TRAF-6

Overview
NameTRAF-6
Smed IDSMED30027408
Length (bp)1289
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TRAF-6 (SMED30027408) t-SNE clustered cells

Violin plots show distribution of expression levels for TRAF-6 (SMED30027408) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TRAF-6 (SMED30027408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TRAF-6 (SMED30027408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027408SMESG000067201.1 SmedASXL_013099SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30027408SMESG000067201.1 dd_Smed_v4_16183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027408SMESG000067201.1 dd_Smed_v4_16183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30027408SMESG000067201.1 dd_Smed_v4_16183_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TRAF-6 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.853e-11
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 3
Query:   45 SESIWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHI 383
            +E I  LL  YNF ++     +L C +C+ LL N  +S C C +C  CI+ Y +     CPG    CK + L + +N+  D R + KI ++ V CP  TCK    L D+E H+
Sbjct:    3 AEKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHL 115          
BLAST of TRAF-6 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.989e-11
Identity = 41/120 (34.17%), Postives = 67/120 (55.83%), Query Frame = 3
Query:   30 MIHSRSESIWNLLKKYNF-RIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHIN 386
            MI S+ +++  LL KYN  R+D   N+DL+C++C KL+++  +S C C YC  CI  Y + +   CPG    CK   L+L  ++  + R   +I  ++V CP   C Y   L  ++ H++
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLD 120          
BLAST of TRAF-6 vs. Ensembl Medaka
Match: rnf151 (ring finger protein 151 [Source:NCBI gene;Acc:101163980])

HSP 1 Score: 48.1358 bits (113), Expect = 6.050e-6
Identity = 32/119 (26.89%), Postives = 51/119 (42.86%), Query Frame = 3
Query:  108 DLICVICQKLLKNPYKSLCPCTYCLDCILNY--SANDVKCCP------------------GKM-LNCKLKILDLMNNLKFDQRKHNKI--LELLVDCPFNTCKYQIPLKDMETHINHHE 395
            DLIC ICQ +L+ P ++ C   +C  CIL +        CC                   G+M + C  +I          ++  + +  L  L+ CP+  C+ Q+  +D+ETH  H E
Sbjct:    9 DLICTICQGVLRCPVRAACHHIFCKKCILQWLKRQQTCPCCRNPVNPSLIFVMFKLSKSIGRMKIKCTNEIRGCAETFSLSEQYCHSLSCLYELIPCPYQGCRAQLLRRDLETHARHCE 127          
BLAST of TRAF-6 vs. Planmine SMEST
Match: SMESG000067201.1 (SMESG000067201.1)

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 365/370 (98.65%), Postives = 367/370 (99.19%), Query Frame = 3
Query:   30 MIHSRSESIWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLWFKDYLNFQNKYNSFHKQHTSELQNISEGIALLINESRNGSKKLASTHGEISTENEQFNQLENQFSLALENQNSKIEFLKNKNSTLIIENKNLEEQLKIVVTKIKILECEFKQLEDSTDPLLGIINELKINFDNQFQDFHRDLNQMLNNSLEIERYQQYPSSHGDLNQSNEQNSGKISTNELDIFTSKENSSQNKEKETNEARKIWIKKRKGPLLKNAENFEIKRKKN 1139
            M  SRSESIWNLLKKYNFRIDLEAN+DLICVICQKLLKNPYKSLCPCTYCLDCILNYSA DVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLWFKDYLNFQNKYNSFHKQHTSELQNISEGIALLINESRNGSKKLASTHGEISTENEQFNQLENQFSLALENQNSKIEFLKNKNSTLIIENKNLE+QLKIVVTKIKILECEFKQLEDSTDPLLGIINELKINFDNQFQDFHRDLNQMLNNSLEIERYQQYPSSHGDLNQSNEQNSGKISTNELDIFTSKENSSQNKEKETNEARKIWIKKRKGPLLKNAENFEIKRKKN
Sbjct:    1 MTDSRSESIWNLLKKYNFRIDLEANNDLICVICQKLLKNPYKSLCPCTYCLDCILNYSATDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLWFKDYLNFQNKYNSFHKQHTSELQNISEGIALLINESRNGSKKLASTHGEISTENEQFNQLENQFSLALENQNSKIEFLKNKNSTLIIENKNLEKQLKIVVTKIKILECEFKQLEDSTDPLLGIINELKINFDNQFQDFHRDLNQMLNNSLEIERYQQYPSSHGDLNQSNEQNSGKISTNELDIFTSKENSSQNKEKETNEARKIWIKKRKGPLLKNAENFEIKRKKN 370          
BLAST of TRAF-6 vs. Planmine SMEST
Match: SMESG000014397.1 (SMESG000014397.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.464e-26
Identity = 49/133 (36.84%), Postives = 78/133 (58.65%), Query Frame = 3
Query:   54 IWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSK 452
            +W LL +Y F +D + N D+IC IC+ LLKN  +S+C C +C DCI NY + + K CPG+   CK  ++++  NL+ D   + K+  + V CP + C+++  LK M++HI+ H  ++       RE    L K
Sbjct:    9 MWTLLNEYKFEVDNDKNRDIICCICKSLLKNAQQSICGCEFCFDCIKNYLSTESKFCPGRSAGCKELMVNIERNLQVDHAANKKVANVTVRCPIDNCEFRTELKAMDSHIDSHNDVVDSQGKFLREPLEKLKK 141          
BLAST of TRAF-6 vs. Planmine SMEST
Match: SMESG000014397.1 (SMESG000014397.1)

