SID1 transmembrane family member 1

Overview
NameSID1 transmembrane family member 1
Smed IDSMED30027386
Length (bp)1842
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SID1 transmembrane family member 1 (SMED30027386) t-SNE clustered cells

Violin plots show distribution of expression levels for SID1 transmembrane family member 1 (SMED30027386) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SID1 transmembrane family member 1 (SMED30027386) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SID1 transmembrane family member 1 (SMED30027386) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027386

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30027386SMESG000041572.1 dd_Smed_v4_8231_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30027386SMESG000041572.1 dd_Smed_v4_8231_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027386SMESG000041572.1 dd_Smed_v6_8231_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30027386SMESG000041572.1 dd_Smed_v6_8231_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 105.916 bits (263), Expect = 9.426e-39
Identity = 56/139 (40.29%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY    KL
Sbjct:  543 QREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL 681          

HSP 2 Score: 58.151 bits (139), Expect = 9.426e-39
Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 1797
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +FL
Sbjct:  796 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFL 833          

HSP 3 Score: 37.7354 bits (86), Expect = 9.426e-39
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   +IN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  704 PLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 792          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 105.916 bits (263), Expect = 9.426e-39
Identity = 56/139 (40.29%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY    KL
Sbjct:  543 QREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL 681          

HSP 2 Score: 58.151 bits (139), Expect = 9.426e-39
Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 1797
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +FL
Sbjct:  796 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFL 833          

HSP 3 Score: 37.7354 bits (86), Expect = 9.426e-39
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   +IN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  704 PLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 792          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 105.916 bits (263), Expect = 3.119e-38
Identity = 56/139 (40.29%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY    KL
Sbjct:  519 QREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL 657          

HSP 2 Score: 56.225 bits (134), Expect = 3.119e-38
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  772 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 808          

HSP 3 Score: 37.7354 bits (86), Expect = 3.119e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   +IN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  680 PLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 768          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 105.916 bits (263), Expect = 3.196e-38
Identity = 56/139 (40.29%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY    KL
Sbjct:  522 QREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL 660          

HSP 2 Score: 56.6102 bits (135), Expect = 3.196e-38
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  775 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 37.7354 bits (86), Expect = 3.196e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   +IN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  683 PLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 771          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 105.916 bits (263), Expect = 3.196e-38
Identity = 56/139 (40.29%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY    KL
Sbjct:  522 QREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL 660          

HSP 2 Score: 56.6102 bits (135), Expect = 3.196e-38
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  775 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 37.7354 bits (86), Expect = 3.196e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   +IN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  683 PLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 771          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: chup-1 (CHolesterol UPtake associated [Source:UniProtKB/TrEMBL;Acc:H2L0H7])

HSP 1 Score: 81.2629 bits (199), Expect = 8.462e-16
Identity = 44/141 (31.21%), Postives = 78/141 (55.32%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYSINLKLILCCQNKCIWL*NQKNGKLSFQL 1418
            YGLP++ GL  A+G +++MEGI SA YHVCPN  +  FD +  Y++  +  ++I+  RH D+  SA+  +  L +F+   +   +   +IFW+LF+++Y+    ++  + Y+            K IW  N +  + S +L
Sbjct:  466 YGLPQHSGLMTAIGLAVIMEGISSATYHVCPNNINYQFDTALMYVIGMLGKLKIWSLRHPDMVVSAYHAFGFLGVFLMAAIAGVYVHNMIFWALFSIIYIASMLLVSLEFYF------------KGIWTLNLRELRNSIRL 594          

HSP 2 Score: 54.299 bits (129), Expect = 2.586e-13
Identity = 25/47 (53.19%), Postives = 33/47 (70.21%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 1824
            K PA+SRE NK CIFL+FYD HD+ H   + AIFF+F  +  +D+ L
Sbjct:  699 KMPAISRELNKPCIFLNFYDNHDLWHLSSAFAIFFSFTAINVIDDDL 745          

HSP 3 Score: 40.0466 bits (92), Expect = 2.586e-13
Identity = 32/100 (32.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query: 1382 IKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN 1681
            + S+     +P YK R  +++   I N  + +YG+   P++F  F L     NL IY  YYI+MK  Y+E   K AI      +  W  A   F Q  S+
Sbjct:  597 VSSRHLSCVVPAYKARFFVILLLNIANTAVVVYGLEAHPKDFLSFLLIPFIGNLFIYIIYYILMKMIYREKIPKRAIALLFAAVISWTCAGILFNQRVSD 696          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: chup-1 (CHolesterol UPtake associated [Source:UniProtKB/TrEMBL;Acc:H2L0H7])

HSP 1 Score: 52.373 bits (124), Expect = 7.611e-7
Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQS 1118
            YGLP++ GL  A+G +++MEGI SA YHVCPN  +  F+ +
Sbjct:  466 YGLPQHSGLMTAIGLAVIMEGISSATYHVCPNNINYQFENA 506          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: chup-1 (CHolesterol UPtake associated [Source:UniProtKB/TrEMBL;Acc:H2L0H7])

HSP 1 Score: 51.9878 bits (123), Expect = 1.127e-6
Identity = 20/33 (60.61%), Postives = 26/33 (78.79%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQ 1094
            YGLP++ GL  A+G +++MEGI SA YHVCPN 
Sbjct:  466 YGLPQHSGLMTAIGLAVIMEGISSATYHVCPNN 498          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Zebrafish
Match: sidt2 (SID1 transmembrane family, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7356])

HSP 1 Score: 107.457 bits (267), Expect = 6.778e-41
Identity = 55/133 (41.35%), Postives = 84/133 (63.16%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
             R   +N  L   + +    G+PK+FGLYYAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +  + FW +F+V+++  T +L   +YY
Sbjct:  535 QRDILHNRALERNDNTALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAAVIFFSVLGVVFGKGNMAFWIVFSVIHILATMLLSTQLYY 667          

HSP 2 Score: 62.7734 bits (151), Expect = 6.778e-41
Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLEN 1830
            KTPA SRE N++CI L F+D HDI HFL SIA+F +FL L  MD+ L++
Sbjct:  788 KTPAESREHNRECILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDS 836          

HSP 3 Score: 38.5058 bits (88), Expect = 6.778e-41
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S
Sbjct:  696 PMYIDRMVLLVMGNIVNWSLAAYGLINRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIQCLALVCVLFTAVVWGFALFFFFQGLS 784          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 109.383 bits (272), Expect = 1.507e-38
Identity = 57/133 (42.86%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H H R N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY
Sbjct:  505 HNHNRMN-----IRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYY 632          

