Trna pseudouridine synthase pus10

Overview
NameTrna pseudouridine synthase pus10
Smed IDSMED30027394
Length (bp)1747
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Trna pseudouridine synthase pus10 (SMED30027394) t-SNE clustered cells

Violin plots show distribution of expression levels for Trna pseudouridine synthase pus10 (SMED30027394) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Trna pseudouridine synthase pus10 (SMED30027394) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Trna pseudouridine synthase pus10 (SMED30027394) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027394

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30027394h1SMcG0000035 SmedASXL_014452SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Human
Match: PUS10 (pseudouridine synthase 10 [Source:HGNC Symbol;Acc:HGNC:26505])

HSP 1 Score: 270.396 bits (690), Expect = 7.566e-83
Identity = 168/508 (33.07%), Postives = 260/508 (51.18%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ     D  I ++   +  + F+F S    VS P  L +RE A +L++K++   +  SL RD+I+ +K  ++++     S  +G   ++G                    V+V F H ++  +C  L  + P+ FK  +  +S     +FT+ ++ + L  I +E   + F  PPN      S + +   +++      V VAGRY K SR LPQ+PWI DG RKLESSVEELI++ L++ F++ES  F SSGREDVDVR LG+GRPF +EL N    V    + +  L+Q+IN S  ++I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   ++ +N  +DL + Q TP+RVLHRR L  R R  +                             +QY  ++ F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++    DIL LDV  ++++WPP
Sbjct:  108 VCNVCLGILQEFCEKD-FIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVP-IDG---------------KSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQS-----VFTRMAVMKALNKIKEEDFLKQFPCPPN------SPKAVCAVLEIECAHGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIELVNPHR-VHFTSQEIKELQQKINNSS-NKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NKAI---------------------------------QKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFME--------------------------TQYVDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPP 525          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Human
Match: PUS10 (pseudouridine synthase 10 [Source:HGNC Symbol;Acc:HGNC:26505])

HSP 1 Score: 270.396 bits (690), Expect = 7.566e-83
Identity = 168/508 (33.07%), Postives = 260/508 (51.18%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ     D  I ++   +  + F+F S    VS P  L +RE A +L++K++   +  SL RD+I+ +K  ++++     S  +G   ++G                    V+V F H ++  +C  L  + P+ FK  +  +S     +FT+ ++ + L  I +E   + F  PPN      S + +   +++      V VAGRY K SR LPQ+PWI DG RKLESSVEELI++ L++ F++ES  F SSGREDVDVR LG+GRPF +EL N    V    + +  L+Q+IN S  ++I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   ++ +N  +DL + Q TP+RVLHRR L  R R  +                             +QY  ++ F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++    DIL LDV  ++++WPP
Sbjct:  108 VCNVCLGILQEFCEKD-FIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVP-IDG---------------KSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQS-----VFTRMAVMKALNKIKEEDFLKQFPCPPN------SPKAVCAVLEIECAHGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIELVNPHR-VHFTSQEIKELQQKINNSS-NKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NKAI---------------------------------QKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFME--------------------------TQYVDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPP 525          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Celegans
Match: Y48C3A.20 (pep chromosome:WBcel235:II:13369607:13375290:1 gene:WBGene00012998.1 transcript:Y48C3A.20.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48C3A.20)

HSP 1 Score: 175.252 bits (443), Expect = 4.275e-48
Identity = 161/532 (30.26%), Postives = 252/532 (47.37%), Query Frame = 2
Query:  170 EELT--ENCL-CYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSEL-ECSVLMELEPESF---KRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWI--FDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNL--VRDV--IERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIG---QQCDILALDVMEIELEWPPK 1717
            EE+T  EN   C LC GI+   +  D + ++++ ++S   +  +SF + ++ P+   +RE  L   L+  F     S+       ++++  YL K  L S  GK           R +    L +D  ++ ++F   +S   +   L    P  F   KR R   ++      +K+ L+QV   IN++  ++          + +  R  +  +   R   PV +AGRYCK SR LPQSPW    D  R+  +SV E + + L   F +    F++SGRED+DVRMLG+GRPFV+ELRNCR    VR +  +E + T+++ IN   Q  + V  L  + ++    +  GE++K KQY    +C                         +   +S +    +QS +         L + Q TP+RV+ RRAL+DR R  YS +   LD                          D+ F + L  QAG+Y+KEFVHGD GRTRP+LA ++     + DIL LDV +++LEWPP+
Sbjct:   23 EEVTKCENSFECQLCFGIMDQAMI-DEVGEKVQEELSKLPYDSMSFILALNLPVGQTLREI-LVSRLRPDFNGTLASVP----YKVRNIDGYLKK--LGSYSGK-----------RPT----LSSDLQLM-ITFEQEESNFSDLQFLQNQFPNDFRVGKRGRYNNNQEAPSSVSKQQLQQVTGRINEQIAKKYI--------FKSPTRKCTFQLQFERD--PVYIAGRYCKYSRCLPQSPWSEDKDAPREPGNSVSEKVCDLLKKQFGASDSRFVTSGREDIDVRMLGTGRPFVVELRNCRTTAPVRGIKYLETLKTVQEAINV--QKDVKVVSLTRVPRDVSEKLCVGEEDKRKQY--CAYC------------------------YSILPISDSQFTAAQSKI--------PLKIVQKTPVRVMKRRALLDRERWIYSMNFLKLD--------------------------DHHFEVRLETQAGTYIKEFVHGDFGRTRPSLAELLDVEHGEVDILELDVEKVDLEWPPE 458          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Fly
Match: CG3709 (gene:FBgn0031227 transcript:FBtr0078147)

HSP 1 Score: 192.2 bits (487), Expect = 4.095e-54
Identity = 151/516 (29.26%), Postives = 248/516 (48.06%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKF-PLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDY-MNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLK--NINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHG---FISSGREDVDVRMLGSGRPFVMELRNCRN--LVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWP 1711
            +C  C G+      ++ +   L  D +  + Q +   I +  P++L +R+ A++  L+ +F P   E+   D  +PIK   + ++   +   + K Y  NGL                  ++N+  TH     E   L++L  E+F  +   + R +    ++  LE+  +   +  E  ++ F +P ++V    S +L S+ +    Q   + VAGRY KLSR L  +PWI +G R +E S+EE+I   +   F +E  G   F+SSGREDVDVR LG GRPFV+E+ N +   L +D       +E+ ++ SG   +S++ L+++ +E ++ IK GE++K K YR +   +                                        +L+ +  +    +QQ TPIRVLHRR L  RPRT YS         ++A   R +P                  ++ +  QAG+Y+KE VHG+ GRT P+L++IIG+  DI ALDV+ I+L+WP
Sbjct:   70 VCSTCLGLFSKDFQNELLSSILASDFAKYDCQKIVLAICL--PMSLQLRQLAMWFALRRRFGPSIDENNPPD--VPIKEAVKLILHPIICEKLAKVYDANGL------------------MINIDLTHSLEGEEVEKLVKLNKEAFPAKASHQKRIE---ISRGLLEKQYQPSKVKAETYEKYFQIPCSNVE--ESIKLTSIDL----QGPLICVAGRYRKLSRELSHTPWILNGQRLMEDSIEEIIIRHVGPHF-TEKLGKITFMSSGREDVDVRCLGKGRPFVLEIPNAKRSCLTKD---EAFAMERAVDASGM--VSIHHLQVVPREELTHIKTGEEQKKKFYRALCALQE----------------------------------PVSVKILEQLQISASFNIQQKTPIRVLHRRPLHTRPRTIYS---------VTAKVHRGNP---------------KALIIDIVTQAGTYIKELVHGEFGRTTPSLSSIIGKPMDIQALDVVGIDLDWP 490          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Zebrafish
Match: pus10 (pseudouridine synthase 10 [Source:ZFIN;Acc:ZDB-GENE-080204-5])

