTGATGACAGTGAATATTGGGTCAGTAAATCTAGCAAGAAATG
CATTCCGCCAAAACGCAAACGAGCCAGGTTGTCTGATCTTAGCAGTAGCC
ATTTTTCTGATAGTAACTCGTGCAAAACTACTCCATGCGGCAAGTCACAA
GAGCCTCATTTGTCGTCTGATTATTCCGACATCAAATCCGACATAGTTCA
CCAGAACAATTTCTATCACATGAAAGCCGATGAAAACACGAAAGACGAAT
CGGTGACAGACGAGAGTAAAGCTCCAGCGGAATCATTCAATCTCAGCAGT
CCTCATAATTCATCTCAATGTTCAAGCCCGAAATATGTGAAGGATGCAAG
TCTAATATCAATTAATAAGGAGGCCGAGTGCAACAATTTCGCGGCACAAT
CAATACTGGCATCATACAGAACACGATCCTTGCATCGACCGAACGACGGG
CCGCTAAAGAAACGACCAATCGCAGAACCAATCATTCTATCAGAAGATCT
ACCATATTTAGAAAAGCAACCAGACGACGAATTTATCACTACGAGTCCCA
CAAGTATCAATGAGGAACCGCCAAGCCAACTGGAATCGATGTATGATGTA
CCACAATCTCAACAGACAAATATCCTTGAGGAAGTTGTGCTAGATGATCA
CCAGGATTCTCTAGATGTTGTCGAGGTGGAATATGGTTCTCATGATTTGG
GAAACGATCAGAATCCAATCGATATTGACCCGCCTTTGCCAGCAGATGTT
GATTCTGCTTCACATATCCTTATGACAATGAAAACTCAGCCCAATATTGA
GTTAGAATATGCAAACGTTACCACCACAACCAGTAATGAACCAGACCACC
AGATCCAATCGGTAGCGGAACATTTGATAAGCCTGGCTCAGAATTCCATT
GTCAGTTCCATTGGATTTCCGCAACCGGAATCCGCCGTCATAGTTACGGA
AGAAGAGAAACAGTCTCAGATTGCGTCAACTCGTGCCTGCAAAGTTAGTA
ATCCCAACAGCAAGCAAAAAGATTACGAAGTAACAACATACGTCAAAAAT
ATCATCGATAAAATAAAAAAAGAAACCGATTTAGCAAATCTAATGAATAA
AGATAAATTAGTGTGCAAACGAAATAAAAAATTGCCCGGGTCAACTGTAG
GGTTGCCTAAACCACAACCAATAACTCAGGAATCCAGACCGACCGTTCCT
GGGGAACCGGATCACACAAATATCCGCGTAACAACTGCTCCTATCGTCCA
GCCAATTGAGCCAGTCACGGCACTGTCCAATTCTGCTGTCAATACAATGC
TGTCAGTGTCTCAATCTTTGCATGAACCTTTGCAACAGAAGACCCAATTG
ATAAAACCTATAGAAACTAAAAAACCGATTCCATTGGAGGAAAACGTAAG
TACTCCTTCAACTGGTCGTCGAACTCGCCATAACAGTGCCAAATCGGATT
GTCAATTACAATCTCTCGATGAAACCATTGATAACGTGGTCAAGAGCTCA
ATGAGCTCATCGGTTTCCGATGCCGTGTCTAACAAGTCGACTCTGGATGG
CGATATCAATCCCGAAGGAGAAACGGGCAAATCGAATTCTAATGATATCC
ATTCTGCTATAAAATCCGGCTGTGATCTTACATCGCTTGAGGAAACAATG
AATGAAGTGATTCACAAAATGAGCAGCGGTCCTTCATGCTCGGTGGCGAA
CTCGTCGGCACAATCAGTGATGGCTGACAGTGAGGCGGCAAACAGACCGA
TTACTAACAATATCAAAGTTTCCATTCCAAATCATGAACTCAGCAAGCAG
AAAAAAGTAAATGTAAATCACGTCAAGCCTCCAATGTACCAATTATCGGG
AAATATGGGCAGCATTACCAATTTGTTGTTAGGAATCCCTTCAATATTGA
CTGTCAACTGCCAGACTAACGCGCTTGGACAAAACAAGATGCCTTCACAA
TTAACTCTTCCAATCAGCAAGTTGGCGGTATCAACTATCCAATCAAATAT
CGTTTCCGCATCGACTCTTGTTCCGTCGAGCATAACTCTCCACAACCAAC
AAAACACGATAACTAGTGTTCAGTCCACCGAAGTTATGATGACAAAGTTG
AATTCTCTCACGCCGATAATGATTCCGGCACCGTTGCGCAATCTGACACC
GTTAGCACATAACAACAATAGTAATTTAGCAAACCAATCACTGATTACCA
GCGGCAGGCCTTTATCCAATCCAGTGTGCGGAACGATAATGAGTGCGTCA
AACTCGAATCTGCCTTCAGACAATTCCTCGTCGAAACTCATTAATGTCAC
CGTACCGATACCAAACAATAAGCCTATCACAAGTCCGATAAATGTCGTTC
CGAGGTCTCCTATAACGCCTAATCCGGGCTTGAATCTCTCCAAGATGCCG
AATTCTGTCGACATGATTAGCAACTACATTCTATTACAGAGACAAGTAAA
TCAGACCAAATCTAAGTTGCCAAATTTGTGCCAACAATCGACATCAAATG
ATAACAATAATAATGGCAGTGGCGGCGGCGGCGGCGGCTCACAAAATGTT
CCCACCGGATTGACGGCATCTATCAGCAACACTGGCCATTCTATTATATT
ATCACAACTGACGCATGCCAATAGTGTTCTGTCACCCATAAATACTGCGT
ATTTAACCGCGTCAGTTAACAGGACGACTAACTCGGCTGGGAACTTGTTG
