SERPINE1 mRNA binding protein 1a

Overview
NameSERPINE1 mRNA binding protein 1a
Smed IDSMED30027407
Length (bp)1351
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SERPINE1 mRNA binding protein 1a (SMED30027407) t-SNE clustered cells

Violin plots show distribution of expression levels for SERPINE1 mRNA binding protein 1a (SMED30027407) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SERPINE1 mRNA binding protein 1a (SMED30027407) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SERPINE1 mRNA binding protein 1a (SMED30027407) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027407

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027407SMESG000008791.1 SmedASXL_006617SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027407SMESG000008791.1 dd_Smed_v4_697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027407SMESG000008791.1 Contig39686newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027407SMESG000008791.1 Contig39686uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
X1 cellSMED30027407SMESG000008791.1 isotig10428be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30027407SMESG000008791.1 dd_Smed_v6_697_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30027407SMESG000008791.1 H.33.12dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 1 cellSMED30027407SMESG000008791.1 H.33.12dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Human
Match: SERBP1 (SERPINE1 mRNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17860])

HSP 1 Score: 66.6254 bits (161), Expect = 2.374e-11
Identity = 42/85 (49.41%), Postives = 54/85 (63.53%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKD-IVDLEIEGLDQIKDEGVLEKPV----DGEVLPEADKKEPEKTMTISEWKAL 715
            REFDRHSGSD++G+K  +KR GSGSHNWG VKD + DL+   + +   EG    PV    + E   E  K+E  K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 275          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Human
Match: SERBP1 (SERPINE1 mRNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17860])

HSP 1 Score: 60.8474 bits (146), Expect = 1.843e-9
Identity = 43/103 (41.75%), Postives = 53/103 (51.46%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKD-----------IVDLEIEGLDQIKDEGVLEKPVDG-EVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++G+K  +KR GSGSHNWG VKD            +      LDQ     V E+  +G E  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQ---SNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 290          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Human
Match: SERBP1 (SERPINE1 mRNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17860])

HSP 1 Score: 60.4622 bits (145), Expect = 2.672e-9
Identity = 42/91 (46.15%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKD-IVDLEIEGLDQIKDEGVLEKPV----DGEVLPEADKKEPEKTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD + DL+   + +   EG    PV    + E   E  K+E  K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 281          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Human
Match: SERBP1 (SERPINE1 mRNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17860])

HSP 1 Score: 54.6842 bits (130), Expect = 2.017e-7
Identity = 43/109 (39.45%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKD-----------IVDLEIEGLDQIKDEGVLEKPVDG-EVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD            +      LDQ     V E+  +G E  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQ---SNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 296          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Celegans
Match: vig-1 (VIG (Drosophila Vasa Intronic Gene) ortholog [Source:UniProtKB/TrEMBL;Acc:H2KYR1])

HSP 1 Score: 48.521 bits (114), Expect = 6.692e-6
Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 2
Query:  479 EFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGL 601
            +FDR SGSD+TG+++ +K+DG G  NWG+ KD +  E E +
Sbjct:  179 QFDRQSGSDRTGVRSFDKKDGHGKGNWGDQKDELAGETENI 219          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Celegans
Match: vig-1 (VIG (Drosophila Vasa Intronic Gene) ortholog [Source:UniProtKB/TrEMBL;Acc:H2KYR1])

HSP 1 Score: 48.521 bits (114), Expect = 6.692e-6
Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 2
Query:  479 EFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGL 601
            +FDR SGSD+TG+++ +K+DG G  NWG+ KD +  E E +
Sbjct:  179 QFDRQSGSDRTGVRSFDKKDGHGKGNWGDQKDELAGETENI 219          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Celegans
Match: vig-1 (VIG (Drosophila Vasa Intronic Gene) ortholog [Source:UniProtKB/TrEMBL;Acc:H2KYR1])

HSP 1 Score: 48.521 bits (114), Expect = 6.692e-6
Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 2
Query:  479 EFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGL 601
            +FDR SGSD+TG+++ +K+DG G  NWG+ KD +  E E +
Sbjct:  179 QFDRQSGSDRTGVRSFDKKDGHGKGNWGDQKDELAGETENI 219          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Celegans
Match: vig-1 (VIG (Drosophila Vasa Intronic Gene) ortholog [Source:UniProtKB/TrEMBL;Acc:H2KYR1])

HSP 1 Score: 48.521 bits (114), Expect = 6.692e-6
Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 2
Query:  479 EFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGL 601
            +FDR SGSD+TG+++ +K+DG G  NWG+ KD +  E E +
Sbjct:  179 QFDRQSGSDRTGVRSFDKKDGHGKGNWGDQKDELAGETENI 219          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Fly
Match: vig2 (gene:FBgn0046214 transcript:FBtr0113354)

HSP 1 Score: 70.8626 bits (172), Expect = 5.565e-13
Identity = 48/108 (44.44%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  404 NNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQI---KDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKAL 715
            NN+DN RG     P      K   REFDR SGSD+TG+K+ +KR+G G+HNWG+ K DI DL+  G       K++   E+  D  V  E D+    K MT+ EWKAL
Sbjct:  127 NNRDN-RG----PPRVRTGEKFGKREFDRQSGSDRTGVKSIDKREGGGAHNWGSPKQDIEDLKTTGETSPQAEKEDSANEQSADPAVAAEEDE---SKQMTLDEWKAL 226          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Fly
Match: vig2 (gene:FBgn0046214 transcript:FBtr0084776)

