Discoidin domain-containing receptor 2

Overview
NameDiscoidin domain-containing receptor 2
Smed IDSMED30027372
Length (bp)3067
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Discoidin domain-containing receptor 2 (SMED30027372) t-SNE clustered cells

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30027372) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Discoidin domain-containing receptor 2 (SMED30027372) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30027372) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027372

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027372SMESG000021250.1 SmedASXL_007226SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30027372SMESG000021250.1 dd_Smed_v4_24382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027372SMESG000021250.1 dd_Smed_v6_24382_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30027372SMESG000021250.1 OX_Smed_1.0.09400ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 126.331 bits (316), Expect = 7.357e-29
Identity = 89/370 (24.05%), Postives = 160/370 (43.24%), Query Frame = 1
Query: 1708 GPLGNSQMYRMNLINFISTTNYPEFS--------------SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSIL-QSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKN 2766
            GP G       +++N    T    +S              +  EF ++L    L   E +    +G + +           ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V   C  D    ++ EY    D+   L        S++D+ ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   +   RP+F+EIH+   ++ 
Sbjct:  514 GPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKL----LTFKEKLGEGQFGEVHLCEVE------GMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQG 853          

HSP 2 Score: 112.464 bits (280), Expect = 1.442e-24
Identity = 93/376 (24.73%), Postives = 158/376 (42.02%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSES 1176
            C   L  +   +PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R  P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW        +I I+F F   R F  + +   N +   V + K ++  F S+   +E   +I+  +  D  N   R++ + L  R    +    HF   W+M  EI F S++
Sbjct:   30 CRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGTRWISWRN-------RHGKQV-----------------------LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-NAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA 368          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 126.331 bits (316), Expect = 7.357e-29
Identity = 89/370 (24.05%), Postives = 160/370 (43.24%), Query Frame = 1
Query: 1708 GPLGNSQMYRMNLINFISTTNYPEFS--------------SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSIL-QSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKN 2766
            GP G       +++N    T    +S              +  EF ++L    L   E +    +G + +           ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V   C  D    ++ EY    D+   L        S++D+ ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   +   RP+F+EIH+   ++ 
Sbjct:  514 GPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKL----LTFKEKLGEGQFGEVHLCEVE------GMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQG 853          

HSP 2 Score: 112.464 bits (280), Expect = 1.442e-24
Identity = 93/376 (24.73%), Postives = 158/376 (42.02%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSES 1176
            C   L  +   +PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R  P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW        +I I+F F   R F  + +   N +   V + K ++  F S+   +E   +I+  +  D  N   R++ + L  R    +    HF   W+M  EI F S++
Sbjct:   30 CRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGTRWISWRN-------RHGKQV-----------------------LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-NAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA 368          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 126.331 bits (316), Expect = 7.357e-29
Identity = 89/370 (24.05%), Postives = 160/370 (43.24%), Query Frame = 1
Query: 1708 GPLGNSQMYRMNLINFISTTNYPEFS--------------SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSIL-QSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKN 2766
            GP G       +++N    T    +S              +  EF ++L    L   E +    +G + +           ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V   C  D    ++ EY    D+   L        S++D+ ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   +   RP+F+EIH+   ++ 
Sbjct:  514 GPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKL----LTFKEKLGEGQFGEVHLCEVE------GMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQG 853          

HSP 2 Score: 112.464 bits (280), Expect = 1.442e-24
Identity = 93/376 (24.73%), Postives = 158/376 (42.02%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSES 1176
            C   L  +   +PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R  P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW        +I I+F F   R F  + +   N +   V + K ++  F S+   +E   +I+  +  D  N   R++ + L  R    +    HF   W+M  EI F S++
Sbjct:   30 CRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGTRWISWRN-------RHGKQV-----------------------LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-NAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA 368          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 120.939 bits (302), Expect = 3.297e-27
Identity = 72/274 (26.28%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 1966 ILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYVVNEYTSLMDIFTLLESLSILQSNNDL-----ISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSK 2760
            ++ V+ ++ D+  N + +F +E+  ++++   N+I    V VQD   C +  Y+ N   +       LE  +   +  D       +I     L++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+ V                +   ++PIRWM WE I    F+T SDV+ FGV +WE+   C+  P+  L++ Q+  N      +      L  P +  +   +++ +C   E+ QRP F ++H F ++
Sbjct:  614 LVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGE-NFTIKIADFGMSRNLYAGDYYRV----------------QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAE 870          