HSP 2 Score: 54.299 bits (129), Expect = 1.507e-38
Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 1797
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  753 KTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 790          

HSP 3 Score: 37.3502 bits (85), Expect = 1.507e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S
Sbjct:  661 PMYVDRMVLLVMGNIVNWSLAAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLS 749          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 109.383 bits (272), Expect = 1.663e-38
Identity = 57/133 (42.86%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H H R N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY
Sbjct:  493 HNHNRMN-----IRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYY 620          

HSP 2 Score: 54.299 bits (129), Expect = 1.663e-38
Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 1797
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  741 KTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 778          

HSP 3 Score: 37.7354 bits (86), Expect = 1.663e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S
Sbjct:  649 PMYVDRMVLLVMGNIVNWSLAAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLS 737          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 109.768 bits (273), Expect = 1.910e-38
Identity = 57/133 (42.86%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H H R N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY
Sbjct:  522 HNHNRMN-----IRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYY 649          

HSP 2 Score: 54.299 bits (129), Expect = 1.910e-38
Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 1797
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  770 KTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 807          

HSP 3 Score: 37.3502 bits (85), Expect = 1.910e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S
Sbjct:  678 PMYVDRMVLLVMGNIVNWSLAAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLS 766          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 109.383 bits (272), Expect = 2.126e-38
Identity = 57/133 (42.86%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H H R N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY
Sbjct:  497 HNHNRMN-----IRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYY 624          

HSP 2 Score: 53.9138 bits (128), Expect = 2.126e-38
Identity = 25/38 (65.79%), Postives = 29/38 (76.32%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 1797
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  745 KTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 782          

HSP 3 Score: 37.7354 bits (86), Expect = 2.126e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S
Sbjct:  653 PMYVDRMVLLVMGNIVNWSLAAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLS 741          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 109.383 bits (272), Expect = 3.782e-38
Identity = 57/133 (42.86%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H H R N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY
Sbjct:  407 HNHNRMN-----IRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYY 534          

HSP 2 Score: 52.7582 bits (125), Expect = 3.782e-38
Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLT 1800
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL 
Sbjct:  655 KTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFLV 693          

HSP 3 Score: 37.7354 bits (86), Expect = 3.782e-38
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S
Sbjct:  563 PMYVDRMVLLVMGNIVNWSLAAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLS 651          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt2 (SID1 transmembrane family, member 2 [Source:MGI Symbol;Acc:MGI:2446134])

HSP 1 Score: 105.916 bits (263), Expect = 9.319e-39
Identity = 57/139 (41.01%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY    KL
Sbjct:  543 QREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKL 681          

HSP 2 Score: 56.6102 bits (135), Expect = 9.319e-39
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  796 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 832          

HSP 3 Score: 39.2762 bits (90), Expect = 9.319e-39
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   IIN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  704 PLYTDRMVLLVMGNIINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 792          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt2 (SID1 transmembrane family, member 2 [Source:MGI Symbol;Acc:MGI:2446134])

HSP 1 Score: 105.916 bits (263), Expect = 9.874e-39
Identity = 57/139 (41.01%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY    KL
Sbjct:  522 QREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKL 660          

HSP 2 Score: 56.6102 bits (135), Expect = 9.874e-39
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  775 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 39.2762 bits (90), Expect = 9.874e-39
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   IIN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  683 PLYTDRMVLLVMGNIINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 771          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt1 (SID1 transmembrane family, member 1 [Source:MGI Symbol;Acc:MGI:2443155])

HSP 1 Score: 106.301 bits (264), Expect = 2.442e-24
Identity = 59/152 (38.82%), Postives = 92/152 (60.53%), Query Frame = 3
Query:  906 LVIFGF*LCYVHRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYSINLKLIL 1355
            L+ F F L  + R   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN S+  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY    K+ L
Sbjct:  506 LLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDL 657          

HSP 2 Score: 26.1794 bits (56), Expect = 2.442e-24
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN*KLQQYLENKTKN 1720
            P Y  RMV+++   ++N + + +G++ +P +F  + L     NLL+Y  +YI+MK    E      +F    T   WA A+Y F Q  S+ +     E++ KN
Sbjct:  678 PLYMDRMVLLIVGNLVNWSFAFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWE-GTPAESREKN 779          

HSP 3 Score: 55.0694 bits (131), Expect = 2.616e-7
Identity = 22/36 (61.11%), Postives = 30/36 (83.33%), Query Frame = 1
Query: 1687 TPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            TPA SRE+N++C+ LDF+D HDI HFL + A+FF+F
Sbjct:  771 TPAESREKNRECVLLDFFDDHDIWHFLSATALFFSF 806          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt1 (SID1 transmembrane family, member 1 [Source:MGI Symbol;Acc:MGI:2443155])

HSP 1 Score: 105.916 bits (263), Expect = 3.284e-24
Identity = 57/144 (39.58%), Postives = 89/144 (61.81%), Query Frame = 3
Query:  906 LVIFGF*LCYVHRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYY 1331
            L+ F F L  + R   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN S+  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY
Sbjct:  506 LLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYY 649          

HSP 2 Score: 26.1794 bits (56), Expect = 3.284e-24
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN*KLQQYLENKTKN 1720
            P Y  RMV+++   ++N + + +G++ +P +F  + L     NLL+Y  +YI+MK    E      +F    T   WA A+Y F Q  S+ +     E++ KN
Sbjct:  683 PLYMDRMVLLIVGNLVNWSFAFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWE-GTPAESREKN 784          

HSP 3 Score: 55.0694 bits (131), Expect = 2.533e-7
Identity = 22/36 (61.11%), Postives = 30/36 (83.33%), Query Frame = 1
Query: 1687 TPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            TPA SRE+N++C+ LDF+D HDI HFL + A+FF+F
Sbjct:  776 TPAESREKNRECVLLDFFDDHDIWHFLSATALFFSF 811          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt2 (SID1 transmembrane family, member 2 [Source:MGI Symbol;Acc:MGI:2446134])

HSP 1 Score: 50.8322 bits (120), Expect = 7.663e-8
Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 1
Query: 1693 AVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTL 1803
            A SRE N+ CI LDF+D HDI HFL SIA+F +FL L
Sbjct:   36 AESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFLVL 72          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q8CIF6|SIDT2_MOUSE (SID1 transmembrane family member 2 OS=Mus musculus OX=10090 GN=Sidt2 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.982e-38
Identity = 57/139 (41.01%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY    KL
Sbjct:  522 QREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKL 660          