HSP 1 Score: 70.8626 bits (172), Expect = 5.565e-13
Identity = 48/108 (44.44%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  404 NNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQI---KDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKAL 715
            NN+DN RG     P      K   REFDR SGSD+TG+K+ +KR+G G+HNWG+ K DI DL+  G       K++   E+  D  V  E D+    K MT+ EWKAL
Sbjct:  127 NNRDN-RG----PPRVRTGEKFGKREFDRQSGSDRTGVKSIDKREGGGAHNWGSPKQDIEDLKTTGETSPQAEKEDSANEQSADPAVAAEEDE---SKQMTLDEWKAL 226          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Fly
Match: vig2 (gene:FBgn0046214 transcript:FBtr0084777)

HSP 1 Score: 70.8626 bits (172), Expect = 5.565e-13
Identity = 48/108 (44.44%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  404 NNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQI---KDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKAL 715
            NN+DN RG     P      K   REFDR SGSD+TG+K+ +KR+G G+HNWG+ K DI DL+  G       K++   E+  D  V  E D+    K MT+ EWKAL
Sbjct:  127 NNRDN-RG----PPRVRTGEKFGKREFDRQSGSDRTGVKSIDKREGGGAHNWGSPKQDIEDLKTTGETSPQAEKEDSANEQSADPAVAAEEDE---SKQMTLDEWKAL 226          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Fly
Match: vig2 (gene:FBgn0046214 transcript:FBtr0084775)

HSP 1 Score: 70.4774 bits (171), Expect = 7.852e-13
Identity = 48/108 (44.44%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  404 NNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQI---KDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKAL 715
            NN+DN RG     P      K   REFDR SGSD+TG+K+ +KR+G G+HNWG+ K DI DL+  G       K++   E+  D  V  E D+    K MT+ EWKAL
Sbjct:  158 NNRDN-RG----PPRVRTGEKFGKREFDRQSGSDRTGVKSIDKREGGGAHNWGSPKQDIEDLKTTGETSPQAEKEDSANEQSADPAVAAEEDE---SKQMTLDEWKAL 257          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Fly
Match: FDY (gene:FBgn0265047 transcript:FBtr0473381)

HSP 1 Score: 69.3218 bits (168), Expect = 1.610e-12
Identity = 42/88 (47.73%), Postives = 53/88 (60.23%), Query Frame = 2
Query:  464 KVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQIKDE---GVLEKPVDGEVLPEADKKEPEKTMTISEWKAL 715
            K   REFDR SGSDKTG+K+ +KR+G G+HNWG+ K DI DL+  G    + E      E+  D  V  E D+    K MT+ EWKAL
Sbjct:  142 KFGKREFDRQSGSDKTGVKSIDKREGVGAHNWGSPKQDIEDLKTTGETSPQAEKKDSANEQSADPAVAAEEDE---SKQMTLDEWKAL 226          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Zebrafish
Match: serbp1a (SERPINE1 mRNA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7389])

HSP 1 Score: 72.7886 bits (177), Expect = 1.485e-13
Identity = 53/124 (42.74%), Postives = 66/124 (53.23%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKALS-KENTIISAKVPPRPANNGEDVFSGMNVYKKR 811
            REFDRHSGSD++ +KA EKR GSGSHNWG VKD    E+  LDQ     V E   +GE  P AD +  E           K M++ EWKA   KE   +   +  R AN G D   G  ++K +
Sbjct:  193 REFDRHSGSDRSSLKAEEKRGGSGSHNWGTVKD----ELSELDQ---SNVTEDTPEGEEHPPADSENKENEVEEAKEEGPKEMSLDEWKAQQDKERAKVEFNI--RKANEGADWKKGYVLHKSK 307          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Zebrafish
Match: serbp1a (SERPINE1 mRNA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7389])

HSP 1 Score: 68.5514 bits (166), Expect = 3.525e-12
Identity = 53/124 (42.74%), Postives = 66/124 (53.23%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKALS-KENTIISAKVPPRPANNGEDVFSGMNVYKKR 811
            REFDRHSGSD++ +KA EKR GSGSHNWG VKD    E+  LDQ     V E   +GE  P AD +  E           K M++ EWKA   KE   +   +  R AN G D   G  ++K +
Sbjct:  193 REFDRHSGSDRS-LKAEEKRGGSGSHNWGTVKD----ELSELDQ---SNVTEDTPEGEEHPPADSENKENEVEEAKEEGPKEMSLDEWKAQQDKERAKVEFNI--RKANEGADWKKGYVLHKSK 306          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Zebrafish
Match: zgc:103482 (zgc:103482 [Source:ZFIN;Acc:ZDB-GENE-041010-115])