HSP 1 Score: 271.166 bits (692), Expect = 1.826e-83
Identity = 165/508 (32.48%), Postives = 257/508 (50.59%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C G+LQ+   S     Q+   +   +++F S  + VS P  L +RE + +L +K++   K   L +D++I +K  +++ ++ +++  +G                  +L N    V+V F H +++ +C  L    P+ FK      ++ K  +FT+ ++ + L+ I++E   R +  PP       S       +D T     V +AGRY K SR LPQ+PW+ DG R+++ SVEELIA  L+S+FR++   F SSGREDVDVR LG+GRPF +EL N      +  E +  +++ IN+S  D+I V  L+I+S+E  S +K+GE+EK K Y  ++W E                                      S+ L  +   +DL V Q TP+RVLHRR L  R R  +S S+  LD+                          + F L LR QAG+Y+KEFVHGD GRT+PNL  ++    DIL LDV  ++++WPP
Sbjct:   98 VCPVCLGVLQD-FCSPAFAKQVSDAVKKQQYEFESLVLTVSLPAQLSVREHSCWLHVKKEVREKSMCLGKDDVIQVKDAFKWAVQGKIAQELGAS----------------VLANSPCEVSVGFIHAETDEDCHFLANTCPDCFK-----PTKNKASIFTRMAVVKALEKISEETFSRYYPCPPKKPNSRCS------ALDTTCLHTSVFIAGRYNKFSRELPQTPWVIDGERRMDGSVEELIAAPLLSSFRADGFNFSSSGREDVDVRTLGNGRPFAVELLNPHRAKFNRTE-IKQIQETINQSS-DKIRVRDLQIVSREATSRMKEGEEEKTKTYSALIWTEK----------------------------------TIDSSDLHFLENIKDLKVAQKTPLRVLHRRPLAVRQRLIHSMSSVYLDK--------------------------HHFTLKLRTQAGTYIKEFVHGDFGRTKPNLCDLMNTDADILELDVESVDIDWPP 515          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Xenopus
Match: bin3 (bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-999567])

HSP 1 Score: 281.952 bits (720), Expect = 1.623e-87
Identity = 176/508 (34.65%), Postives = 261/508 (51.38%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C LC GILQ        I ++   I++A ++   F   VS P  L +RE + +L  K++       L + +I+ +K  +++++   LS+ +G             +    L E     V V FTH +++ +C  L  + P+ FK  +  +S     +FT+ ++ + L+ I +E     F  PP      +S    S  VD+     PV VAGRY K SR LPQ+PWI DG RK+ESSVEELI E LV AF+++S  F SSGREDVDVR LG GRPF +EL N    V+  ++ +  L+Q+IN S  D+I V  L+I+S+E V+ +K+GE+EK K Y  ++W E                                     Q+  LQ +NG ++L + Q TP+RVLHRR L  R RT ++     +D+                          + F L+L+ QAG+Y+KEFVHGD GRT PN+ +I+    DIL LDV  ++++WPP
Sbjct:   94 ICTLCLGILQQ-FCEPEFIKKVFVKINSAGYELKDFVFSVSLPAQLSVREHSAWLQAKQEMGKDGHWLDKADIVQLKEAYKWIIHPLLSTELG-----------IHADGKSLFE-----VAVVFTHPETDGDCHFLATVCPDCFKPTKNKQS-----VFTRMAVVKALEKIKEEDFHVQFPFPP------SSPETASEVVDIQCNHSPVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELITEHLVKAFKADSFNFSSSGREDVDVRTLGKGRPFAIELLNPHK-VQFTVQDIKALQQKINTS--DKIKVRDLQIVSREAVAHMKEGEEEKTKCYCALIWLEK----------------------------------KIQNEDLQQLNGLQELKIAQKTPLRVLHRRPLASRSRTIHTMRTEHVDE--------------------------HHFRLYLKTQAGTYIKEFVHGDFGRTTPNVGSILKTNADILELDVESVDVDWPP 510          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Xenopus
Match: bin3 (bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-999567])

HSP 1 Score: 229.565 bits (584), Expect = 4.924e-68
Identity = 165/499 (33.07%), Postives = 241/499 (48.30%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDV 1687
            +C LC GILQ        I ++   I++A ++   F   VS P  L +RE     + K+        L + +I+ +K  +++++   LS+ +G      + V  A +   C          V +T+                SF++ ++ +     D + K+      +NI  +     F  PP      +S    S  VD+     PV VAGRY K SR LPQ+PWI DG RK+ESSVEELI E LV AF+++S  F SSGREDVDVR LG GRPF +EL N    V+  ++ +  L+Q+IN S  D+I V  L+I+S+E V+ +K+GE+EK K Y  ++W E                                     Q+  LQ +NG ++L + Q TP+RVLHRR L  R RT ++     +D+                          + F L+L+ QAG+Y+KEFVHGD GRT PN+ +I+    DIL LDV
Sbjct:   94 ICTLCLGILQQ-FCEPEFIKKVFVKINSAGYELKDFVFSVSLPAQLSVRE-----VKKDG-----HWLDKADIVQLKEAYKWIIHPLLSTELGIHADGKVPVFCANTIYLC----------VCYTYI---------------SFRKGQQDQ-----DFYAKQ------RNIFNQ-----FPFPP------SSPETASEVVDIQCNHSPVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELITEHLVKAFKADSFNFSSSGREDVDVRTLGKGRPFAIELLNPHK-VQFTVQDIKALQQKINTS--DKIKVRDLQIVSREAVAHMKEGEEEKTKCYCALIWLEK----------------------------------KIQNEDLQQLNGLQELKIAQKTPLRVLHRRPLASRSRTIHTMRTEHVDE--------------------------HHFRLYLKTQAGTYIKEFVHGDFGRTTPNVGSILKTNADILELDV 471          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Xenopus
Match: bin3 (bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-999567])

HSP 1 Score: 223.016 bits (567), Expect = 1.393e-65
Identity = 161/499 (32.26%), Postives = 233/499 (46.69%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDV 1687
            +C LC GILQ        I ++   I++A ++   F   VS P  L +RE     + K+        L + +I+ +K  +++++   LS+ +G             +    L E     V V FTH +++ +C  LM                         ++ + L+ I +E     F  PP      +S    S  VD+     PV VAGRY K SR LPQ+PWI DG RK+ESSVEELI E LV AF+++S  F SSGREDVDVR LG G    + L    + +      M ++ Q+IN S  D+I V  L+I+S+E V+ +K+GE+EK K Y  ++W E                                     Q+  LQ +NG ++L + Q TP+RVLHRR L  R RT ++     +D+                          + F L+L+ QAG+Y+KEFVHGD GRT PN+ +I+    DIL LDV
Sbjct:   94 ICTLCLGILQQ-FCEPEFIKKVFVKINSAGYELKDFVFSVSLPAQLSVRE-----VKKDG-----HWLDKADIVQLKEAYKWIIHPLLSTELG-----------IHADGKSLFE-----VAVVFTHPETDGDCHFLM-------------------------AVVKALEKIKEEDFHVQFPFPP------SSPETASEVVDIQCNHSPVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELITEHLVKAFKADSFNFSSSGREDVDVRTLGKGTVLGISL---MHFLLSFPNTMCSVLQKINTS--DKIKVRDLQIVSREAVAHMKEGEEEKTKCYCALIWLEK----------------------------------KIQNEDLQQLNGLQELKIAQKTPLRVLHRRPLASRSRTIHTMRTEHVDE--------------------------HHFRLYLKTQAGTYIKEFVHGDFGRTTPNVGSILKTNADILELDV 469          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Xenopus
Match: bin3 (bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-999567])