HSP 2 Score: 56.6102 bits (135), Expect = 5.982e-38
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  775 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 39.2762 bits (90), Expect = 5.982e-38
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   IIN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  683 PLYTDRMVLLVMGNIINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 771          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|D3ZEH5|SIDT2_RAT (SID1 transmembrane family member 2 OS=Rattus norvegicus OX=10116 GN=Sidt2 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 6.440e-38
Identity = 57/139 (41.01%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY    KL
Sbjct:  522 QREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKL 660          

HSP 2 Score: 56.6102 bits (135), Expect = 6.440e-38
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  775 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 39.2762 bits (90), Expect = 6.440e-38
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   IIN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  683 PLYTDRMVLLVMGNIINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 771          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q8NBJ9|SIDT2_HUMAN (SID1 transmembrane family member 2 OS=Homo sapiens OX=9606 GN=SIDT2 PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 1.402e-37
Identity = 56/139 (40.29%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
             R   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY    KL
Sbjct:  522 QREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKL 660          

HSP 2 Score: 56.6102 bits (135), Expect = 1.402e-37
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  775 KTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 37.7354 bits (86), Expect = 1.402e-37
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   +IN +++ YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S
Sbjct:  683 PLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLS 771          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q6Q3F5|SIDT1_RAT (SID1 transmembrane family member 1 OS=Rattus norvegicus OX=10116 GN=Sidt1 PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 7.352e-24
Identity = 58/150 (38.67%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  906 LVIFGF*LCYVHRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYSINLKL 1349
            L+ F F L  + R   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN S+  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY    K+
Sbjct:  505 LLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHVLASLALSTQIYYMGRFKI 654          

HSP 2 Score: 27.7202 bits (60), Expect = 7.352e-24
Identity = 31/103 (30.10%), Postives = 55/103 (53.40%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN*KLQQYLENKTKN 1720
            P Y  RMV+++   ++N + +++G++ +P +F  + L     NLL+Y  +YI+MK    E      +F  + T   WA A+Y F Q  S+ +     E++ KN
Sbjct:  682 PLYMDRMVLLIVGNLVNWSFALFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIVATAVVWAAALYFFFQNLSSWE-GTPAESREKN 783          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q6AXF6|SIDT1_MOUSE (SID1 transmembrane family member 1 OS=Mus musculus OX=10090 GN=Sidt1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.479e-23
Identity = 59/152 (38.82%), Postives = 92/152 (60.53%), Query Frame = 3
Query:  906 LVIFGF*LCYVHRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYSINLKLIL 1355
            L+ F F L  + R   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN S+  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY    K+ L
Sbjct:  506 LLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDL 657          

HSP 2 Score: 26.1794 bits (56), Expect = 1.479e-23
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN*KLQQYLENKTKN 1720
            P Y  RMV+++   ++N + + +G++ +P +F  + L     NLL+Y  +YI+MK    E      +F    T   WA A+Y F Q  S+ +     E++ KN
Sbjct:  678 PLYMDRMVLLIVGNLVNWSFAFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWE-GTPAESREKN 779          

HSP 3 Score: 55.0694 bits (131), Expect = 1.830e-6
Identity = 22/36 (61.11%), Postives = 30/36 (83.33%), Query Frame = 1
Query: 1687 TPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            TPA SRE+N++C+ LDF+D HDI HFL + A+FF+F
Sbjct:  771 TPAESREKNRECVLLDFFDDHDIWHFLSATALFFSF 806          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A564ZEB0 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14818 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.891e-46
Identity = 54/131 (41.22%), Postives = 85/131 (64.89%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H+  + N   +E  +    +G+P+++GL+YAMG +L MEG++SA YH+CP+ S+  FD +Y YIL  I+M++IYQ RH DI ASAH  Y+ +A+ I  GV    +    FW +FT++++  +  L  +IYY
Sbjct:  817 HKDHQSNDESDEDYLRNRAFGIPQHYGLFYAMGLALTMEGLLSACYHICPSFSNFQFDTAYMYILALILMLKIYQTRHPDINASAHSAYMVMAVVILAGVTGVLYGGETFWVVFTIVFLTMSIWLTAEIYY 947          

HSP 2 Score: 62.003 bits (149), Expect = 1.891e-46
Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 1
Query: 1687 TPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 1842
            TPA SR  N+ CIFL FYD+HD+ HFL S ++FF+F+++  +D+ L N   N
Sbjct: 1068 TPAQSRALNQPCIFLGFYDVHDVWHFLSSTSMFFSFMSIMTLDDDLINTPRN 1119          

HSP 3 Score: 61.6178 bits (148), Expect = 1.891e-46
Identity = 35/114 (30.70%), Postives = 67/114 (58.77%), Query Frame = 2
Query: 1337 QFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            Q+  +I LP+++Y +++S       P Y  RM++++ A  +N  I+ +G+  +P +F  F L+   +NLL+Y+ +Y++MK  Y+E F+   + Y  +    W  A+Y FIQ ++
Sbjct:  950 QWNFDICLPRRLYHLMRSDGIHCLTPMYMERMLLLLVANCVNIGIAAFGLFTRPRDFASFLLSIFMINLLMYYCFYVIMKCRYRERFHCIPLLYIFLACITWGFAIYFFIQHST 1063          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A564ZF36 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14818 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.938e-46
Identity = 54/131 (41.22%), Postives = 85/131 (64.89%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            H+  + N   +E  +    +G+P+++GL+YAMG +L MEG++SA YH+CP+ S+  FD +Y YIL  I+M++IYQ RH DI ASAH  Y+ +A+ I  GV    +    FW +FT++++  +  L  +IYY
Sbjct:  811 HKDHQSNDESDEDYLRNRAFGIPQHYGLFYAMGLALTMEGLLSACYHICPSFSNFQFDTAYMYILALILMLKIYQTRHPDINASAHSAYMVMAVVILAGVTGVLYGGETFWVVFTIVFLTMSIWLTAEIYY 941          