HSP 1 Score: 60.077 bits (144), Expect = 1.786e-9
Identity = 35/90 (38.89%), Postives = 56/90 (62.22%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKD---IVDLEIEGLDQIKDEGVLEK-PVDGEVLPEADKK--EPEKTMTISEWKALSKEN 727
            REF+RHSGSD++ +++ EKR GSGS NWG+V+D   ++++     +  ++E   E    DGE  P   ++  E    MT+ EWKAL +++
Sbjct:  154 REFERHSGSDRSSVRSEEKRSGSGSRNWGSVRDHMSVIEVASPSEEVTENEETQEAVETDGENRPSETEEVIEVAMEMTLDEWKALQEQS 243          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Zebrafish
Match: serbp1b (SERPINE1 mRNA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-031118-196])

HSP 1 Score: 58.9214 bits (141), Expect = 5.624e-9
Identity = 37/84 (44.05%), Postives = 47/84 (55.95%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKK---EPEKTMTISEWKAL 715
            R+FDRHSG+DK   K  EKR GSGSHNWG VK +  +L+     +   EG    P D E      ++   E  K MT+ EWKA+
Sbjct:  183 RDFDRHSGNDKARQKGEEKRSGSGSHNWGGVKEETSELDQSAAPEPVPEGEEHAPADSENKENEVEEVKDEGPKEMTLDEWKAM 266          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Xenopus
Match: serbp1 (SERPINE1 mRNA binding protein 1 [Source:NCBI gene;Acc:407908])

HSP 1 Score: 56.9954 bits (136), Expect = 2.838e-8
Identity = 58/160 (36.25%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  476 REFDRHSGSDK-----TGIKATEKRDGSGSHNWGNVKD-IVDLEIEGLDQIKDEGVLEKPVDGE---VLPEADKKEPEKTMTISEWKALS-KENTIISAKVPPRPANNGEDVFSGMNVYKK-RISHITDSDTEVVVPEDEIDSKGRR-------QIKVNV 901
            REFDRHSGSD+     +G K  +KR GSGSHNWG VKD + +L+   + +   E      VD E      E  K+E  K MT+ EWKA+  KE + +   +  R  N G D       +KK  + H   SD EV    D +D   R+       Q+++N 
Sbjct:  173 REFDRHSGSDRASSHFSGPKHEDKRGGSGSHNWGTVKDELSELDQSAVTEETPETEEHPAVDSENKENEAEEVKEEGPKEMTLDEWKAMQDKERSKVEFNI--RKPNEGAD-----GQWKKGFVLHKAKSD-EVHAESDALDHHFRKPANDITSQLEINF 324          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Xenopus
Match: serbp1 (SERPINE1 mRNA binding protein 1 [Source:NCBI gene;Acc:407908])

HSP 1 Score: 56.9954 bits (136), Expect = 2.883e-8
Identity = 56/147 (38.10%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  476 REFDRHSGSDK-----TGIKATEKRDGSGSHNWGNVKD-IVDLEIEGLDQIKDEGVLEKPVDGE---VLPEADKKEPEKTMTISEWKALS-KENTIISAKVPPRPANNGEDVFSGMNVYKKR-ISHITDSDTEVVVPEDEIDSKGRR 883
            REFDRHSGSD+     +G K  +KR GSGSHNWG VKD + +L+   + +   E      VD E      E  K+E  K MT+ EWKA+  KE + +   +  R  N G D       +KK  + H   SD EV    D +D   R+
Sbjct:  205 REFDRHSGSDRASSHFSGPKHEDKRGGSGSHNWGTVKDELSELDQSAVTEETPETEEHPAVDSENKENEAEEVKEEGPKEMTLDEWKAMQDKERSKVEFNI--RKPNEGAD-----GQWKKGFVLHKAKSD-EVHAESDALDHHFRK 343          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Xenopus
Match: rab5if (RAB5 interacting factor [Source:Xenbase;Acc:XB-GENE-999817])

HSP 1 Score: 51.9878 bits (123), Expect = 1.054e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEV---------------LPEADKKEPEKTMTISEWKALSKEN 727
            REFDRHSGSD+  I+  +KR G G  NWG++K+    EIE +           PV+ +V               +PE   +   + M++ EWK+L  +N
Sbjct:  189 REFDRHSGSDRARIRPEDKRGGGGPRNWGSIKEAFS-EIEAV-----------PVEEQVEPTETTEATEEEHGKVPEEINEGFSQEMSLDEWKSLQDQN 275          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Xenopus
Match: rab5if (RAB5 interacting factor [Source:Xenbase;Acc:XB-GENE-999817])

HSP 1 Score: 51.9878 bits (123), Expect = 1.077e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEV---------------LPEADKKEPEKTMTISEWKALSKEN 727
            REFDRHSGSD+  I+  +KR G G  NWG++K+    EIE +           PV+ +V               +PE   +   + M++ EWK+L  +N
Sbjct:  184 REFDRHSGSDRARIRPEDKRGGGGPRNWGSIKEAFS-EIEAV-----------PVEEQVEPTETTEATEEEHGKVPEEINEGFSQEMSLDEWKSLQDQN 270          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Mouse
Match: Serbp1 (serpine1 mRNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1914120])

HSP 1 Score: 70.4774 bits (171), Expect = 1.063e-12
Identity = 44/91 (48.35%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++G+K  +KR GSGSHNWG VKD    E+  LDQ     V E+  +GE  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKD----ELTDLDQ---SNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 274          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Mouse
Match: Serbp1 (serpine1 mRNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1914120])