HSP 1 Score: 220.32 bits (560), Expect = 3.263e-64
Identity = 158/501 (31.54%), Postives = 243/501 (48.50%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQ-QINRS-GQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDV 1687
            +C LC GILQ        I ++   I++A ++   F   VS P  L +RE + +L  K++       L + +I+ +K  +++++   LS+ +G             +    L E     V V FTH +++ +C  L  + P+ FK  +  +S     +FT+ ++ + L+ I +E     F  PP      +S    S  VD+     PV VAGRY K SR LPQ+PWI DG RK+ESSVEELI E LV AF+++S   I+  + +  +  L  GRPF +EL N    V+  ++ +  L+Q  +N+S   D I V    + ++E V+ +K+GE+EK K Y  ++W E                                     Q+  LQ +NG ++L + Q TP+RVLHRR L  R RT ++     +D                          ++ F L+L+ QAG+Y+KEFVHGD GRT PN+ +I+    DIL LDV
Sbjct:   94 ICTLCLGILQQ-FCEPEFIKKVFVKINSAGYELKDFVFSVSLPAQLSVREHSAWLQAKQEMGKDGHWLDKADIVQLKEAYKWIIHPLLSTELG-----------IHADGKSLFE-----VAVVFTHPETDGDCHFLATVCPDCFKPTKNKQS-----VFTRMAVVKALEKIKEEDFHVQFPFPP------SSPETASEVVDIQCNHSPVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELITEHLVKAFKADSK--IAFWKAECILLYLFLGRPFAIELLNPHK-VQFTVQDIKALQQCNLNKSITADWICV----LFTREAVAHMKEGEEEKTKCYCALIWLEK----------------------------------KIQNEDLQQLNGLQELKIAQKTPLRVLHRRPLASRSRTIHTMRTEHVD--------------------------EHHFRLYLKTQAGTYIKEFVHGDFGRTTPNVGSILKTNADILELDV 499          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Mouse
Match: Pus10 (pseudouridylate synthase 10 [Source:MGI Symbol;Acc:MGI:1921717])

HSP 1 Score: 267.314 bits (682), Expect = 6.783e-82
Identity = 170/508 (33.46%), Postives = 258/508 (50.79%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ        I ++   +  + F+F S  + VS P  L +RE A +L++K++   +  SL R++++ +K  ++++     S  +G             +    L E     V+V F H ++  +C  L E+  + FK      ++ K  +FT+ ++ + L  I +E     F  PPN      S + +   ++V      V VAGRY K SR LPQ+PWI DG RK+ESSVEELI++ L++ FR+ES  F SSGREDVDVR LG+GRPF +EL N    V    + M  L+Q IN+S  D+I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   +  ++  +DL + Q TP+RVLHRR L  R R  +S     LD+                          + F LHL+ QAG+Y+KEFVHGD GRT+PNL +++    DIL LDV  ++++WPP
Sbjct:  106 VCNVCLGILQE-FCEKGFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELG-----------VPTDGKSLFE-----VSVVFAHPETAEDCHFLGEVCRDCFK-----PAKNKQSVFTRMAVLKALSKIKEEDFLGQFPCPPN------SPKTVCTVLEVECTHGAVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLNPHR-VHFTSQEMKELQQTINKSS-DKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NRAI---------------------------------QKKDIGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDE--------------------------HHFRLHLKTQAGTYIKEFVHGDFGRTKPNLGSLMNVTADILELDVESVDVDWPP 523          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Mouse
Match: Pus10 (pseudouridylate synthase 10 [Source:MGI Symbol;Acc:MGI:1921717])

HSP 1 Score: 267.314 bits (682), Expect = 6.783e-82
Identity = 170/508 (33.46%), Postives = 258/508 (50.79%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ        I ++   +  + F+F S  + VS P  L +RE A +L++K++   +  SL R++++ +K  ++++     S  +G             +    L E     V+V F H ++  +C  L E+  + FK      ++ K  +FT+ ++ + L  I +E     F  PPN      S + +   ++V      V VAGRY K SR LPQ+PWI DG RK+ESSVEELI++ L++ FR+ES  F SSGREDVDVR LG+GRPF +EL N    V    + M  L+Q IN+S  D+I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   +  ++  +DL + Q TP+RVLHRR L  R R  +S     LD+                          + F LHL+ QAG+Y+KEFVHGD GRT+PNL +++    DIL LDV  ++++WPP
Sbjct:  106 VCNVCLGILQE-FCEKGFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELG-----------VPTDGKSLFE-----VSVVFAHPETAEDCHFLGEVCRDCFK-----PAKNKQSVFTRMAVLKALSKIKEEDFLGQFPCPPN------SPKTVCTVLEVECTHGAVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLNPHR-VHFTSQEMKELQQTINKSS-DKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NRAI---------------------------------QKKDIGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDE--------------------------HHFRLHLKTQAGTYIKEFVHGDFGRTKPNLGSLMNVTADILELDVESVDVDWPP 523          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Mouse
Match: Pus10 (pseudouridylate synthase 10 [Source:MGI Symbol;Acc:MGI:1921717])