CAATCTTTGCCGACTACCAACTGTTTATCCGCAGGAATTCCCTCAAATTC
TGTCGTAGCTGCCGCTGCCGCCGCTGCTGCTGCTACTCAGTCAGTTATTC
TAAGACCGATGAACATTCCATTTCCCAAATTCGATGAGAAAGACGACTGG
TTAAAGCAAAACAAACAAACGGATTTATCCTATCCTGTACGCTGGACTGG
TAAATTGTGCCTTAAAAACGATGAAGTTTTTGTTCAAATGCATATGATTG
CTGGAAATGAAGACCTGATCAAGAACAGCATGAACCTGATATCGAATGGT
CAGAGCTTATCGCAACCGTTGAGGATTGTACAAAGGATGCGGCTCGAACC
GAATCAGTTGGAAGGTCTTCAGCGTCGATTGACTCGTCCTCTGGAATTCT
GTACTTGTTTGACACTAGCGGGTGGGGATAAACTGGAGGAATTGACTCAG
ACCAGTTCCATACTGAATGACAACTTTATTAAATATCTCCAGGAGAAATC
GGCAGCTGGTATCATAAATATTTGTATACCGGAATCACAGCAAAATGCCT
ATGTCATCCATATTTTCCCTCCGTGTGAATTCTCAGACAATCAACTGAAA
AATTGCTGCTCGAAGTTGTACGATAAACTGAAGGAAGAATCAGTTCCATA
CTTGCTTGTTGTGATAACTACTGTATAATATATTATATATATTGGACTAG
AGAAATGCTGTGAATGCATAATAGCCAGAAGCAGCCTCAACTGCGTCCCC
TCATTGCGTTCACTACCGAAACCCAGTGGAGGCAAGTGCTATTATCAAGT
TGCAGATTCATTTCAACGGCTGTGATTTCAATTTCGGTGAATTTAGTCAG
AGAAAATATCAGAATCAAATCGGAGCTTTTTCTGTTGTAATTTTGTAAAT
ATAGTAATTATGATGATGCGGCTGCTGTAATATGATGATGATGGTGATTT
GCACATTGGGTGTGCTGTGCTGTGCTGCATCACCGGACGGACGCTGCTGC
GTGCATGCGAGTGTGTGTGTGTGTGTACATATATCGCTTGTCTGTGAATG
TAAATTATTACATGTACAATCGGTCATTTGTCTCTCTCGTACATTTGCTG
TTGTAATTCTATTGTTACAGACGTTTCCGTTGATTCCAGTTCCATTCATT
CTAGTTATATAT
back to top

protein sequence of SMED30027416-orf-1

>SMED30027416-orf-1 ID=SMED30027416-orf-1|Name=SMED30027416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2772bp
MKITRYLWINNLSNNCEENDIRQSFQSHGKIQTIRIHKNNNSRGAIVAFI
DCKSSTKALESVKTLMEVPLKLEYCEANGEPGINYLGNNGNSSENQKIIE
KSNHKQSTKTSTSSRSRSNSSNTSSFGSSIDDCSKYPGIQQSKRVDENSN
NYDSNDNEKDKLSNNNNNNESHEADKQCLNKELCGLLIENLSQRSSDTSL
REGLFHEYKKHGKITSVTVMGQASGRYAIISFKRSEDMEKAFEASQGKVF
FGNLIKAKQHNGFNYIDPDLCPPEHAMDEYHPKATKTLFVGKLTTGSVTE
SDLKKSFKKFGEIIDIDIKTQSNQPDTSFAFVQYYDISSVVRALRNQDNI
KIDSKSVKLGFGKSQPTNCLWIGNLQRNANDAFLRRHFRRYGPIMIVIPD
PEFSCALIQFDCVEDAQRALTDTRERSNGNGNNNKRMQVDYASNEYQMAF
MNRLRKSCQFDSHDLLKTYADPYQTEKIQNLLISYTKYLGLLEETRPQSF
DRYENKSDYEDPYDEVYGTRQSRHRKSAGGHQRLYGSDNYGLEEEYSDDY
RYSKSSVRHYEDYSPTHSPVRYSRSSQKFSTEQYNSRKSNYRYNSDYYDA
KRDPVASSNSYYPHRRSPEPGFIHSNHNRSYSPSPSSSADYCVENSRFNL
PTKRYRQTSKEFRSSRSKVADNHETRSARFERNSENRSWNKSNRYDYNGY
AHYRSKSKSHSRLSGSNSPHSRHSMSQQRSYRNESAKKTRSHKIANNASV
TEHIRLSTQKSSSKPASNSKLTPSTYSTKTSSNNSNADTSGIALLDSVKS
SINSTNIGNAAASQSADTLSKLERERAKLLQELSMLSEDGSGVGLGSISK
SNKSSSKLSDLETRSGSHKSQKKHASPLVGSEFSQPVKRSSGLESKLAAV
ASGIIPSPTPDCQSQSQFLFSDSYKTVKDSLDFGKENQIKLETLSTNSLD
VIVKLEPILPTKDVIILNSSMDLFGVECSVSKVSQSVTLPSNMDVTCSDS
LASTTSSSVTNQCRDPRLSSTNYNIRSLSSSLCPLSPSEHNLPLLTAISM
TTTSTATSATSATIATIVNTTSVLSHYQDAGIATSATQNPHLQFSTTVMP
LITSNYKDSTSDSDLDHFSNIDNEVDKRIRELDAKLNRNEQTVRTLDYSK
FRIRKKVCDIGNCSASYNSSSSGLISSPTCLSAPTPSLSVTSSLLDVGYS
GGITRDNNSNTSEFIKTMLNQTKPKNYHLLADSLPSSDHLTCNYSTVVST
NSSLPFRTVDLGANDIERRTLYSRFGSLSSNNLPLLDTKLSVDTTHLSPT
INTHSSKFVSTTSSISNSKMPSVLTISPTATTSSTTSTPTILYDSNQPMK
SILKKSIPTTPTSSKPPSDTPATSKFKASLSLLDCSSSNESKSVPKKSFN