HSP 1 Score: 65.4698 bits (158), Expect = 4.185e-11
Identity = 43/102 (42.16%), Postives = 53/102 (51.96%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKD-----------IVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++G+K  +KR GSGSHNWG VKD            +      LDQ     V E+  +GE  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNCSDLDQ---SNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 289          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Mouse
Match: Serbp1 (serpine1 mRNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1914120])

HSP 1 Score: 61.2326 bits (147), Expect = 1.334e-10
Identity = 26/39 (66.67%), Postives = 32/39 (82.05%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEI 592
            REFDRHSGSD++G+K  +KR GSGSHNWG VKD + L +
Sbjct:  138 REFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTLRV 176          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Mouse
Match: Serbp1 (serpine1 mRNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1914120])

HSP 1 Score: 63.929 bits (154), Expect = 1.340e-10
Identity = 44/97 (45.36%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD    E+  LDQ     V E+  +GE  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKD----ELTDLDQ---SNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 280          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Mouse
Match: Serbp1 (serpine1 mRNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1914120])

HSP 1 Score: 59.3066 bits (142), Expect = 4.780e-9
Identity = 43/108 (39.81%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKD-----------IVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD            +      LDQ     V E+  +GE  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNCSDLDQ---SNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 295          
BLAST of SERPINE1 mRNA binding protein 1a vs. UniProt/SwissProt
Match: sp|Q9CY58|PAIRB_MOUSE (Plasminogen activator inhibitor 1 RNA-binding protein OS=Mus musculus OX=10090 GN=Serbp1 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 3.343e-8
Identity = 43/108 (39.81%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKD-----------IVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD            +      LDQ     V E+  +GE  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNCSDLDQ---SNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 295          
BLAST of SERPINE1 mRNA binding protein 1a vs. UniProt/SwissProt
Match: sp|Q6AXS5|PAIRB_RAT (Plasminogen activator inhibitor 1 RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Serbp1 PE=1 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 5.592e-8
Identity = 41/105 (39.05%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKD-------IVDLEIE-GLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD        +  +I      ++   V E+  +GE  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNCSDLEQSNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 295          
BLAST of SERPINE1 mRNA binding protein 1a vs. UniProt/SwissProt
Match: sp|Q8NC51|PAIRB_HUMAN (Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 9.684e-7
Identity = 43/109 (39.45%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  476 REFDRHSGSDKT------GIKATEKRDGSGSHNWGNVKD-----------IVDLEIEGLDQIKDEGVLEKPVDG-EVLPEADKKEPE-----------KTMTISEWKAL 715
            REFDRHSGSD++      G+K  +KR GSGSHNWG VKD            +      LDQ     V E+  +G E  P AD +  E           K MT+ EWKA+
Sbjct:  191 REFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQ---SNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAI 296          
BLAST of SERPINE1 mRNA binding protein 1a vs. TrEMBL
Match: A0A3Q2YUP5 (SERPINE1 mRNA binding protein 1a OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.053e-12
Identity = 68/188 (36.17%), Postives = 91/188 (48.40%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKALS-KENTIISAKVPPRPANNGEDVFSGMNVYKKRISHITDS--DTEVVVPEDEIDSKGRR-------QIKVNVEFSGRNRRGRGAYTNSRFNKEEKKS 976
            REFDRHSGSD++G+K  EKR GSGSHNWG VKD    E+  LDQ       E+  +GE  P AD +  E           K MT+ EWKA+  K+   +   +  R AN G D   G  ++K +     D   D E    + E +   R+       Q+++N    GR  RGR      R  +EE +S
Sbjct:  189 REFDRHSGSDRSGLKGEEKRGGSGSHNWGTVKD----ELNELDQSN---ATEENPEGEEHPPADSENKENEVEEVKEEGPKEMTLDEWKAMQDKDRAKVEFNI--RKANEGADWNKGFVLHKSKAEGKKDDLIDPEAFESKMEEEPHFRKPANDITSQLEINFGDLGRTGRGRSGTPRGRPAEEEPRS 367          