HSP 1 Score: 112.464 bits (280), Expect = 1.646e-26
Identity = 65/201 (32.34%), Postives = 103/201 (51.24%), Query Frame = 3
Query:   54 IWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLW----------FKDYLN-------FQNKYNSFHKQHTSELQNISEGIALLINESRNGSK-KLASTHG 602
            +W LL +Y F +D + N D+IC IC+ LLKN  +S+C C +C DCI NY + + K CPG+   CK  ++++  NL+ D   + K+  + V CP + C+++  LK M++HI+ H  ++       RE    L K             KD LN        + + + F K   S+ Q +   I +LI+ +R   K   A +HG
Sbjct:    1 MWTLLNEYKFEVDNDKNRDIICCICKSLLKNAQQSICGCEFCFDCIKNYLSTESKFCPGRSAGCKELMVNIERNLQVDHAANKKVANVTVRCPIDNCEFRTELKAMDSHIDSHNDVVDSQGKFLREPLEKLKKEMNGLKEGLDQCRKDCLNKEVVIMKIREEIDRFRK--ASDAQAVE--IGILIDMARRTEKVSSAGSHG 197          
BLAST of TRAF-6 vs. Planmine SMEST
Match: SMESG000067198.1 (SMESG000067198.1)

HSP 1 Score: 109.383 bits (272), Expect = 1.082e-25
Identity = 78/240 (32.50%), Postives = 125/240 (52.08%), Query Frame = 3
Query:   54 IWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLWFKDYLNFQNKYNSFHKQHTSELQNI--SEGIALLI-----NESRNG-SKKLASTHGEISTENEQFNQLENQFSLALENQNSKIEFLKNKNSTLIIENKNLEEQLK 749
            IWNLL KYNF ID +  +DL+CVIC+ +L NPY+SLC C+YC  C   Y +   K CPGK   CK +I+D++ ++       +KI +++V CP   C +   +K +  HI  H+S    +++++ EL  +     + D +  +    S   + T EL +   SE I +       NE+RN  S KL          N + N ++ +    L+NQ  +I+ LK +     + N+ L E+L+
Sbjct:    7 IWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMN-----YFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQTLQAHENENRNCLSDKLIE-------RNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQ 234          
BLAST of TRAF-6 vs. Planmine SMEST
Match: SMESG000067198.1 (SMESG000067198.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.151e-25
Identity = 78/240 (32.50%), Postives = 125/240 (52.08%), Query Frame = 3
Query:   54 IWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYCLDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDCPFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLWFKDYLNFQNKYNSFHKQHTSELQNI--SEGIALLI-----NESRNG-SKKLASTHGEISTENEQFNQLENQFSLALENQNSKIEFLKNKNSTLIIENKNLEEQLK 749
            IWNLL KYNF ID +  +DL+CVIC+ +L NPY+SLC C+YC  C   Y +   K CPGK   CK +I+D++ ++       +KI +++V CP   C +   +K +  HI  H+S    +++++ EL  +     + D +  +    S   + T EL +   SE I +       NE+RN  S KL          N + N ++ +    L+NQ  +I+ LK +     + N+ L E+L+
Sbjct:    9 IWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMN-----YFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQTLQAHENENRNCLSDKLIE-------RNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQ 236          
The following BLAST results are available for this feature:
BLAST of TRAF-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