HSP 2 Score: 61.6178 bits (148), Expect = 1.938e-46
Identity = 35/114 (30.70%), Postives = 67/114 (58.77%), Query Frame = 2
Query: 1337 QFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            Q+  +I LP+++Y +++S       P Y  RM++++ A  +N  I+ +G+  +P +F  F L+   +NLL+Y+ +Y++MK  Y+E F+   + Y  +    W  A+Y FIQ ++
Sbjct:  944 QWNFDICLPRRLYHLMRSDGIHCLTPMYMERMLLLLVANCVNIGIAAFGLFTRPRDFASFLLSIFMINLLMYYCFYVIMKCRYRERFHCIPLLYIFLACITWGFAIYFFIQHST 1057          

HSP 3 Score: 61.6178 bits (148), Expect = 1.938e-46
Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 1
Query: 1687 TPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 1842
            TPA SR  N+ CIFL FYD+HD+ HFL S ++FF+F+++  +D+ L N   N
Sbjct: 1062 TPAQSRALNQPCIFLGFYDVHDVWHFLSSTSMFFSFMSIMTLDDDLINTPRN 1113          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A074ZSI4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_14015 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 6.907e-46
Identity = 54/111 (48.65%), Postives = 79/111 (71.17%), Query Frame = 3
Query:  999 GLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            GLP+++GLYYAMG +L MEGIMSA YH+CP+ S+  FD +Y YIL  +++++IYQ RH D+ ASAH  Y+ +A+ IF+GV    +    FW  FT+L++  + +L  +IYY
Sbjct:  901 GLPQHYGLYYAMGLALTMEGIMSACYHMCPSFSNFQFDTAYMYILAMLIILKIYQTRHPDVNASAHSAYMVMAVVIFLGVTGVVYGSQTFWIAFTILFLLMSVVLTGEIYY 1011          

HSP 2 Score: 63.1586 bits (152), Expect = 6.907e-46
Identity = 34/109 (31.19%), Postives = 65/109 (59.63%), Query Frame = 2
Query: 1337 QFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCF 1663
            Q+ I+  LP++++ +IKS   ++  P Y  RM++++ A ++N  ++ YG+  +P +F  F L+   +N+++Y  +YI MK  +KE      I Y +  + CW+ A+Y F
Sbjct: 1014 QWNIDYCLPRRLFSMIKSDGIRSLRPMYLERMILLLVANLVNFALAGYGVATRPRDFSSFLLSVFMINMMVYTLFYIFMKIRHKERILLAPILYMVAGLVCWSAAIYFF 1122          

HSP 3 Score: 57.7658 bits (138), Expect = 6.907e-46
Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 1
Query: 1687 TPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 1824
            TPA SR  N  C+  DFYD HDI HFL + ++FF+F+ L N+D+ L
Sbjct: 1132 TPAQSRALNHPCLLFDFYDAHDIWHFLSASSMFFSFMMLMNLDDDL 1177          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A0R3X3R6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7988 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 7.478e-45
Identity = 53/112 (47.32%), Postives = 78/112 (69.64%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            YG+P+++GL+YAMG +L MEG++SA YH+CP+ S+  FD +Y YIL  I+M++IYQ RH DI ASAH  Y+ +A+ I  GV    +    FW LFT++++  +  L  +IYY
Sbjct:  609 YGIPQHYGLFYAMGLALTMEGLLSACYHICPSFSNFQFDTAYMYILALILMLKIYQTRHPDINASAHSAYMVMAVVILAGVTGVLYGGETFWVLFTIVFLTMSVWLTAEIYY 720          

HSP 2 Score: 64.3142 bits (155), Expect = 7.478e-45
Identity = 31/69 (44.93%), Postives = 46/69 (66.67%), Query Frame = 1
Query: 1642 GSGC--LLLHPADFKLKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 1842
            GSG    L H   +++ TPA SR  N+ CIFL FYD+HD+ HFL S+++FF+F+++  +D+ L N   N
Sbjct:  825 GSGIYFFLQHSTTWEV-TPAQSRALNQPCIFLGFYDVHDVWHFLSSVSMFFSFMSIMTLDDDLINTPRN 892          

HSP 3 Score: 54.6842 bits (130), Expect = 7.478e-45
Identity = 33/111 (29.73%), Postives = 66/111 (59.46%), Query Frame = 2
Query: 1337 QFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQ 1669
            Q+  +I LP+++Y +++S       P Y  RMV+++ A  +N  I+++G+  +P +F  F L+   +NLL+Y+ +Y++MK  ++E F+   + Y ++    W   +Y F+Q
Sbjct:  723 QWNFDICLPRRLYNLMRSDGINCLTPMYMERMVLLLVANCVNIGIAVFGLFTRPRDFSSFLLSIFLINLLMYYFFYVIMKCRFRERFHCIPVLYILLACIAWGSGIYFFLQ 833          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A1I8IS62 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.703e-44
Identity = 51/111 (45.95%), Postives = 79/111 (71.17%), Query Frame = 3
Query:  999 GLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            G+P++FG++YAMG +L+MEGIMS  YHVCP+ S+  FD +Y Y+L  + M++IYQ RH DI ASAH+  +++AI IF+ V+   +  + FW+ FTV ++  +  L  ++YY
Sbjct:  537 GIPQHFGIFYAMGIALIMEGIMSGCYHVCPSYSNFQFDTAYMYVLAVLCMLKIYQTRHPDINASAHVACMAMAIVIFVSVVGVVYGTVFFWAAFTVFFILSSLFLTGEVYY 647          

HSP 2 Score: 63.929 bits (154), Expect = 1.703e-44
Identity = 43/115 (37.39%), Postives = 68/115 (59.13%), Query Frame = 2
Query: 1337 QFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN 1681
             +K+N+ L ++ YL+I S+  + F P YK RMVI+V A +IN TI+I+G + +P++F  F L    +NLL+Y  +Y+VMK    E        + + +   WA  +Y F+Q  SN
Sbjct:  650 HWKVNVGLFRRFYLLISSQGIRCFKPMYKDRMVILVTANLINWTIAIFGAVRQPQDFNSFLLYIFLVNLLMYIAFYVVMKVRSGEKIRLLTTLFVVASCITWAAGLYFFMQRPSN 764          

HSP 3 Score: 63.5438 bits (153), Expect = 1.703e-44
Identity = 26/47 (55.32%), Postives = 37/47 (78.72%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 1824
            K+PA SR  N++C+ LDFYDIHDI HFL S+++FF+F+ L  +D+ L
Sbjct:  767 KSPADSRALNQRCLLLDFYDIHDIWHFLSSMSLFFSFMVLLTLDDDL 813          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 104.76 bits (260), Expect = 3.795e-40
Identity = 54/133 (40.60%), Postives = 84/133 (63.16%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
             R   +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY
Sbjct:  456 QRDIIHNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYY 588          