BLAST of SERPINE1 mRNA binding protein 1a vs. TrEMBL
Match: A0A3Q3MWA1 (SERPINE1 mRNA binding protein 1a OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.719e-12
Identity = 58/139 (41.73%), Postives = 73/139 (52.52%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEAD-----------KKEPEKTMTISEWKALS-KENTIISAKVPPRPANNGEDVFSGMNVYKKRISHITDSDTEVVVPE 856
            REFDRHSGSD++ +K  EKR GSGSHNWG VKD    E+  LDQ     V E+  +GE  P AD           K E  K MT+ EWKA+  KE   +   +  R AN G D   G  ++K   S   D   +++ PE
Sbjct:  172 REFDRHSGSDRSSLKGEEKRGGSGSHNWGTVKD----ELNELDQSN---VTEENPEGEEHPPADSENKENEVEDMKDEGPKEMTLDEWKAMQDKERAKVEFNI--RKANEGADWNKGFVLHK---SKADDKKGDLIEPE 298          
BLAST of SERPINE1 mRNA binding protein 1a vs. TrEMBL
Match: A0A0R3X5K9 (HABP4_PAI-RBP1 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8746 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.060e-12
Identity = 76/267 (28.46%), Postives = 132/267 (49.44%), Query Frame = 2
Query:   53 ISMSVPNVVYNVNVKSKFELFLNDDLCEAEPEELVRKIIEDXXXXXXXXXXXXXXXXXETKKAVAKSISEPEQPKSEEKRNGDKAPRFQ--NIDKRVPQKPRTANERVPPAKSETGFDENNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGL---DQIKDEGVLE-----KPVDGEVLPEADKKEPEKTMTISEW---KALSKENTIISAKVPPRPANNGEDVFSGMN-VYKKR 811
            ++ +V +  Y+V VKS+F+LF   D    +P+ L+ ++           +  K++++   K+   K   EP +P  ++     +APR +    D++V         R PP  +        ++ +   +  +P S  V       FDRHSGSDKTG+KA  K+DG G+ NWG + D ++ ++  +     I++E   E     +P   E   E +K+ P K MT+ E+   +  S+ N  +  K   RP N+G++VFSGM+ V+K +
Sbjct:    1 MTSAVHDYTYSVQVKSRFDLFAKADYNSEDPDHLLSRL-----------RNQKRERKSSAKEVFGKGAPEPVEPTQKDS----QAPRNERRGADRKV--------SRDPPGNAGGRSAPRGRNVVMRNRVSKPGSQRV-------FDRHSGSDKTGVKAVMKKDGHGTGNWGTMDDELEAQMAEVVLEPTIEEEAPAEEVKPAEPTSAEQDQEPEKERP-KMMTLKEFHQQRKASRVNVQLVTKGVRRP-NDGKNVFSGMSEVHKSK 235          
BLAST of SERPINE1 mRNA binding protein 1a vs. TrEMBL
Match: A0A087VY13 (mRNA binding protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000091800 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.807e-12
Identity = 76/261 (29.12%), Postives = 122/261 (46.74%), Query Frame = 2
Query:   53 ISMSVPNVVYNVNVKSKFELFLNDDLCEAEPEELVRKIIEDXXXXXXXXXXXXXXXXXETKKAVAKSISEPEQPKSEEKRNGDKAPRFQNIDKRVPQKPRTANERVPPAKSETGFDENNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLE-------KPVDGEVLPEADKKEP----EKTMTISEWKA---LSKENTIISAKVPPRPANNGEDVFSGM 793
            ++ +V +  Y+V VKS+F+LF  DD    +P+ L+ ++           K  +K    E  +  ++ + EP Q +++  RN  +       D++   +  + N R   A    G    NK    GG+              R FDRHSGSDKTG+KA  K+DG G+ NWG ++D  +LE +  + + +    E       KP   E  P    +EP     KT+T+ E++     SK    ++ K   RP N+G++VFS M
Sbjct:    1 MTSAVHDYTYSVQVKSRFDLFAKDDYNGEDPDVLLTRL--------RTQKRERKSSAKEASEKASQDVFEPIQKEAQATRNDRRG-----ADQKASLRDASGNVRGRAAPRGRGVSARNKAPKFGGQ--------------RVFDRHSGSDKTGVKAVMKKDGHGTGNWGTLED--ELEAQMAEVVPEPTTEEEAPAEEVKPA--ESTPTEQIQEPVDERPKTLTLKEYREQLRASKAKVQLTTKGERRP-NDGKNVFSDM 229          
BLAST of SERPINE1 mRNA binding protein 1a vs. TrEMBL
Match: A0A3P8VB35 (SERPINE1 mRNA binding protein 1a OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.259e-12
Identity = 56/139 (40.29%), Postives = 73/139 (52.52%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEAD-----------KKEPEKTMTISEWKAL-SKENTIISAKVPPRPANNGEDVFSGMNVYKKRISHITDSDTEVVVPE 856
            REFDRHSGSD++ +K  +KR GSGSHNWG VKD    E+  LDQ     + E+  +GE  P AD           K E  K MT+ EWKA+  KE   +   +  R AN G D   G  ++K +     D   E++ PE
Sbjct:  185 REFDRHSGSDRSSLKGEDKRGGSGSHNWGTVKD----ELNELDQSN---LTEENPEGEEHPAADSENKENEAEEVKDEAPKEMTLDEWKAMQGKERAKVEFNI--RKANEGADWNKGFVLHKSKAEAKKD---EIIDPE 311          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Cavefish
Match: serbp1a (plasminogen activator inhibitor 1 RNA-binding protein-like [Source:NCBI gene;Acc:103035173])

HSP 1 Score: 69.3218 bits (168), Expect = 2.264e-12
Identity = 52/124 (41.94%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKK-----------EPEKTMTISEWKALSKENTIISAKVPPRPANNGEDVFSGMNVYKKRI 814
            REFDRHSGSD++ +KA EKR GSGSHNWG VKD    E+  LDQ     V E   +GE  P AD +           E  K MT+ EWKA   +     +    R AN G D   G  ++K + 
Sbjct:  211 REFDRHSGSDRS-LKAEEKRGGSGSHNWGTVKD----ELSELDQSN---VTEDTHEGEEHPPADSENKENEAEEVKEEEPKEMTLDEWKAQQDKERAKVSDFKIRKANEGTDWKKGFLLHKSKA 326          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Cavefish
Match: SERBP1 (SERPINE1 mRNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17860])