HSP 1 Score: 267.314 bits (682), Expect = 6.783e-82
Identity = 170/508 (33.46%), Postives = 258/508 (50.79%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ        I ++   +  + F+F S  + VS P  L +RE A +L++K++   +  SL R++++ +K  ++++     S  +G             +    L E     V+V F H ++  +C  L E+  + FK      ++ K  +FT+ ++ + L  I +E     F  PPN      S + +   ++V      V VAGRY K SR LPQ+PWI DG RK+ESSVEELI++ L++ FR+ES  F SSGREDVDVR LG+GRPF +EL N    V    + M  L+Q IN+S  D+I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   +  ++  +DL + Q TP+RVLHRR L  R R  +S     LD+                          + F LHL+ QAG+Y+KEFVHGD GRT+PNL +++    DIL LDV  ++++WPP
Sbjct:  106 VCNVCLGILQE-FCEKGFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELG-----------VPTDGKSLFE-----VSVVFAHPETAEDCHFLGEVCRDCFK-----PAKNKQSVFTRMAVLKALSKIKEEDFLGQFPCPPN------SPKTVCTVLEVECTHGAVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLNPHR-VHFTSQEMKELQQTINKSS-DKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NRAI---------------------------------QKKDIGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDE--------------------------HHFRLHLKTQAGTYIKEFVHGDFGRTKPNLGSLMNVTADILELDVESVDVDWPP 523          
BLAST of Trna pseudouridine synthase pus10 vs. UniProt/SwissProt
Match: sp|Q3MIT2|PUS10_HUMAN (tRNA pseudouridine synthase Pus10 OS=Homo sapiens OX=9606 GN=PUS10 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.634e-82
Identity = 168/508 (33.07%), Postives = 260/508 (51.18%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ     D  I ++   +  + F+F S    VS P  L +RE A +L++K++   +  SL RD+I+ +K  ++++     S  +G   ++G                    V+V F H ++  +C  L  + P+ FK  +  +S     +FT+ ++ + L  I +E   + F  PPN      S + +   +++      V VAGRY K SR LPQ+PWI DG RKLESSVEELI++ L++ F++ES  F SSGREDVDVR LG+GRPF +EL N    V    + +  L+Q+IN S  ++I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   ++ +N  +DL + Q TP+RVLHRR L  R R  +                             +QY  ++ F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++    DIL LDV  ++++WPP
Sbjct:  108 VCNVCLGILQEFCEKD-FIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVP-IDG---------------KSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQS-----VFTRMAVMKALNKIKEEDFLKQFPCPPN------SPKAVCAVLEIECAHGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIELVNPHR-VHFTSQEIKELQQKINNSS-NKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NKAI---------------------------------QKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFME--------------------------TQYVDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPP 525          
BLAST of Trna pseudouridine synthase pus10 vs. UniProt/SwissProt
Match: sp|Q9D3U0|PUS10_MOUSE (tRNA pseudouridine synthase Pus10 OS=Mus musculus OX=10090 GN=Pus10 PE=1 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 4.745e-81
Identity = 170/508 (33.46%), Postives = 258/508 (50.79%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ        I ++   +  + F+F S  + VS P  L +RE A +L++K++   +  SL R++++ +K  ++++     S  +G             +    L E     V+V F H ++  +C  L E+  + FK      ++ K  +FT+ ++ + L  I +E     F  PPN      S + +   ++V      V VAGRY K SR LPQ+PWI DG RK+ESSVEELI++ L++ FR+ES  F SSGREDVDVR LG+GRPF +EL N    V    + M  L+Q IN+S  D+I V  L+++++E +  +K+GE+EK K Y  ++W  N  I                                 Q   +  ++  +DL + Q TP+RVLHRR L  R R  +S     LD+                          + F LHL+ QAG+Y+KEFVHGD GRT+PNL +++    DIL LDV  ++++WPP
Sbjct:  106 VCNVCLGILQE-FCEKGFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELG-----------VPTDGKSLFE-----VSVVFAHPETAEDCHFLGEVCRDCFK-----PAKNKQSVFTRMAVLKALSKIKEEDFLGQFPCPPN------SPKTVCTVLEVECTHGAVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLNPHR-VHFTSQEMKELQQTINKSS-DKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT-NRAI---------------------------------QKKDIGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDE--------------------------HHFRLHLKTQAGTYIKEFVHGDFGRTKPNLGSLMNVTADILELDVESVDVDWPP 523          
BLAST of Trna pseudouridine synthase pus10 vs. UniProt/SwissProt
Match: sp|Q6ING2|PUS10_XENLA (tRNA pseudouridine synthase Pus10 OS=Xenopus laevis OX=8355 GN=pus10 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 6.154e-79
Identity = 176/508 (34.65%), Postives = 266/508 (52.36%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C LC GILQ        I+++   I++A ++   F + +S P  L +RE + +L  K++      SL + +I+ +K  +++++   LS  +G        +Q+   S   L E     V V FTH +++ +C  L  +  + FK  +  +S     +FT+ ++ + L+ I +E  +  F  PP      +S       VD+     PV VAGRY K SR LPQ+PWI DG RK+ESSVEELI + LV+AFRS S  F SSGREDVDVR LG GRPF +EL N    V+   + +  L+Q+IN S  D+I V  L+I+S+E V+ +K+GE+EK K Y  ++W E                                     ++  LQL++G  +L + Q TP+RVLHRR L  R RT ++                            ++Y  ++ F L+L+ QAG+Y+KEFVHGD GRT+PN+ +I+    DIL LDV  ++++WPP
Sbjct:   95 ICPLCLGILQQ-FCEPEFIEKVFVKINSAVYELKDFVLSISLPAQLSVREHSAWLQAKQEMGKHGHSLDKTDIVQLKEAYKWIIHPLLSDQLG--------IQADSKS---LFE-----VAVVFTHPETDGDCHFLATVCRDCFKPTKNKQS-----VFTRMAVVKALEKIKEEDFRVQFPFPP------SSPETTCEVVDIQCNHSPVFVAGRYNKYSRNLPQTPWIIDGERKIESSVEELITDHLVAAFRSSSFNFSSSGREDVDVRTLGKGRPFAIELLNPHK-VQFTGQEIKALQQKINTS--DKIKVRDLQIVSREAVAHMKEGEEEKTKCYCALIWIEK----------------------------------MVRNEDLQLLDGLEELTIAQKTPLRVLHRRPLASRSRTIHTMR--------------------------TEYVDEHHFRLYLKTQAGTYIKEFVHGDFGRTKPNVGSIMETNADILELDVESVDVDWPP 511          
BLAST of Trna pseudouridine synthase pus10 vs. UniProt/SwissProt
Match: sp|Q9VPK7|PUS10_DROME (Putative tRNA pseudouridine synthase Pus10 OS=Drosophila melanogaster OX=7227 GN=Pus10 PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 4.105e-53
Identity = 151/516 (29.26%), Postives = 248/516 (48.06%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKF-PLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDY-MNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLK--NINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHG---FISSGREDVDVRMLGSGRPFVMELRNCRN--LVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWP 1711
            +C  C G+      ++ +   L  D +  + Q +   I +  P++L +R+ A++  L+ +F P   E+   D  +PIK   + ++   +   + K Y  NGL                  ++N+  TH     E   L++L  E+F  +   + R +    ++  LE+  +   +  E  ++ F +P ++V    S +L S+ +    Q   + VAGRY KLSR L  +PWI +G R +E S+EE+I   +   F +E  G   F+SSGREDVDVR LG GRPFV+E+ N +   L +D       +E+ ++ SG   +S++ L+++ +E ++ IK GE++K K YR +   +                                        +L+ +  +    +QQ TPIRVLHRR L  RPRT YS         ++A   R +P                  ++ +  QAG+Y+KE VHG+ GRT P+L++IIG+  DI ALDV+ I+L+WP
Sbjct:   70 VCSTCLGLFSKDFQNELLSSILASDFAKYDCQKIVLAICL--PMSLQLRQLAMWFALRRRFGPSIDENNPPD--VPIKEAVKLILHPIICEKLAKVYDANGL------------------MINIDLTHSLEGEEVEKLVKLNKEAFPAKASHQKRIE---ISRGLLEKQYQPSKVKAETYEKYFQIPCSNVE--ESIKLTSIDL----QGPLICVAGRYRKLSRELSHTPWILNGQRLMEDSIEEIIIRHVGPHF-TEKLGKITFMSSGREDVDVRCLGKGRPFVLEIPNAKRSCLTKD---EAFAMERAVDASGM--VSIHHLQVVPREELTHIKTGEEQKKKFYRALCALQE----------------------------------PVSVKILEQLQISASFNIQQKTPIRVLHRRPLHTRPRTIYS---------VTAKVHRGNP---------------KALIIDIVTQAGTYIKELVHGEFGRTTPSLSSIIGKPMDIQALDVVGIDLDWP 490          
BLAST of Trna pseudouridine synthase pus10 vs. UniProt/SwissProt
Match: sp|Q8TUV7|PUS10_METKA (tRNA pseudouridine synthase Pus10 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) OX=190192 GN=pus10 PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.155e-28
Identity = 98/306 (32.03%), Postives = 135/306 (44.12%), Query Frame = 2
Query:  812 PVMVAGRYCKLSRRLPQSPWIFDGVRK------------LESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVME 1693
            P+ V GRY KL R +PQ+ W     R                SVEELI   L  AF +ESH F ++GRED+DVRMLG+GRPFVMEL   +    D+ E    +E +INR   D + V GL     E V  +K   +   K+YR   W + G                                   +  L +++ G    +++Q TP RVLHRR                      AD++R       +   L +Y+ D   +  L C  G YVKE + GD GRTRP+LA ++  + +   LDV+E
Sbjct:  185 PIYVRGRYLKLRRGIPQTKWPCPRCRGAGCPNCDFTGKLYTESVEELIGMVLKDAFLAESHKFHAAGREDIDVRMLGNGRPFVMELLYPKRRNVDLKE----IEGEINRKVGDDVQVVGLEYGDPEDVGKVKDLSERSRKRYR--AWVKFG-------------------------------KPVPEDKLREVLKGLERSVIEQRTPRRVLHRR----------------------ADKVRRKRV---HEAKLIEYDGDRAVIEFL-CDPGLYVKELISGDAGRTRPSLAELVEVEAECERLDVIE 427          
BLAST of Trna pseudouridine synthase pus10 vs. TrEMBL
Match: A0A091JB41 (Putative tRNA pseudouridine synthase Pus10 (Fragment) OS=Egretta garzetta OX=188379 GN=Z169_07336 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 3.609e-86
Identity = 183/567 (32.28%), Postives = 293/567 (51.68%), Query Frame = 2
Query:   65 DNKEVNDVLCQWEI----CWRCRLRITDKIID----------FQKFNSKEELTENC---LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +N+E  D +C +++    C R RL  T++  D              N++   TEN    +C +C GILQ     D  + ++   +++A++QF SF   VS P  L +RE A +L++K++      SL++D+I+ +K  +++++  +LS  +G                 C        V+V F H ++E EC  L    P+ FK      ++ K  +FT+ ++ + L+ I +E   + F  PP      +S + + + +++   +  V VAGRY K SR LPQ+PWI DG RKLESSVEELI+E L++ F+++S  F SSGREDVDVR LG+GRPF +EL N R  +    E M  L+Q IN+S  D+I V  L+++++E +  +K+GE+EK K Y  ++W +                                     Q   +  ++  ++L + Q TP+RVLHRR L  R R  ++  A  +D+                          + F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++ +  DIL LDV  ++++WPP
Sbjct:   54 NNEEKEDTVC-FDVVDPPCKRIRLEHTEEGSDDLNHNGALQQIPPLNNENTATENSAVKVCNVCLGILQEFCEVD-FVKKVCQKVNSADYQFTSFVFSVSLPPQLSVRECAAWLLVKQEMGKLDLSLAKDDIVQLKEAYKWIIHPQLSEELGGPAFR------------CFKNLGLFEVSVVFAHPETEEECHFLATACPDCFK-----PAKNKQSVFTRMAVIKALEKIKEEDFLKHFPCPP------SSPKNLCVPLEIQCNNGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISEHLIAEFKADSFNFSSSGREDVDVRTLGNGRPFAIELVNPRR-IHFTAEEMKGLQQTINKSS-DKIQVRDLQLVTREAIGRMKEGEEEKTKSYSALIWTDKA----------------------------------IQEEDIAFLDDIKELKLDQKTPLRVLHRRPLAVRCRIIHTMKAEYIDE--------------------------HHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLLNRTADILELDVESVDVDWPP 533          
BLAST of Trna pseudouridine synthase pus10 vs. TrEMBL
Match: A0A093D546 (Putative tRNA pseudouridine synthase Pus10 (Fragment) OS=Tauraco erythrolophus OX=121530 GN=N340_02168 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.274e-86
Identity = 172/508 (33.86%), Postives = 272/508 (53.54%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ     D  + ++   +++A++QF SF   VS P  L +RE A +L++K++      SL++D+I+ +K  +++++  +LS  +G             +    L E     V+V F H +++ EC  L    P+ FK      ++ K  +FT+ ++ + L+ I +E   + F  PP      +S + + + V++   +  V VAGRY K SR LPQ+PWI DG RKLESSVEELI+E L++ F+++S  F SSGREDVDVR LG+GRPF +EL N R  +R   E M  L+Q IN S  D+I V  L+++++E +  +K+GE+EK K Y  ++W +                                     Q   +  ++  ++L ++Q TP+RVLHRR L  R R  ++                            SQY  ++ F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++ +  DIL LDV  ++++WPP
Sbjct:  112 VCNVCLGILQEFCEVD-FVKKVSHKVNSADYQFTSFLFSVSLPPQLSVRERAAWLLVKQEMGKLGLSLAKDDIVQLKEAYKWIIHPQLSEELG-----------VPAHGKVLFE-----VSVVFAHPETDEECHFLATACPDCFK-----PAKNKQSVFTRMAVIKALEKIKEEDFLKHFPCPP------SSPKNLCVAVEIQCNNGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISEHLMAEFKADSFNFSSSGREDVDVRTLGNGRPFAIELVNPRR-IRFTAEEMKGLQQTINNSS-DKIQVRDLQLVTREAIGRMKEGEEEKTKTYSALIWTDKA----------------------------------IQKEDIAFLDDIKELKLEQKTPLRVLHRRPLAVRCRIIHTMQ--------------------------SQYIDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLLNRTADILELDVESVDVDWPP 529          
BLAST of Trna pseudouridine synthase pus10 vs. TrEMBL
Match: A0A091Q8C7 (Putative tRNA pseudouridine synthase Pus10 (Fragment) OS=Leptosomus discolor OX=188344 GN=N330_10430 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 6.198e-86
Identity = 171/508 (33.66%), Postives = 272/508 (53.54%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +C +C GILQ   +  + + ++   + +A++QF SF   VS P  L +RE A +L++K++      SL++D+I+ +K  +++++  RLS  +G   ++G                    V+V F H +++ EC  L    P+ FK      ++ K  +FT+ ++ + L+ I +E   + F  PP      +S + + + +++   +  V VAGRY K SR LPQ+PWI DG RKLESSVEELI+E L+SAF+++S  F SSGREDVDVR LG+GRPF +EL N R  +R   E M  L+Q IN S  D+I V  L+++++E +  +K+GE+EK K Y  ++W +                                     Q   +  ++  ++L + Q TP+RVLHRR L  R R  ++                            S+Y  ++ F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++ +  DIL LDV  ++++WPP
Sbjct:  112 VCNVCLGILQE-FSEADFVKKMCQKVKSADYQFTSFVFSVSLPPQLSVRERAAWLLVKQEMGNLGLSLAKDDIVQLKEAYKWIIHPRLSEELGVP-VDG---------------KSLFEVSVVFAHPETDKECHFLATACPDCFK-----PAKNKQSVFTRMAVIKALEKITEEDFLKHFPCPP------SSPKNLCVALEIQCNNGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISEHLMSAFKADSFNFSSSGREDVDVRTLGNGRPFAIELVNPRR-IRFTAEEMKGLQQTINNSS-DKIKVRDLQLVTREAIGRMKEGEEEKTKTYSALIWTDKA----------------------------------IQKEDIAFLDDIKELKLDQKTPLRVLHRRPLAVRCRIIHTMK--------------------------SEYIDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLLNRTADILELDVESVDVDWPP 529          
BLAST of Trna pseudouridine synthase pus10 vs. TrEMBL
Match: A0A1V4IG10 (Putative tRNA pseudouridine synthase Pus10 OS=Patagioenas fasciata monilis OX=372326 GN=PUS10 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 6.395e-86
Identity = 185/566 (32.69%), Postives = 292/566 (51.59%), Query Frame = 2
Query:   65 DNKEVNDVLCQWEI---CWRCRLRITDKIID----------FQKFNSKEELTENC---LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +N+E  D +C   +   C R RL  T++  D              N +   TEN    +C +C GILQ    +D  + ++   +++A++QF SF   VS P  L +RE A +L++K++      SL++D+I+ +K  +++++  +LS  +G             +    L E     V+V F H ++E EC  L    P+ FK      ++ K  +FT+ ++ + L+ I +E   + F  PP      +S + + + +++   +  V VAGRY K SR LPQ+PWI DG RKLESSVEELI+E L++ F+++S  F SSGREDVDVR LG+GRPF +EL N R  +    E M  L+Q IN S  D+I V  L+++++E +  +K+GE+EK K Y  ++W +                                     Q   +  ++  ++L + Q TP+RVLHRR L  R R  ++                            SQY  ++ F LHL+ QAG+Y+KEFVHGD GRT+PN+ +++ +  DIL LDV  ++++WPP
Sbjct:  117 NNQEKEDTVCLDVVDPPCKRIRLEHTEEGPDDLNHNGALRQIPSGNGENNATENSAVEVCNVCLGILQEFCEAD-FVKKVCQKVTSADYQFTSFVFSVSLPPQLSVRECAAWLLVKQEMGKLGLSLAKDDIVQLKEAYKWIIHPQLSEELG-----------VPADGKSLFE-----VSVIFAHPETEEECHFLATACPDCFK-----PAKNKQSVFTRMAVIKALEKIKEEDFLKHFPCPP------SSPKNLCVALEIQCNNGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISEHLIAEFKADSFNFSSSGREDVDVRTLGNGRPFAIELVNPRR-IHFTAEEMKGLQQTINNSS-DKIQVRDLQLVTREAIGRMKEGEEEKTKTYSALIWTDEA----------------------------------IQKEDIAFLDDIKELKLDQKTPLRVLHRRPLAVRSRIIHTMK--------------------------SQYIDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGSLLNRTADILELDVESVDVDWPP 592          
BLAST of Trna pseudouridine synthase pus10 vs. TrEMBL
Match: A0A452I2D2 (Pseudouridine synthase 10 OS=Gopherus agassizii OX=38772 GN=PUS10 PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 8.085e-86
Identity = 172/514 (33.46%), Postives = 274/514 (53.31%), Query Frame = 2
Query:  173 ELTENCLCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            E++   +C +C GILQ     D  + ++   +++AE+QF SF   VS P  L +RE A +L++KE+   +  SL++++I+ +K  +++++    S  +G             +    L E     V+V F H +++ +C  L  + P+ FK  +  +S     +FT+ ++ + L  I +E  ++ F  PP      +S + I   +++   +  + VAGRY K SR LPQ+PWI DG RKLESSVEELI+E L++AF+++S  F SSGREDVDVR LGSGRPF +EL N   +    +E M  L+Q+IN S  D+I V  L+++++E +  +K+GE+EK K Y  ++W +                                     Q   + L++  ++L + Q TP+RVLHRR L  R R  ++                            S+Y  D+ F LHL+ QAG+Y+KEFVHGD GRT+PN+  ++ +  DIL LDV  ++++WPP
Sbjct:  106 EISTPKVCNVCLGILQEFCEID-FVKKVCQKVNSAEYQFTSFVFSVSLPPQLSVREHAAWLLVKEEMRKQGLSLAKEDIVQLKETYKWIIHPLFSEELG-----------VPADGKSLFE-----VSVVFAHPETDEDCHFLATVCPDCFKPAKNKQS-----VFTRMAIIKALDKIKEEDFRKHFPCPP------SSPKNICAALEIQCTNGAIFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISEHLMTAFKADSFNFSSSGREDVDVRTLGSGRPFAIELVNPHRIHFTAME-MKELQQKINNSS-DKIKVQDLQLVTREAIGHMKEGEEEKTKTYSALIWTDKA----------------------------------IQKEDIALLDDMKELKIDQKTPLRVLHRRPLAVRSRVIHTMK--------------------------SEYIDDHHFRLHLKTQAGTYIKEFVHGDFGRTKPNIGFLLKRTADILELDVESVDVDWPP 529          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Cavefish
Match: pus10 (pseudouridine synthase 10 [Source:ZFIN;Acc:ZDB-GENE-080204-5])