I1ZID82.853e-1136.28TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1012.989e-1134.17TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TRAF-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf1516.050e-626.89ring finger protein 151 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of TRAF-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067201.10.000e+098.65SMESG000067201.1[more]
SMESG000014397.11.464e-2636.84SMESG000014397.1[more]
SMESG000014397.11.646e-2632.34SMESG000014397.1[more]
SMESG000067198.11.082e-2532.50SMESG000067198.1[more]
SMESG000067198.11.151e-2532.50SMESG000067198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027408 ID=SMED30027408|Name=TRAF-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1289bp
ATCTATATAAATCTTATATGTGTCAATAAATGATACATTCCAGATCTGAA
TCCATTTGGAATTTATTAAAGAAATATAATTTTAGAATTGATTTAGAAGC
AAATAGTGACTTAATTTGTGTGATATGTCAAAAGTTATTAAAGAATCCTT
ACAAAAGTCTTTGTCCATGTACATATTGTCTGGACTGCATTTTAAATTAT
TCTGCTAATGATGTTAAATGCTGCCCTGGGAAAATGTTAAATTGTAAACT
TAAAATATTAGATCTAATGAATAACCTTAAATTTGACCAAAGAAAACATA
ACAAAATATTGGAGTTGTTAGTCGATTGTCCTTTCAATACATGCAAATAC
CAAATCCCATTAAAAGATATGGAAACGCATATTAATCATCATGAATCTAT
AATTGTGAAAGATATTAACCACACAAGAGAACTTGCATCTGATTTGTCTA
AATTATGGTTCAAGGATTATCTTAATTTTCAAAACAAATACAATTCATTT
CATAAGCAACACACTTCGGAATTACAGAACATTAGTGAAGGAATAGCACT
CTTAATTAACGAGTCTAGAAATGGTTCTAAAAAACTGGCATCAACGCATG
GAGAAATTTCAACTGAAAATGAACAATTCAATCAATTGGAAAATCAATTT
AGCTTGGCCTTAGAAAATCAAAATTCAAAAATTGAGTTTCTCAAGAATAA
AAATTCTACATTAATTATCGAAAATAAAAATCTAGAAGAGCAACTTAAAA
TCGTAGTAACAAAAATAAAGATTTTAGAGTGTGAATTTAAACAGCTAGAG
GACTCGACTGACCCTTTATTAGGAATCATTAATGAGCTAAAGATAAATTT
TGATAATCAGTTCCAGGACTTTCACCGAGATTTAAATCAGATGCTTAATA
ATAGCCTTGAAATTGAAAGATATCAACAATATCCAAGTTCACATGGGGAT
CTAAATCAGAGTAATGAACAAAATTCTGGGAAAATATCAACAAATGAACT
CGATATTTTTACTAGTAAAGAAAATAGTTCTCAAAATAAAGAAAAGGAAA
CTAATGAAGCTAGAAAAATTTGGATTAAGAAAAGAAAAGGTCCCTTGTTG
AAAAATGCGGAAAATTTTGAAATTAAAAGAAAAAAAAATTAATATTATAA
TTTTTAGTTGATTGACTTTGTGTGTTGTGCATTTATTGATTGTAAATATT
CATAAGAAACCAAAGCTGTGCTTATTATTATATTGTGCTTATTTCTGGAG
ATCAATATTGATTGATCCAGTAAACTCCGTAACTGTTGG
back to top

protein sequence of SMED30027408-orf-1

>SMED30027408-orf-1 ID=SMED30027408-orf-1|Name=SMED30027408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=371bp
MIHSRSESIWNLLKKYNFRIDLEANSDLICVICQKLLKNPYKSLCPCTYC
LDCILNYSANDVKCCPGKMLNCKLKILDLMNNLKFDQRKHNKILELLVDC
PFNTCKYQIPLKDMETHINHHESIIVKDINHTRELASDLSKLWFKDYLNF
QNKYNSFHKQHTSELQNISEGIALLINESRNGSKKLASTHGEISTENEQF
NQLENQFSLALENQNSKIEFLKNKNSTLIIENKNLEEQLKIVVTKIKILE
CEFKQLEDSTDPLLGIINELKINFDNQFQDFHRDLNQMLNNSLEIERYQQ
YPSSHGDLNQSNEQNSGKISTNELDIFTSKENSSQNKEKETNEARKIWIK
KRKGPLLKNAENFEIKRKKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 211..252
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 332..346
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 327..346
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 4.75072E-5
score: 38.2173
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 16..67
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 14..130
e-value: 4.5E-10
score: 41.5