HSP 1 Score: 61.2326 bits (147), Expect = 8.622e-10
Identity = 53/152 (34.87%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVK-DIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL-SKENTIISAKVPPRPANNGEDVF--SGMNVYK---KRISHITDSDTEVVVPEDEIDSKG 877
            RE++RHSGSDK+G K+ +KR G+GSHNWG  K +  + E+E           E P +GE    AD +  E           K MT+ EWKA+ +KE   +   +  R  N GED     G  ++K   K  +  +    E   PE E   KG
Sbjct:  233 REYERHSGSDKSGQKSDDKRGGAGSHNWGTTKEEASNTEVE------QTAAPETPAEGEEHAPADSENKENEVEEVKEEGPKEMTLDEWKAMQNKERAKVEFNI--RKPNEGEDAQWKKGYVLHKSKSKDAARPSGGLIEAAEPEPETLQKG 376          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Cavefish
Match: ENSAMXT00000038790.1 (hyaluronan binding protein 4 [Source:NCBI gene;Acc:103037257])

HSP 1 Score: 50.447 bits (119), Expect = 2.077e-6
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVD 583
            REF+RHSGSD+  ++  EKR GSG  NWG+++D V+
Sbjct:  184 REFERHSGSDRANVRPEEKRGGSGPRNWGSMRDHVN 219          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Cavefish
Match: ENSAMXT00000000304.2 (hyaluronan binding protein 4 [Source:NCBI gene;Acc:103037257])

HSP 1 Score: 50.0618 bits (118), Expect = 3.309e-6
Identity = 20/36 (55.56%), Postives = 28/36 (77.78%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVD 583
            REF+RHSGSD+  ++  EKR GSG  NWG+++D V+
Sbjct:  254 REFERHSGSDRANVRPEEKRGGSGPRNWGSMRDHVN 289          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Sea Lamprey
Match: serbp1b (SERPINE1 mRNA binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-031118-196])

HSP 1 Score: 55.4546 bits (132), Expect = 1.268e-8
Identity = 26/35 (74.29%), Postives = 29/35 (82.86%), Query Frame = 2
Query:  476 REFDRHSGSDKT--GIKATEKRDGSGSHNWGNVKD 574
            REF+RHSGSDKT  G+K  +KR GSGSHNWGN KD
Sbjct:  213 REFERHSGSDKTPSGLKPEDKRGGSGSHNWGNAKD 247          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Medaka
Match: serbp1a (plasminogen activator inhibitor 1 RNA-binding protein [Source:NCBI gene;Acc:101158186])

HSP 1 Score: 71.633 bits (174), Expect = 3.793e-13
Identity = 54/125 (43.20%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  476 REFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPE-----------KTMTISEWKAL-SKENTIISAKVPPRPANNGEDVFSGMNVYKKRI 814
            REFDRHSGSDK+ +K  EKR GSGSHNWG VKD    E+  LDQ       E+  DGE  P AD +  E           K MT+ EWKA+  KE   +   +  R AN G D   G  ++K + 
Sbjct:  183 REFDRHSGSDKS-MKGEEKRGGSGSHNWGTVKD----ELNELDQSN---TTEENPDGEEHPPADSENKENEVEEVKEEGPKEMTLDEWKAMQGKERAKVEFNI--RKANEGADWNKGFVLHKSKA 297          
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Medaka
Match: serbp1b (plasminogen activator inhibitor 1 RNA-binding protein [Source:NCBI gene;Acc:101155636])