PIKRKSQSESEDSVEYSKPSKKIKIESGPTLDDSLFPTYPSAPIKKLKKS
SKNSLSSSSSAHLSKYDSKNSIPSKRSPSSIIYSNSSSTRNSIGIDKSRV
SKKSAKINQSNHSNQKSTKLYKDKKKTSSKLSINKKSKSKVGSNRKNKQM
KAEKVKKSSKRNKEKEFYDNNIDNAIKDDEIEDDNNDDLSEFDDDFDKES
GSSDNGNYESMYDKIKRRNSTKSVSSGKKRRNKHLNSLTNAASSDAMDSD
DSEYWVSKSSKKCIPPKRKRARLSDLSSSHFSDSNSCKTTPCGKSQEPHL
SSDYSDIKSDIVHQNNFYHMKADENTKDESVTDESKAPAESFNLSSPHNS
SQCSSPKYVKDASLISINKEAECNNFAAQSILASYRTRSLHRPNDGPLKK
RPIAEPIILSEDLPYLEKQPDDEFITTSPTSINEEPPSQLESMYDVPQSQ
QTNILEEVVLDDHQDSLDVVEVEYGSHDLGNDQNPIDIDPPLPADVDSAS
HILMTMKTQPNIELEYANVTTTTSNEPDHQIQSVAEHLISLAQNSIVSSI
GFPQPESAVIVTEEEKQSQIASTRACKVSNPNSKQKDYEVTTYVKNIIDK
IKKETDLANLMNKDKLVCKRNKKLPGSTVGLPKPQPITQESRPTVPGEPD
HTNIRVTTAPIVQPIEPVTALSNSAVNTMLSVSQSLHEPLQQKTQLIKPI
ETKKPIPLEENVSTPSTGRRTRHNSAKSDCQLQSLDETIDNVVKSSMSSS
VSDAVSNKSTLDGDINPEGETGKSNSNDIHSAIKSGCDLTSLEETMNEVI
HKMSSGPSCSVANSSAQSVMADSEAANRPITNNIKVSIPNHELSKQKKVN
VNHVKPPMYQLSGNMGSITNLLLGIPSILTVNCQTNALGQNKMPSQLTLP
ISKLAVSTIQSNIVSASTLVPSSITLHNQQNTITSVQSTEVMMTKLNSLT
PIMIPAPLRNLTPLAHNNNSNLANQSLITSGRPLSNPVCGTIMSASNSNL
PSDNSSSKLINVTVPIPNNKPITSPINVVPRSPITPNPGLNLSKMPNSVD
MISNYILLQRQVNQTKSKLPNLCQQSTSNDNNNNGSGGGGGGSQNVPTGL
TASISNTGHSIILSQLTHANSVLSPINTAYLTASVNRTTNSAGNLLQSLP
TTNCLSAGIPSNSVVAAAAAAAAATQSVILRPMNIPFPKFDEKDDWLKQN
KQTDLSYPVRWTGKLCLKNDEVFVQMHMIAGNEDLIKNSMNLISNGQSLS
QPLRIVQRMRLEPNQLEGLQRRLTRPLEFCTCLTLAGGDKLEELTQTSSI
LNDNFIKYLQEKSAAGIINICIPESQQNAYVIHIFPPCEFSDNQLKNCCS
KLYDKLKEESVPYLLVVITTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR034173SHARP_RRM2
IPR035979RBD_domain_sf
IPR007527Znf_SWIM
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR012921SPOC_C
IPR016194SPOC-like_C_dom_sf
IPR010912SPOC_met
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 813..840
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 711..733
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1403..1422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 845..862
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1558..1576
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 569..594
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1737..1756
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 743..787
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 655..688
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 520..541
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1447..1652
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2107..2130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1724..1756
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 653..688
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2108..2130
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..787
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1448..1496
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1532..1557