HSP 2 Score: 61.2326 bits (147), Expect = 3.795e-40
Identity = 29/48 (60.42%), Postives = 35/48 (72.92%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLE 1827
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L+
Sbjct:  709 KTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLD 756          

HSP 3 Score: 40.0466 bits (92), Expect = 3.795e-40
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 1355 MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            +L + +YL+      +   P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S
Sbjct:  598 ILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVNWSLAAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLS 705          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 104.76 bits (260), Expect = 4.646e-40
Identity = 53/128 (41.41%), Postives = 83/128 (64.84%), Query Frame = 3
Query:  954 YNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
            +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY
Sbjct:  572 HNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYY 699          

HSP 2 Score: 61.6178 bits (148), Expect = 4.646e-40
Identity = 29/48 (60.42%), Postives = 35/48 (72.92%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLE 1827
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L+
Sbjct:  820 KTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLD 867          

HSP 3 Score: 39.2762 bits (90), Expect = 4.646e-40
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 1355 MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            +L + +YL+      +   P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S
Sbjct:  709 ILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVNWSLAAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLS 816          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 105.531 bits (262), Expect = 2.273e-38
Identity = 53/128 (41.41%), Postives = 83/128 (64.84%), Query Frame = 3
Query:  954 YNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
            +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY
Sbjct:  608 HNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYY 735          

HSP 2 Score: 55.8398 bits (133), Expect = 2.273e-38
Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQN 1809
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL   N
Sbjct:  856 KTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVSPN 897          

HSP 3 Score: 38.891 bits (89), Expect = 2.273e-38
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 1355 MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            +L + +YL+      +   P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S
Sbjct:  745 ILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVNWSLAAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLS 852          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 105.145 bits (261), Expect = 2.861e-38
Identity = 53/128 (41.41%), Postives = 83/128 (64.84%), Query Frame = 3
Query:  954 YNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
            +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY
Sbjct:  572 HNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYY 699          

HSP 2 Score: 55.8398 bits (133), Expect = 2.861e-38
Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQN 1809
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL   N
Sbjct:  820 KTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVSPN 861          

HSP 3 Score: 38.891 bits (89), Expect = 2.861e-38
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 1355 MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            +L + +YL+      +   P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S
Sbjct:  709 ILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVNWSLAAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLS 816          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 105.145 bits (261), Expect = 8.958e-28
Identity = 53/128 (41.41%), Postives = 83/128 (64.84%), Query Frame = 3
Query:  954 YNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
            +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY
Sbjct:  627 HNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYY 754          

HSP 2 Score: 38.891 bits (89), Expect = 8.958e-28
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 1355 MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            +L + +YL+      +   P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S
Sbjct:  764 ILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVNWSLAAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLS 871          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Sea Lamprey
Match: SIDT1 (SID1 transmembrane family member 1 [Source:HGNC Symbol;Acc:HGNC:25967])

HSP 1 Score: 100.523 bits (249), Expect = 5.259e-23
Identity = 51/123 (41.46%), Postives = 80/123 (65.04%), Query Frame = 3
Query:  969 NELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
             E +  +  +GLPK+FGL+Y+MGF+L+MEG++SA YHVCPN S+  FD ++ YI+  + M+++YQ RH D+ ASA+  Y S A+ IF  V+     +  + FW L T++++     L   IY+
Sbjct:  103 REFSHQLADHGLPKHFGLFYSMGFALMMEGVLSACYHVCPNYSNFQFDTAFMYIIAGLCMLKLYQKRHSDVNASAYKAYASFAVIIFFAVLGVVVAKSAVWFWILCTIVHILAALALSFHIYH 225          

HSP 2 Score: 50.8322 bits (120), Expect = 5.472e-7
Identity = 22/39 (56.41%), Postives = 30/39 (76.92%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLT 1800
            +T A SRE+NK+C+ L FYD HDI HF+ SIA+F +F+ 
Sbjct:  356 ETAAQSRERNKECVLLKFYDHHDIWHFISSIAMFLSFMV 394          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Sea Lamprey
Match: SIDT1 (SID1 transmembrane family member 1 [Source:HGNC Symbol;Acc:HGNC:25967])

HSP 1 Score: 99.3673 bits (246), Expect = 1.495e-22
Identity = 50/114 (43.86%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
            +GLPK+FGL+Y+MGF+L+MEG++SA YHVCPN S+  FD ++ YI+  + M+++YQ RH D+ ASA+  Y S A+ IF  V+     +  + FW L T++++     L   IY+
Sbjct:  153 HGLPKHFGLFYSMGFALMMEGVLSACYHVCPNYSNFQFDTAFMYIIAGLCMLKLYQKRHSDVNASAYKAYASFAVIIFFAVLGVVVAKSAVWFWILCTIVHILAALALSFHIYH 266          

HSP 2 Score: 50.8322 bits (120), Expect = 6.440e-7
Identity = 22/39 (56.41%), Postives = 30/39 (76.92%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLT 1800
            +T A SRE+NK+C+ L FYD HDI HF+ SIA+F +F+ 
Sbjct:  382 ETAAQSRERNKECVLLKFYDHHDIWHFISSIAMFLSFMV 420          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Match: EDO43450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYF1])

HSP 1 Score: 45.0542 bits (105), Expect = 1.599e-11
Identity = 19/37 (51.35%), Postives = 27/37 (72.97%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 1794
            ++PA SRE N  C+ + FYD HD+ HFL + A+FF+F
Sbjct:  167 ESPAHSREGNSHCLLMGFYDDHDVWHFLSACAMFFSF 203          

HSP 2 Score: 38.1206 bits (87), Expect = 1.599e-11
Identity = 33/108 (30.56%), Postives = 58/108 (53.70%), Query Frame = 2
Query: 1364 KQVYLVIKSKKWKAFIPTYKY--RMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCW-AVAVYCFIQPTS 1678
            K+   ++K + W   I       RM++++ A I+N   +I G++I+P +F  + L  L +N L+Y G+Y++MK   KE         S +++ CW A  V+ F + TS
Sbjct:   57 KRSQAMVKREGWVGHIGKKMCIDRMLLLLIANIVNWAFAINGVVIEPRDFATYLLAILIVNGLLYIGFYVIMKLRNKERILPLPFVVSGLSLLCWIAALVFFFKRLTS 164          