HSP 1 Score: 57.3806 bits (137), Expect = 1.253e-8
Identity = 45/108 (41.67%), Postives = 56/108 (51.85%), Query Frame = 2
Query:  476 REFDRHSGSDKTGI--KATEKRDGSGSHNWGNVKDIV-DLEIEGLDQIKDEGVLEKPVDGEVLPEADKK---EPEKTMTISEWKALS-KENTIISAKVPPRPANNGED 778
            R+FDRHS SDK+    K+ EKR G GSHNWGNVKD V + E     +   EG    P   E      ++   E  K MT+ EWKA+  KE T +   +  R  N G D
Sbjct:  181 RDFDRHSASDKSSSNPKSEEKRGGGGSHNWGNVKDEVNEAEQTAAPETTPEGEENTPAGSENKENEVEEVKPEGPKEMTLDEWKAMQDKERTKVEFNI--RKPNEGTD 286          
BLAST of SERPINE1 mRNA binding protein 1a vs. Planmine SMEST
Match: SMESG000008791.1 (SMESG000008791.1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 283/284 (99.65%), Postives = 283/284 (99.65%), Query Frame = 2
Query:   95 KSKFELFLNDDLCEAEPEELVRKIIEDXXXXXXXXXXXXXXXXXETKKAVAKSISEPEQPKSEEKRNGDKAPRFQNIDKRVPQKPRTANERVPPAKSETGFDENNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKALSKENTIISAKVPPRPANNGEDVFSGMNVYKKRISHITDSDTEVVVPEDEIDSKGRRQIKVNVEFSGRNRRGRGAYTN 946
            KSKFELFLNDDLCEAEPEELVRKIIEDKKKKEVALKEAKKQKQVETKKAVAKSISEPEQPKSEEKRNGDKAPRFQNIDKRVPQKPRTANERVPPAKSETGFDENNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKALSKENTIISAKVPPRPANNGEDVFSGMNVYKKRISHITDSDTEV VPEDEIDSKGRRQIKVNVEFSGRNRRGRGAYTN
Sbjct:   13 KSKFELFLNDDLCEAEPEELVRKIIEDKKKKEVALKEAKKQKQVETKKAVAKSISEPEQPKSEEKRNGDKAPRFQNIDKRVPQKPRTANERVPPAKSETGFDENNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDKTGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLPEADKKEPEKTMTISEWKALSKENTIISAKVPPRPANNGEDVFSGMNVYKKRISHITDSDTEVAVPEDEIDSKGRRQIKVNVEFSGRNRRGRGAYTN 296          
The following BLAST results are available for this feature:
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SERBP12.374e-1149.41SERPINE1 mRNA binding protein 1 [Source:HGNC Symbo... [more]
SERBP11.843e-941.75SERPINE1 mRNA binding protein 1 [Source:HGNC Symbo... [more]
SERBP12.672e-946.15SERPINE1 mRNA binding protein 1 [Source:HGNC Symbo... [more]
SERBP12.017e-739.45SERPINE1 mRNA binding protein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
vig-16.692e-648.78VIG (Drosophila Vasa Intronic Gene) ortholog [Sou... [more]
vig-16.692e-648.78VIG (Drosophila Vasa Intronic Gene) ortholog [Sou... [more]
vig-16.692e-648.78VIG (Drosophila Vasa Intronic Gene) ortholog [Sou... [more]
vig-16.692e-648.78VIG (Drosophila Vasa Intronic Gene) ortholog [Sou... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vig25.565e-1344.44gene:FBgn0046214 transcript:FBtr0113354[more]
vig25.565e-1344.44gene:FBgn0046214 transcript:FBtr0084776[more]
vig25.565e-1344.44gene:FBgn0046214 transcript:FBtr0084777[more]
vig27.852e-1344.44gene:FBgn0046214 transcript:FBtr0084775[more]
FDY1.610e-1247.73gene:FBgn0265047 transcript:FBtr0473381[more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
serbp1a1.485e-1342.74SERPINE1 mRNA binding protein 1a [Source:ZFIN;Acc:... [more]
serbp1a3.525e-1242.74SERPINE1 mRNA binding protein 1a [Source:ZFIN;Acc:... [more]
zgc:1034821.786e-938.89zgc:103482 [Source:ZFIN;Acc:ZDB-GENE-041010-115][more]
serbp1b5.624e-944.05SERPINE1 mRNA binding protein 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
serbp12.838e-836.25SERPINE1 mRNA binding protein 1 [Source:NCBI gene;... [more]
serbp12.883e-838.10SERPINE1 mRNA binding protein 1 [Source:NCBI gene;... [more]
rab5if1.054e-633.33RAB5 interacting factor [Source:Xenbase;Acc:XB-GEN... [more]
rab5if1.077e-633.33RAB5 interacting factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Serbp11.063e-1248.35serpine1 mRNA binding protein 1 [Source:MGI Symbol... [more]
Serbp14.185e-1142.16serpine1 mRNA binding protein 1 [Source:MGI Symbol... [more]
Serbp11.334e-1066.67serpine1 mRNA binding protein 1 [Source:MGI Symbol... [more]
Serbp11.340e-1045.36serpine1 mRNA binding protein 1 [Source:MGI Symbol... [more]
Serbp14.780e-939.81serpine1 mRNA binding protein 1 [Source:MGI Symbol... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9CY58|PAIRB_MOUSE3.343e-839.81Plasminogen activator inhibitor 1 RNA-binding prot... [more]
sp|Q6AXS5|PAIRB_RAT5.592e-839.05Plasminogen activator inhibitor 1 RNA-binding prot... [more]
sp|Q8NC51|PAIRB_HUMAN9.684e-739.45Plasminogen activator inhibitor 1 RNA-binding prot... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2YUP51.053e-1236.17SERPINE1 mRNA binding protein 1a OS=Hippocampus co... [more]
A0A3Q3MWA12.719e-1241.73SERPINE1 mRNA binding protein 1a OS=Mastacembelus ... [more]
A0A0R3X5K93.060e-1228.46HABP4_PAI-RBP1 domain-containing protein OS=Hydati... [more]
A0A087VY135.807e-1229.12mRNA binding protein OS=Echinococcus multiloculari... [more]
A0A3P8VB357.259e-1240.29SERPINE1 mRNA binding protein 1a OS=Cynoglossus se... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
serbp1a2.264e-1241.94plasminogen activator inhibitor 1 RNA-binding prot... [more]
SERBP18.622e-1034.87SERPINE1 mRNA binding protein 1 [Source:HGNC Symbo... [more]
ENSAMXT00000038790.12.077e-655.56hyaluronan binding protein 4 [Source:NCBI gene;Acc... [more]
ENSAMXT00000000304.23.309e-655.56hyaluronan binding protein 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
serbp1b1.268e-874.29SERPINE1 mRNA binding protein 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
serbp1a3.793e-1343.20plasminogen activator inhibitor 1 RNA-binding prot... [more]
serbp1b1.253e-841.67plasminogen activator inhibitor 1 RNA-binding prot... [more]
back to top
BLAST of SERPINE1 mRNA binding protein 1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008791.10.000e+099.65SMESG000008791.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027407 ID=SMED30027407|Name=SERPINE1 mRNA binding protein 1a|organism=Schmidtea mediterranea sexual|type=transcript|length=1351bp
TTTTGTTGTTTAAATTATCTGTTGGTTAGTTATTCTCCATTTTACATATT
TCATCAGCATGTCTGTGCCTAACGTAGTTTACAACGTGAATGTGAAATCA
AAATTCGAATTATTTTTAAATGATGATTTGTGTGAAGCAGAACCTGAAGA
ATTAGTTCGTAAAATAATTGAAGATAAGAAAAAGAAAGAAGTTGCATTGA
AAGAAGCTAAGAAACAAAAACAAGTTGAAACTAAAAAAGCTGTCGCTAAA
TCTATTTCAGAACCTGAACAACCTAAATCAGAAGAAAAACGAAATGGTGA
TAAAGCACCTAGATTTCAAAATATCGACAAACGTGTTCCACAAAAACCTC
GAACTGCTAATGAACGAGTTCCTCCTGCTAAAAGTGAAACTGGGTTTGAT
GAAAATAATAAAGATAACATAAGGGGTGGTAAAGGAAAGCGACCTGCTAG
TAATGTTGTCCGTAAAGTTCACGGACGAGAATTTGATAGGCATTCGGGAT
CTGATAAAACTGGGATTAAAGCAACGGAAAAACGAGATGGGTCTGGTTCG
CACAACTGGGGAAATGTTAAGGATATTGTAGATTTAGAAATTGAAGGATT
GGATCAAATTAAAGATGAAGGGGTTCTTGAAAAGCCTGTAGATGGTGAAG
TACTACCAGAAGCTGATAAAAAAGAGCCCGAGAAAACAATGACTATTTCT
GAATGGAAAGCACTAAGTAAAGAAAATACTATTATATCGGCTAAAGTCCC
CCCTCGTCCTGCAAATAATGGTGAAGATGTGTTTTCTGGAATGAATGTTT
ATAAGAAACGGATTAGTCATATAACTGATTCTGACACGGAAGTAGTTGTT
CCTGAAGACGAAATTGATTCCAAAGGCCGTCGACAAATTAAAGTTAATGT
TGAATTTTCTGGTAGAAACCGAAGAGGACGTGGGGCTTATACTAATTCTA
GATTTAATAAGGAAGAAAAGAAAAGTTCTAATGTGGCAGATGTTTTACTA
AATTTAGATGAAAATGAGTTTCCAACTTTGTCGTAAATAAATATCAGTAT
TGATCAAAGAAATCAGTATTGATTGTTATAAGTAAAATAGGGTGCTTTTA
ATAAAATTGGAAACCCTGATTGGTTTTGTATATTAGGATTCACGGTGATT
TCGTTGTTTAAATGGTTTTCTATTAATTATTTGCTAAAAACTTCAATTTA
TCAAGTTTTTGTTATCGGTGGTGTTAGATATTGAGAGTTTTTTCATTTGT
GTTATGAAAATGATAAGGTTAAAGTCTATCGAAAGTTTATATGGATTATA
AAATGTCGTTTTTAATTTGCTATTAACTTTGTTTATAAATGTGAATCAAT
T
back to top