HSP 1 Score: 214.927 bits (546), Expect = 2.302e-62
Identity = 166/501 (33.13%), Postives = 243/501 (48.50%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKF--DISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDV 1687
            +C  C G+LQ+     +   QL+    +   E+QF S  + VS P  L +RE + +L +K++   K   L +++++ +K  +++  +      +GKD   G  V          L N    V+V FTH +++ +C        + FK      ++ K  +FT+ ++ + L+ I+ +K    +  PP H     + R   L  D T Q   V +A RY K SR LPQ+PW+ DG R++E SVEELIA  L+S+FR++   F SSGREDVDVR LG+GRPF MEL N      +  E +  L++ IN S  D+I V  L+I++ E +  +K+GE+EK K Y  ++W +                                         L  I   + L V Q TP+RVLHRR L  R R  +S SAS LD                           + F L L  QAG Y+KEFVHGD GRT+PNL  ++  + DIL LDV
Sbjct:  105 ICVACLGVLQD-FCDQSYTTQLQVCDAVRKGEYQFDSLMLAVSLPAQLSVREHSCWLHVKKEAE-KSMCLDKEDLVQVKDAFKWATQ----GMVGKDL--GASV----------LTNSGFEVSVGFTHAETDGDCHFRATTCSDCFK-----PTKNKASVFTRMAVVKALEKISDQKFLN-YPCPPVH----PATRCTPL--DTTLQHASVFIA-RYNKFSRELPQTPWVIDGERRMEGSVEELIAGPLLSSFRAD-FNFSSSGREDVDVRTLGNGRPFAMELLNPHRARFNKAE-IRQLQETINTSS-DKIRVRDLQIVT-EAMGRMKEGEEEKTKTYSALIWTKK----------------------------------PLTHTDLDFIKNIK-LKVDQKTPLRVLHRRPLAVRQRVIHSMSASFLDT--------------------------HHFKLQLHTQAG-YIKEFVHGDFGRTKPNLCALMDSEVDILELDV 508          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Cavefish
Match: pus10 (pseudouridine synthase 10 [Source:ZFIN;Acc:ZDB-GENE-080204-5])