HSP 3 Score: 23.8682 bits (50), Expect = 1.599e-11
Identity = 12/36 (33.33%), Postives = 19/36 (52.78%), Query Frame = 3
Query: 1188 SAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYM 1295
            SA+  Y S A  I I V+   F    FW +F ++++
Sbjct:    1 SAYSVYASFAAIILIAVVGVLFASFTFWLVFCIIHI 36          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Match: EDO27616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8S0])

HSP 1 Score: 51.9878 bits (123), Expect = 5.031e-9
Identity = 20/44 (45.45%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  984 SIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQ 1115
            S+ + G+P+++ ++YAM  +L+MEG++SA YHVCPN S+  F +
Sbjct:   11 SLQHNGIPQHYQIFYAMAMALVMEGVLSACYHVCPNNSNFQFGK 54          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 109.383 bits (272), Expect = 5.489e-41
Identity = 55/133 (41.35%), Postives = 84/133 (63.16%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
             R   +   L+  +++    G+PK+FGLYYAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  VI   F     +FW +F+V+++  T +L   +YY
Sbjct:  562 QREIVHKQALDRNDLNALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVIGVVFGRGNTVFWIVFSVIHILATLLLSTQLYY 694          

HSP 2 Score: 63.1586 bits (152), Expect = 5.489e-41
Identity = 29/49 (59.18%), Postives = 36/49 (73.47%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLEN 1830
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L++
Sbjct:  815 KTPAESREHNRNCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDS 863          

HSP 3 Score: 36.5798 bits (83), Expect = 5.489e-41
Identity = 30/89 (33.71%), Postives = 47/89 (52.81%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A+Y F Q  S
Sbjct:  723 PMYIDRMVLLVMGNIVNWSLAAYGLIQRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLPLVCILFTAVVWGFALYFFFQGLS 811          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 108.997 bits (271), Expect = 5.720e-41
Identity = 55/133 (41.35%), Postives = 84/133 (63.16%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
             R   +   L+  +++    G+PK+FGLYYAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  VI   F     +FW +F+V+++  T +L   +YY
Sbjct:  553 QREIVHKQALDRNDLNALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVIGVVFGRGNTVFWIVFSVIHILATLLLSTQLYY 685          

HSP 2 Score: 63.1586 bits (152), Expect = 5.720e-41
Identity = 29/49 (59.18%), Postives = 36/49 (73.47%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLEN 1830
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L++
Sbjct:  806 KTPAESREHNRNCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDS 854          

HSP 3 Score: 36.5798 bits (83), Expect = 5.720e-41
Identity = 30/89 (33.71%), Postives = 47/89 (52.81%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A+Y F Q  S
Sbjct:  714 PMYIDRMVLLVMGNIVNWSLAAYGLIQRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLPLVCILFTAVVWGFALYFFFQGLS 802          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 108.997 bits (271), Expect = 6.359e-41
Identity = 55/133 (41.35%), Postives = 84/133 (63.16%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYY 1331
             R   +   L+  +++    G+PK+FGLYYAMG +L+MEG++SA YHVCPN ++  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  VI   F     +FW +F+V+++  T +L   +YY
Sbjct:  583 QREIVHKQALDRNDLNALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVIGVVFGRGNTVFWIVFSVIHILATLLLSTQLYY 715          

HSP 2 Score: 63.1586 bits (152), Expect = 6.359e-41
Identity = 29/49 (59.18%), Postives = 36/49 (73.47%), Query Frame = 1
Query: 1684 KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLEN 1830
            KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L++
Sbjct:  836 KTPAESREHNRNCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDS 884          

HSP 3 Score: 36.5798 bits (83), Expect = 6.359e-41
Identity = 30/89 (33.71%), Postives = 47/89 (52.81%), Query Frame = 2
Query: 1412 PTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTS 1678
            P Y  RMV++V   I+N +++ YG++ +P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A+Y F Q  S
Sbjct:  744 PMYIDRMVLLVMGNIVNWSLAAYGLIQRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLPLVCILFTAVVWGFALYFFFQGLS 832          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000041572.1 (SMESG000041572.1)

HSP 1 Score: 268.855 bits (686), Expect = 2.796e-151
Identity = 128/130 (98.46%), Postives = 129/130 (99.23%), Query Frame = 3
Query:  942 RHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            +HQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQ HMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY
Sbjct:  439 KHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 568          

HSP 2 Score: 194.512 bits (493), Expect = 2.796e-151
Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 2
Query: 1331 FDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN 1681
            FDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEFPLFFLTFLSLNLLIYFGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN
Sbjct:  569 FDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEFPLFFLTFLSLNLLIYFGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSN 685          

HSP 3 Score: 114.775 bits (286), Expect = 2.796e-151
Identity = 54/61 (88.52%), Postives = 55/61 (90.16%), Query Frame = 1
Query: 1660 LHPADFKLKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 1842
            + P     KTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN
Sbjct:  680 IQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 740          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000075887.1 (SMESG000075887.1)

HSP 1 Score: 124.405 bits (311), Expect = 2.021e-65
Identity = 58/114 (50.88%), Postives = 82/114 (71.93%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIH--QFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            +G+P+YFGL+YAMG SL MEGIMSA YH+CP+ ++  FD +Y YIL C+ M++IYQ RH DI A+AH F++++A+FIF+ VI     +  IIFW  F +LY+     L  ++YY
Sbjct:  475 HGVPQYFGLFYAMGVSLTMEGIMSACYHICPSNNNFQFDTAYMYILACLCMIKIYQTRHPDINATAHSFFMTMALFIFVSVIGVVTMYNRIIFWIFFLILYLCICGFLTSEVYY 588          

HSP 2 Score: 88.9669 bits (219), Expect = 2.021e-65
Identity = 55/113 (48.67%), Postives = 79/113 (69.91%), Query Frame = 2
Query: 1343 KINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFI-QPTS 1678
            K++  + K++Y +I   KWK FIPTYK RM I+ F   +N  IS+YGI+ KP+ FP +FL    +NLL+YFG+YI+MK  + E F++ ++FY I++I CWA A+YCFI  PT 
Sbjct:  593 KLDFQIFKRIYNMILLDKWKIFIPTYKRRMAILSFFNAVNFAISLYGIIAKPKNFPSYFLAVFMVNLLLYFGFYILMKVIHSERFHRISLFYVIVSILCWATALYCFINHPTD 705          