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2149..2180
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1686..1701
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1686..1706
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1577..1599
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1622..1636
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1328..1349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..148
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 842..886
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 561..612
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 101..162
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1388..1422
NoneNo IPR availablePANTHERPTHR23189:SF48MSX2-INTERACTING PROTEINcoord: 2607..2771
coord: 100..872
NoneNo IPR availablePANTHERPTHR23189RNA RECOGNITION MOTIF-CONTAININGcoord: 2607..2771
coord: 100..872
NoneNo IPR availableCDDcd00590RRM_SFcoord: 7..65
e-value: 3.9784E-7
score: 47.6849
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 186..259
e-value: 8.7E-5
score: 31.9
coord: 288..361
e-value: 3.1E-13
score: 60.0
coord: 370..441
e-value: 2.6E-6
score: 37.0
coord: 6..73
e-value: 0.0037
score: 26.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 205..257
e-value: 2.1E-5
score: 24.3
coord: 371..423
e-value: 2.9E-5
score: 23.8
coord: 289..358
e-value: 2.6E-11
score: 43.2
coord: 7..62
e-value: 8.5E-8
score: 31.9
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 185..263
score: 9.934
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 287..365
score: 15.63
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 369..445
score: 11.008
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 5..77
score: 10.309
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..123
e-value: 1.6E-9
score: 39.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 186..260
e-value: 1.1E-15
score: 59.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 365..461
e-value: 4.3E-13
score: 51.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 286..364
e-value: 1.4E-14
score: 56.1
IPR012921Spen paralogue and orthologue SPOC, C-terminalPFAMPF07744SPOCcoord: 2602..2770
e-value: 1.9E-31
score: 109.0
IPR016194SPOC-like, C-terminal domain superfamilyGENE3DG3DSA:2.40.290.10coord: 2599..2771
e-value: 2.9E-54
score: 185.1
IPR016194SPOC-like, C-terminal domain superfamilySUPERFAMILYSSF100939SPOC domain-likecoord: 2601..2769
IPR010912Spen paralogue/orthologue C-terminal, metazoaPROSITEPS50917SPOCcoord: 2600..2770
score: 37.954
IPR034173SHARP, RNA recognition motif 2CDDcd12349RRM2_SHARPcoord: 186..258
e-value: 6.49193E-33
score: 120.876
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 5..259
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 286..443