HSP 1 Score: 191.43 bits (485), Expect = 7.523e-54
Identity = 137/427 (32.08%), Postives = 204/427 (47.78%), Query Frame = 2
Query:  191 LCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLD 1471
            +C  C G+LQ+     +   Q+   +   E+QF S  + VS P  L +RE + +L +K++   K   L +++++ +K  +++  +      +GKD   G  V          L N    V+V FTH +++ +C  L     + FK  +                + V+  +    L   +  PP H     + R   L  D T Q   V +AGRY K SR LPQ+PW+ DG R++E SVEELIA  L+S+FR++   F SSGREDVDVR LG+GRPF MEL N      +  E +  L++ IN S  D+I V  L+I+++E +  +K+GE+EK K Y  ++W +                                         L  I   ++L V Q TP+RVLHRR L  R R  +S SAS LD
Sbjct:  105 ICVACLGVLQD-FCDQSYTTQVCDAVRKGEYQFDSLMLAVSLPAQLSVREHSCWLHVKKEAREKSMCLDKEDLVQVKDAFKWATQ----GMVGKDL--GASV----------LTNSGFEVSVGFTHAETDGDCHFLATTCSDCFKPTKN---------------KAVIFLVFGVLLSSNYPCPPVH----PATRCTPL--DTTLQHASVFIAGRYNKFSRELPQTPWVIDGERRMEGSVEELIAGPLLSSFRADGFNFSSSGREDVDVRTLGNGRPFAMELLNPHRARFNKAE-IRQLQETINTSS-DKIRVRDLQIVTREAMGRMKEGEEEKTKTYSALIWTKK----------------------------------PLTHTDLDFIKNIKELKVDQKTPLRVLHRRPLAVRQRVIHSMSASFLD 457          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005324.1 (pep scaffold:Pmarinus_7.0:GL481270:186998:195979:1 gene:ENSPMAG00000004811.1 transcript:ENSPMAT00000005324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 5.305e-51
Identity = 120/352 (34.09%), Postives = 189/352 (53.69%), Query Frame = 2
Query:  179 TENCLCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYE-SLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVP-PNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENG 1228
            T+  +C +C G++Q  L  D  I+++   + ++++QF S  +  S P  L +RE A +L +KE    K    +     + +K  ++++    +  A+ K +   ++ +S               V+++ TH +++ EC  L    P+ FK      S+ K  LF++ ++ + L+ I   + +R F  P P   R         +  D+     PV VAGRY K SR LPQ+PW+ DG RK+ESSVEELIA  LV AF +    F SSGREDVDVR LG GRPF +EL N R        ++  L+++IN S  D+I+V  L+I+S+E ++ +K+GE+EK K Y  +VW E  
Sbjct:   96 TKVSVCSVCLGVMQR-LCEDPFIEEMCNKVRSSDYQFSSMLVSASFPPQLAVREHAAWLAIKENERGKRNLQIGSGTGVLLKEAYKWV----VYPALAKRFRVPVEGKSP------------FEVSLNLTHKETDGECRFLASACPDCFK-----PSKNKQSLFSRAAVSKALEKIPDNQFRRNFPWPLPPPSR-------TCVCTDIACTHGPVFVAGRYNKYSRTLPQTPWVIDGERKMESSVEELIANILVLAFNASGFNFSSSGREDVDVRTLGKGRPFAVELINPRRAALSP-SQLRQLQKEINSS--DKIAVRDLQIVSREAMAHMKEGEEEKTKSYSALVWSEKA 415          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Nematostella
Match: EDO32870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU7])