HSP 3 Score: 77.411 bits (189), Expect = 2.021e-65
Identity = 34/64 (53.12%), Postives = 49/64 (76.56%), Query Frame = 1
Query: 1651 CLLLHPADFKLKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 1842
            C + HP D++ K P++SR +NK C+F DFYDIHD  HFL ++++FF+F+ LQNMD+CL + E N
Sbjct:  698 CFINHPTDWQ-KPPSLSRIENKDCLFFDFYDIHDTWHFLSAMSMFFSFMGLQNMDDCLIHTERN 760          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000075887.1 (SMESG000075887.1)

HSP 1 Score: 124.405 bits (311), Expect = 2.038e-65
Identity = 58/114 (50.88%), Postives = 82/114 (71.93%), Query Frame = 3
Query:  996 YGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIH--QFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
            +G+P+YFGL+YAMG SL MEGIMSA YH+CP+ ++  FD +Y YIL C+ M++IYQ RH DI A+AH F++++A+FIF+ VI     +  IIFW  F +LY+     L  ++YY
Sbjct:  476 HGVPQYFGLFYAMGVSLTMEGIMSACYHICPSNNNFQFDTAYMYILACLCMIKIYQTRHPDINATAHSFFMTMALFIFVSVIGVVTMYNRIIFWIFFLILYLCICGFLTSEVYY 589          

HSP 2 Score: 88.9669 bits (219), Expect = 2.038e-65
Identity = 55/113 (48.67%), Postives = 79/113 (69.91%), Query Frame = 2
Query: 1343 KINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFI-QPTS 1678
            K++  + K++Y +I   KWK FIPTYK RM I+ F   +N  IS+YGI+ KP+ FP +FL    +NLL+YFG+YI+MK  + E F++ ++FY I++I CWA A+YCFI  PT 
Sbjct:  594 KLDFQIFKRIYNMILLDKWKIFIPTYKRRMAILSFFNAVNFAISLYGIIAKPKNFPSYFLAVFMVNLLLYFGFYILMKVIHSERFHRISLFYVIVSILCWATALYCFINHPTD 706          

HSP 3 Score: 77.411 bits (189), Expect = 2.038e-65
Identity = 34/64 (53.12%), Postives = 49/64 (76.56%), Query Frame = 1
Query: 1651 CLLLHPADFKLKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 1842
            C + HP D++ K P++SR +NK C+F DFYDIHD  HFL ++++FF+F+ LQNMD+CL + E N
Sbjct:  699 CFINHPTDWQ-KPPSLSRIENKDCLFFDFYDIHDTWHFLSAMSMFFSFMGLQNMDDCLIHTERN 761          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000041575.1 (SMESG000041575.1)

HSP 1 Score: 137.502 bits (345), Expect = 9.445e-58
Identity = 66/131 (50.38%), Postives = 89/131 (67.94%), Query Frame = 3
Query:  939 HRHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYY 1331
             RH  YN     L    +  G+P+Y+GL+YAMG SL MEGIMSA YHVCP+  +  FD +Y YIL  + +++IYQ RH DI A+AH FY+++A+FIFIGVI   F  +I W +FT+LY+F    L C+IY+
Sbjct:  473 RRHSLYNECKLRLCKKDYNLGIPQYYGLFYAMGVSLTMEGIMSACYHVCPSHDNFQFDTAYMYILASLCLIKIYQIRHPDIDATAHSFYMTMALFIFIGVIGVIFNRLILWIIFTMLYLFGLMFLSCEIYF 603          

HSP 2 Score: 65.0846 bits (157), Expect = 9.445e-58
Identity = 29/58 (50.00%), Postives = 44/58 (75.86%), Query Frame = 1
Query: 1651 CLLLHPADFKLKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 1824
            C + HP D++ ++PA SR  N+ C+ L+FYDIHDI HFL S+++FF+F+ L N+D+ L
Sbjct:  713 CFIKHPTDWE-QSPASSRAFNQNCLLLNFYDIHDIWHFLSSLSMFFSFMALLNIDDGL 769          