protein sequence of SMED30027407-orf-1

>SMED30027407-orf-1 ID=SMED30027407-orf-1|Name=SMED30027407-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MSVPNVVYNVNVKSKFELFLNDDLCEAEPEELVRKIIEDKKKKEVALKEA
KKQKQVETKKAVAKSISEPEQPKSEEKRNGDKAPRFQNIDKRVPQKPRTA
NERVPPAKSETGFDENNKDNIRGGKGKRPASNVVRKVHGREFDRHSGSDK
TGIKATEKRDGSGSHNWGNVKDIVDLEIEGLDQIKDEGVLEKPVDGEVLP
EADKKEPEKTMTISEWKALSKENTIISAKVPPRPANNGEDVFSGMNVYKK
RISHITDSDTEVVVPEDEIDSKGRRQIKVNVEFSGRNRRGRGAYTNSRFN
KEEKKSSNVADVLLNLDENEFPTLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003730mRNA 3'-UTR binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039764HABP4/SERBP1
IPR006861HABP4_PAIRBP1-bd
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 33..60
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..98
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..304
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..125
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..166
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..211
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 134..165
NoneNo IPR availablePANTHERPTHR12299:SF17AT19571P-RELATEDcoord: 15..324
IPR006861Hyaluronan/mRNA-binding proteinSMARTSM01233HABP4_PAI_RBP1_2coord: 138..238
e-value: 5.8E-23
score: 92.3
IPR006861Hyaluronan/mRNA-binding proteinPFAMPF04774HABP4_PAI-RBP1coord: 140..223
e-value: 3.1E-16
score: 60.2
IPR039764RNA binding protein HABP4/SERBP1PANTHERPTHR12299HYALURONIC ACID-BINDING PROTEIN 4coord: 15..324