HSP 1 Score: 179.874 bits (455), Expect = 1.341e-52
Identity = 111/300 (37.00%), Postives = 161/300 (53.67%), Query Frame = 2
Query:  815 VMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +++ GRY K SR LPQ+PW+ DG R  ESS+  LI +            F SSGRED+DVRMLG+GRPFV+E  N    + D  + +  +++QIN S ++ I+V+GL++I+K   S++K GE +K K Y  ++W +                                  +  Q+ L +L +  +DL ++Q TP+RVLHRR L  R R  ++ SA  +D                          D+ F L L+  AG+YVKEFVHGD GRT+PNL T++G + DIL LDV  +++EWPP
Sbjct:   22 LLIGGRYNKYSRCLPQTPWLIDGERLKESSITLLITDC----------RFSSSGREDIDVRMLGTGRPFVLEFVNPHRTLLDE-DFLSDMQKQINSSTKE-IAVSGLQVITKGEYSILKDGETKKTKCYSALIWTKE---------------------------------LVPQTELDKLAD-IKDLRIEQKTPLRVLHRRPLAVRVREVHTMSAQRID--------------------------DHHFKLFLKTMAGTYVKEFVHGDFGRTKPNLGTLLGVESDILELDVESVDVEWPP 249          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Nematostella
Match: EDO29263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T450])

HSP 1 Score: 53.5286 bits (127), Expect = 4.927e-8
Identity = 51/194 (26.29%), Postives = 91/194 (46.91%), Query Frame = 2
Query:   26 LINANMELETSNNDNKEVNDVLCQWEICWRCRLR-ITDKIIDFQKFNS-----------------KEELTEN----CLCYLCSGILQNGL---TSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESL-SRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLL 529
            L NA+   E  + + K + + L +  +C RC LR + +K     + N+                 KE+ TE+     +C  C GILQNG    T + I+D     + ++ ++F SF   +S P++    + +L L LKEKF   Y+++ + D++  IK V +++    + +A+G  + +    Q    S   LL
Sbjct:    5 LCNASKVKEDFSTNVKAIAESLYELNLCVRCILRFLKEKTPSAYEGNNSYIAKYIEEEYGLEYILKEQDTEHNNYDTICKGCLGILQNGCDTPTVNKIVDT----VQSSGYEFESFTFAISIPLSTMAYQHSLLLHLKEKFSKFYDAVRTADDLPSIKEVIKWVCGPAVGNALGVYFKHECVCQQIVCSHGSLL 194          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Medaka
Match: pus10 (pseudouridine synthase 10 [Source:NCBI gene;Acc:101174641])

HSP 1 Score: 266.929 bits (681), Expect = 8.461e-82
Identity = 176/552 (31.88%), Postives = 281/552 (50.91%), Query Frame = 2
Query:   59 NNDNKEVNDVLCQWEICWRCRLRITDKIIDFQKFNSKEELTENCLCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQIVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDRLSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLMELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHVRYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLESSVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNLVRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            +N++ +  +VL +   C R +L   D     +  + K  L E+ +C  C GILQ+ L   N   ++   +   +++F S  + +S P  L +RE + +L +K++   K   L +D++I +K  ++++M+  ++  +G     G+ V          +      V V FTH +++ +C  L ++ P+ FK      ++ K  +FT+ ++ + L+ I+ +K  + +  PP      A      +  DV      V +AGRY K  R LPQ+PW+ DG R++ESSVEELIA  +++AFR+    F SSGREDVDVR LG+GRPF MEL+N        +E M  L++ IN+S  D+I V  L+I+++E +  +K+GE+EK K Y  +VW +                                     Q   +  I+  +DL + Q TP+RVLHRRAL  R R  +S +A                          +Y  D+ F L L+ QAG+Y+KEFVHGD GRT+PNL  ++    DIL LDV  ++++WPP
Sbjct:   72 DNNSHDAAEVL-EGPPCKRVKLDPGDHADPSE--DEKSNLGESQVCVACLGILQD-LCGTNQAVKIADTVKAQKYEFDSLVLSISLPAQLCVREHSCWLHVKKEVREKGLVLDKDDVIQVKEAFKWIMQSLVAKELG-----GVAV----------VGKSGFEVGVEFTHPETDSDCHFLAKVCPDCFK-----PTKNKQSVFTRMAVVKALEKISDDKFLKQYPCPP------ARPACSCVPQDVQCLHVSVFIAGRYNKFCRSLPQTPWLIDGERRMESSVEELIAAPILTAFRAGGFNFSSSGREDVDVRTLGNGRPFAMELQNPHRSRLSKLE-MKELQETINKSS-DKIRVRDLQIVTREAMGRMKEGEEEKTKSYTALVWTQR----------------------------------PIQKEDIGFIDEIKDLTLGQKTPLRVLHRRALAVRQRVIHSMNA--------------------------RYVDDHHFYLRLKTQAGTYIKEFVHGDFGRTKPNLCELLKTDTDILELDVESVDVDWPP 531          
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Medaka
Match: pus10 (pseudouridine synthase 10 [Source:NCBI gene;Acc:101174641])