HSP 3 Score: 62.003 bits (149), Expect = 9.445e-58
Identity = 42/115 (36.52%), Postives = 69/115 (60.00%), Query Frame = 2
Query: 1337 QFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQ-PTS 1678
            Q+ I++ +P Q+Y   K  KW    P +  RM+I++   I+N + +++G +IKP  F  +FL    +NLL+YF  Y+++K  Y E+    +I Y +I + CW  A+YCFI+ PT 
Sbjct:  606 QWNIDVKVPIQIYNRFKQDKWLILCPDHVVRMIIILIFNIVNISFALFGAIIKPSNFSSYFLAIFMINLLLYFFIYVILKIIYCESIYYLSILYVLIAMVCWGFALYCFIKHPTD 720          
The following BLAST results are available for this feature:
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIDT29.426e-3940.29SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
SIDT29.426e-3940.29SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
SIDT23.119e-3840.29SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
SIDT23.196e-3840.29SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
SIDT23.196e-3840.29SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
chup-18.462e-1631.21CHolesterol UPtake associated [Source:UniProtKB/T... [more]
chup-17.611e-751.22CHolesterol UPtake associated [Source:UniProtKB/T... [more]
chup-11.127e-660.61CHolesterol UPtake associated [Source:UniProtKB/T... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sidt26.778e-4141.35SID1 transmembrane family, member 2 [Source:ZFIN;A... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIDT21.507e-3842.86SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT21.663e-3842.86SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT21.910e-3842.86SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT22.126e-3842.86SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT23.782e-3842.86SID1 transmembrane family member 2 [Source:NCBI ge... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sidt29.319e-3941.01SID1 transmembrane family, member 2 [Source:MGI Sy... [more]
Sidt29.874e-3941.01SID1 transmembrane family, member 2 [Source:MGI Sy... [more]
Sidt12.442e-2438.82SID1 transmembrane family, member 1 [Source:MGI Sy... [more]
Sidt13.284e-2439.58SID1 transmembrane family, member 1 [Source:MGI Sy... [more]
Sidt27.663e-864.86SID1 transmembrane family, member 2 [Source:MGI Sy... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CIF6|SIDT2_MOUSE5.982e-3841.01SID1 transmembrane family member 2 OS=Mus musculus... [more]
sp|D3ZEH5|SIDT2_RAT6.440e-3841.01SID1 transmembrane family member 2 OS=Rattus norve... [more]
sp|Q8NBJ9|SIDT2_HUMAN1.402e-3740.29SID1 transmembrane family member 2 OS=Homo sapiens... [more]
sp|Q6Q3F5|SIDT1_RAT7.352e-2438.67SID1 transmembrane family member 1 OS=Rattus norve... [more]
sp|Q6AXF6|SIDT1_MOUSE1.479e-2338.82SID1 transmembrane family member 1 OS=Mus musculus... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564ZEB01.891e-4641.22Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564ZF361.938e-4641.22Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A074ZSI46.907e-4648.65Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A0R3X3R67.478e-4547.32Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A1I8IS621.703e-4445.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sidt23.795e-4040.60SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt24.646e-4041.41SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt22.273e-3841.41SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt22.861e-3841.41SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt28.958e-2841.41SID1 transmembrane family member 2 [Source:NCBI ge... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SIDT15.259e-2341.46SID1 transmembrane family member 1 [Source:HGNC Sy... [more]
SIDT11.495e-2243.86SID1 transmembrane family member 1 [Source:HGNC Sy... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434501.599e-1151.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276165.031e-945.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sidt25.489e-4141.35SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt25.720e-4141.35SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt26.359e-4141.35SID1 transmembrane family member 2 [Source:NCBI ge... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000041572.12.796e-15198.46SMESG000041572.1[more]
SMESG000075887.12.021e-6550.88SMESG000075887.1[more]
SMESG000075887.12.038e-6550.88SMESG000075887.1[more]
SMESG000041575.19.445e-5850.38SMESG000041575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027386 ID=SMED30027386|Name=SID1 transmembrane family member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1842bp
ATTATGAGTGAGGGTCATTAATGTGCGGTGGTCCGGAAAAGCCTGGGAAC
CTATGGTTTAAATAATTATGTTTTGGCTAAGAATATTTTTTCTTAATATT
TAAGAGAAACGGAAAAAGTCATTCTTTAAAGAAAAGCCGAAAAATGCAGT
AAACTTTAGACCATTTTTTATCAAAGTCATAATTTATGACTTTGATGTTC
TTTTGAATTTTTGTTTATTTTATTATATATTTTTTGTTTTTTATTTATAA
TTATCATATTAATTCATTAAGTCACTTTGAGGTGTGACGCCCGCATACTC
CGGCTTGAAATGTAATTTGATAAAGTTCATTATATTCATATTTGTTTACC
AAAAAAAATTAATTTCACAAATCACATTTTATGGAAATTAAATCGATTTA
AAATTACGCAGAAAGCATTAAACAATTCGTAAGCCAATGTGTTAAATTAT
AATGAAAAATATATAAATATGTATTTGTTTGTAATATATGTAAGTTTTTA
CTAATAACAATAGTTTGGATTTTTTTCAAATATTGCATTCTGGTCTCAAT
TAATAAAACTTATAAAAATATATAAAAAAAGATTAGGTGAATTTGTGTCA
TTTGAATTGAGTCGTGTTTCTCTGGTTCAAATTAACAACGGAAATCGAGT
ATTTGCGGAGATTTATCCACCAGCACCCCTTAATCTTGTCGAAGTATGTG
TTTCTAAAGTGCCACTGTTTGTGGTTACGTTTTTTCCCGTCAAATTAGAT
TTTTCCCGAACGACTAATTTTCAGAAACCTATTTCATCAACTTCAATTTA
TTGAAAAGAATTATATCTTAGATGTTAATTATTTTAAATGAAAACTATAA
AAGAGAAAAGTACTGTCGCAACAGTCAGTGGCCCATAGGGTGCGCTTCTA
AGGATTTAGTTATCTTCGGATTTTGATTGTGTTATGTTCATAGGCATCAA
CGTTACAATTCATGGCTGAATGAACTAAATATGTCAATCTTTTATTATGG
CTTACCAAAATATTTTGGACTTTATTATGCAATGGGGTTTTCTCTTCTGA
TGGAAGGTATTATGAGTGCATTATATCACGTTTGTCCAAATCAGAGCCAT
ATGATATTTGACCAATCTTACAAGTATATTCTTGTTTGTATAATGATGGT
ACAAATCTATCAGTTCCGCCATTTTGATATAACTGCTTCAGCTCATTTAT
TTTACATTTCCTTGGCAATATTCATCTTCATTGGCGTTATCCACCAGTTT
TTTCAAGAAATTATTTTCTGGTCGCTATTTACAGTTTTATATATGTTCTG
GACTGCCATTTTGATGTGCGATATTTACTATTCGATCAATTTAAAATTAA
TATTATGTTGCCAAAACAAGTGTATTTGGTTATAAAATCAAAAAAATGGA
AAGCTTTCATTCCAACTTATAAATATCGGATGGTTATTGTGGTATTTGCG
CTTATTATCAATGGAACTATATCAATTTATGGAATTCTAATAAAACCGGA
AGAATTTCCATTATTTTTTCTGACTTTTCTATCTCTAAACTTGCTAATCT
ATTTCGGATATTACATTGTCATGAAGGCTTTTTACAAGGAAACTTTCAAC
AAAACGGCAATTTTCTATTCAATAATTACCATTTCGTGTTGGGCAGTGGC
TGTTTATTGCTTCATCCAGCCGACTTCAAACTGAAAACTCCAGCAGTATC
TCGAGAACAAAACAAAAAATGTATATTTTTAGATTTTTACGACATTCATG
ACATTTCACACTTTTTATTTTCAATTGCAATTTTTTTCACATTTCTGACA
CTTCAAAATATGGATAACTGCTTGGAAAACCAAGAAATGAAC
back to top

protein sequence of SMED30027386-orf-1

>SMED30027386-orf-1 ID=SMED30027386-orf-1|Name=SMED30027386-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
MSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQSHMIFDQSYKYI
LVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLF
TVLYMFWTAILMCDIYYSINLKLILCCQNKCIWL*
back to top

protein sequence of SMED30027386-orf-2

>SMED30027386-orf-2 ID=SMED30027386-orf-2|Name=SMED30027386-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISIYGILIKPEE
FPLFFLTFLSLNLLIYFGYYIVMKAFYKETFNKTAIFYSIITISCWAVAV
YCFIQPTSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR025958SID1_TM_fam
Vocabulary: biological process
TermDefinition
GO:0033227dsRNA transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0051033RNA transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025958SID1 transmembrane familyPFAMPF13965SID-1_RNA_chancoord: 6..133
e-value: 7.7E-34
score: 117.1
IPR025958SID1 transmembrane familyPANTHERPTHR12185FAMILY NOT NAMEDcoord: 6..129
NoneNo IPR availablePANTHERPTHR12185:SF14CHOLESTEROL UPTAKE ASSOCIATEDcoord: 6..129
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 94..116