HSP 1 Score: 111.694 bits (278), Expect = 1.992e-28
Identity = 65/201 (32.34%), Postives = 95/201 (47.26%), Query Frame = 2
Query: 1112 DRISVNGLRIISKEFVSLIKQGEQEKCKQYRMVVWCENGGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSALLQLINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRSDPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATIIGQQCDILALDVMEIELEWPP 1714
            D+I V  L+I+++E +  +K+GE+EK K Y  +VW +                                     Q   +  I+  +DL + Q TP+RVLHRRAL  R R  +S +A                          +Y  D+ F L L+ QAG+Y+KEFVHGD GRT+PNL  ++    DIL LDV  ++++WPP
Sbjct:    8 DKIRVRDLQIVTREAMGRMKEGEEEKTKSYTALVWTQRP----------------------------------IQKEDIGFIDEIKDLTLGQKTPLRVLHRRALAVRQRVIHSMNA--------------------------RYVDDHHFYLRLKTQAGTYIKEFVHGDFGRTKPNLCELLKTDTDILELDVESVDVDWPP 148          
The following BLAST results are available for this feature:
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PUS107.566e-8333.07pseudouridine synthase 10 [Source:HGNC Symbol;Acc:... [more]
PUS107.566e-8333.07pseudouridine synthase 10 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y48C3A.204.275e-4830.26pep chromosome:WBcel235:II:13369607:13375290:1 gen... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG37094.095e-5429.26gene:FBgn0031227 transcript:FBtr0078147[more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pus101.826e-8332.48pseudouridine synthase 10 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bin31.623e-8734.65bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-... [more]
bin34.924e-6833.07bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-... [more]
bin31.393e-6532.26bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-... [more]
bin33.263e-6431.54bridging integrator 3 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pus106.783e-8233.46pseudouridylate synthase 10 [Source:MGI Symbol;Acc... [more]
Pus106.783e-8233.46pseudouridylate synthase 10 [Source:MGI Symbol;Acc... [more]
Pus106.783e-8233.46pseudouridylate synthase 10 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3MIT2|PUS10_HUMAN3.634e-8233.07tRNA pseudouridine synthase Pus10 OS=Homo sapiens ... [more]
sp|Q9D3U0|PUS10_MOUSE4.745e-8133.46tRNA pseudouridine synthase Pus10 OS=Mus musculus ... [more]
sp|Q6ING2|PUS10_XENLA6.154e-7934.65tRNA pseudouridine synthase Pus10 OS=Xenopus laevi... [more]
sp|Q9VPK7|PUS10_DROME4.105e-5329.26Putative tRNA pseudouridine synthase Pus10 OS=Dros... [more]
sp|Q8TUV7|PUS10_METKA2.155e-2832.03tRNA pseudouridine synthase Pus10 OS=Methanopyrus ... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091JB413.609e-8632.28Putative tRNA pseudouridine synthase Pus10 (Fragme... [more]
A0A093D5464.274e-8633.86Putative tRNA pseudouridine synthase Pus10 (Fragme... [more]
A0A091Q8C76.198e-8633.66Putative tRNA pseudouridine synthase Pus10 (Fragme... [more]
A0A1V4IG106.395e-8632.69Putative tRNA pseudouridine synthase Pus10 OS=Pata... [more]
A0A452I2D28.085e-8633.46Pseudouridine synthase 10 OS=Gopherus agassizii OX... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pus102.302e-6233.13pseudouridine synthase 10 [Source:ZFIN;Acc:ZDB-GEN... [more]
pus107.523e-5432.08pseudouridine synthase 10 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005324.15.305e-5134.09pep scaffold:Pmarinus_7.0:GL481270:186998:195979:1... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO328701.341e-5237.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292634.927e-826.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pus108.461e-8231.88pseudouridine synthase 10 [Source:NCBI gene;Acc:10... [more]
pus101.992e-2832.34pseudouridine synthase 10 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Trna pseudouridine synthase pus10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027394 ID=SMED30027394|Name=Trna pseudouridine synthase pus10|organism=Schmidtea mediterranea sexual|type=transcript|length=1747bp
AAATTTTTTCATTAAGTATTTAAGTTTAATTAACGCAAACATGGAACTGG
AGACATCGAATAATGATAATAAAGAAGTTAATGATGTATTATGCCAATGG
GAAATTTGTTGGCGGTGTAGACTTAGAATCACTGATAAAATTATTGATTT
TCAAAAATTCAATAGTAAAGAAGAATTAACTGAAAATTGTCTCTGTTATT
TATGCTCAGGAATATTACAAAATGGTTTAACAAGTGATAATATTATAGAT
CAATTAAAATTTGATATATCAAATGCTGAATTTCAATTTCTTTCCTTTCA
AATTGTTGTAAGCACACCGATAAATTTATTTATTAGGGAATTTGCACTTT
TTCTAATTCTAAAAGAAAAGTTTCCTTTAAAATATGAAAGCCTTTCTAGA
GATGAAATAATTCCAATCAAATCTGTTTGGCGTTATTTAATGAAAGATCG
ATTGTCGAGCGCCATTGGAAAGGATTATATGAACGGACTCCAAGTACAAT
CTGCACGATCATCAAAGGATTGCTTATTGGAAAATGATTTCCTCATAGTA
AATGTGTCATTTACTCACTGCAAAAGCGAATTGGAATGTAGCGTTTTAAT
GGAATTGGAACCGGAATCCTTCAAAAGAAGGCGAAAAGGAGAATCGAGAT
ATAAATGGGATTTATTTACGAAGAAATCGCTGGAACAAGTTTTGAAAAAT
ATAAACAAAGAAAAATTACAAAGATGTTTTTCTGTGCCGCCGAATCACGT
TCGATACGGAGCTAGTGAGCGTTTGATTTCATTGGGTGTCGACGTGACAC
GGCAGGATTACCCGGTAATGGTTGCCGGCAGGTACTGCAAGCTCAGCCGC
CGACTGCCGCAGTCGCCATGGATATTCGATGGAGTGAGGAAGCTGGAGTC
GTCGGTGGAGGAGCTGATTGCTGAGCAATTGGTTTCGGCGTTCCGATCGG
AATCTCACGGGTTTATTTCCTCTGGTCGCGAGGATGTCGATGTGAGAATG
CTGGGATCTGGGCGGCCGTTTGTCATGGAGTTGCGCAACTGCAGGAATCT
CGTCCGTGACGTCATCGAGCGGATGGGAACGCTGGAGCAGCAGATCAACC
GATCCGGCCAGGACAGGATCAGCGTCAACGGATTGAGAATCATTTCCAAG
GAATTTGTCAGCCTGATAAAGCAAGGCGAGCAGGAGAAATGCAAGCAGTA
CCGAATGGTGGTCTGGTGCGAGAACGGGGGCATCACTGCCGGTGGTTCCG
GCGGTGCCGCTCATGCTGTCGGTGGTGCCAGCGGTGTCGGCGGTGCCGCT
CATGCTGTCAGTGGTGCCGATGCCGTCGGCAGCCAATCAGCACTGCTCCA
GCTGATTAACGGCACGCGCGATCTCCTCGTCCAGCAGCTCACTCCGATCC
GAGTGCTTCACCGCCGGGCATTGATTGATCGCCCGCGCACATTTTACTCC
TTTTCCGCCAGTCCGCTCGATCAGGCGCTGTCAGCTGATCGGATCAGATC
GGATCCAACGCTGAATGATTACAGTCGGTTCCTCAGTCAGTACGAGCCGG
ACAATTTATTCCTTCTCCATCTCCGTTGCCAGGCCGGTAGCTATGTCAAG
GAGTTTGTGCACGGAGATCTCGGCAGGACTCGTCCGAATTTAGCAACGAT
AATTGGACAGCAGTGCGATATTCTCGCTCTGGATGTCATGGAAATCGAGC
TGGAATGGCCACCGAAATAATTATATATGAATAAATGGAGAGATCGG
back to top

protein sequence of SMED30027394-orf-1

>SMED30027394-orf-1 ID=SMED30027394-orf-1|Name=SMED30027394-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
NFFIKYLSLINANMELETSNNDNKEVNDVLCQWEICWRCRLRITDKIIDF
QKFNSKEELTENCLCYLCSGILQNGLTSDNIIDQLKFDISNAEFQFLSFQ
IVVSTPINLFIREFALFLILKEKFPLKYESLSRDEIIPIKSVWRYLMKDR
LSSAIGKDYMNGLQVQSARSSKDCLLENDFLIVNVSFTHCKSELECSVLM
ELEPESFKRRRKGESRYKWDLFTKKSLEQVLKNINKEKLQRCFSVPPNHV
RYGASERLISLGVDVTRQDYPVMVAGRYCKLSRRLPQSPWIFDGVRKLES
SVEELIAEQLVSAFRSESHGFISSGREDVDVRMLGSGRPFVMELRNCRNL
VRDVIERMGTLEQQINRSGQDRISVNGLRIISKEFVSLIKQGEQEKCKQY
RMVVWCENGGITAGGSGGAAHAVGGASGVGGAAHAVSGADAVGSQSALLQ
LINGTRDLLVQQLTPIRVLHRRALIDRPRTFYSFSASPLDQALSADRIRS
DPTLNDYSRFLSQYEPDNLFLLHLRCQAGSYVKEFVHGDLGRTRPNLATI
IGQQCDILALDVMEIELEWPPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039894Pus10-like
IPR020103PsdUridine_synth_cat_dom_sf
Vocabulary: biological process
TermDefinition
GO:0001522pseudouridine synthesis
GO:0009451RNA modification
Vocabulary: molecular function
TermDefinition
GO:0009982pseudouridine synthase activity
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.70.3190coord: 447..578
e-value: 4.2E-28
score: 99.1
NoneNo IPR availableGENE3DG3DSA:3.30.70.2510coord: 271..397
e-value: 4.0E-41
score: 142.1
IPR039894tRNA pseudouridine synthase Pus10-likePANTHERPTHR21568UNCHARACTERIZEDcoord: 55..581
IPR020103Pseudouridine synthase, catalytic domain superfamilySUPERFAMILYSSF55120Pseudouridine synthasecoord: 471..575