HSP 2 Score: 94.3597 bits (233), Expect = 6.318e-19
Identity = 78/341 (22.87%), Postives = 134/341 (39.30%), Query Frame = 1
Query:  175 DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLH-TDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHT-------GMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSE 1173
            +SS  + AWCP   V    +E++ +DL  ++++ ++ T+G  RH       +             R R   + ++W+   D+    +                   ISGN+D          P +V R +R YP +     +CL ++LYGC + + ++ Y    G   Y  E      Y  D +YDG   HT       G+ +   G +   D+ K+         + +VGWS   F   ++ + F F   R F  + +   N  T    LP  +E  F         G+ + H +  +  +   R + + L  R  RF+     F   W++  EI F S+
Sbjct:   65 ESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQG--RHAGGLGKEFSRS---------YRLRYSRDGRRWMGWKDRWGQEV-------------------ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAV----YLNDSTYDG---HTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYD-YVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISD 367          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 120.939 bits (302), Expect = 3.297e-27
Identity = 72/274 (26.28%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 1966 ILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYVVNEYTSLMDIFTLLESLSILQSNNDL-----ISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSK 2760
            ++ V+ ++ D+  N + +F +E+  ++++   N+I    V VQD   C +  Y+ N   +       LE  +   +  D       +I     L++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+ V                +   ++PIRWM WE I    F+T SDV+ FGV +WE+   C+  P+  L++ Q+  N      +      L  P +  +   +++ +C   E+ QRP F ++H F ++
Sbjct:  614 LVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGE-NFTIKIADFGMSRNLYAGDYYRV----------------QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAE 870          

HSP 2 Score: 94.3597 bits (233), Expect = 6.318e-19
Identity = 78/341 (22.87%), Postives = 134/341 (39.30%), Query Frame = 1
Query:  175 DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLH-TDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHT-------GMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSE 1173
            +SS  + AWCP   V    +E++ +DL  ++++ ++ T+G  RH       +             R R   + ++W+   D+    +                   ISGN+D          P +V R +R YP +     +CL ++LYGC + + ++ Y    G   Y  E      Y  D +YDG   HT       G+ +   G +   D+ K+         + +VGWS   F   ++ + F F   R F  + +   N  T    LP  +E  F         G+ + H +  +  +   R + + L  R  RF+     F   W++  EI F S+
Sbjct:   65 ESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQG--RHAGGLGKEFSRS---------YRLRYSRDGRRWMGWKDRWGQEV-------------------ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAV----YLNDSTYDG---HTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYD-YVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISD 367          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 122.479 bits (306), Expect = 3.505e-28
Identity = 84/284 (29.58%), Postives = 138/284 (48.59%), Query Frame = 1
Query: 1945 EGKFSDTILC--------VRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLIS-------IEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETI-DIIEQCLVDEALQRPTFKEIHI 2748
            +G+F +  LC        V+K+   S  + + +FH+E+  L  + H N++  V V   C +             I  ++E +     N DL S       I+ SQ + I  QL+  L+YLE    VHRDIA RN LV      +K++D  +A++ +  +Y++V                +   ++PIRWM WE +    FST SDV+GFGV MWE+F+ C + PY  +++  +  N  S++S     Q L  P+    +   + I  C   E+ +RP+F+ +H+
Sbjct:  505 QGEFGEVDLCQLENRKVAVKKLHGISQAD-EFSFHREIRVLGSLKHPNVVEVVGV---CTIQK----------PILCIMEYME----NGDLKSYILKNPTIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEG-NVKIADFGMARSLYSQEYYKV----------------EGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHL 753          

HSP 2 Score: 74.7146 bits (182), Expect = 2.311e-13
Identity = 79/330 (23.94%), Postives = 142/330 (43.03%), Query Frame = 1
Query:  196 AWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL--SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINH-AIKEDRENFDTRWIVIDLKKRTGRFVSINLHF--QSQWIMVREILFSS 1170
            AWCP+ ++++ +KE++ I      V+  + T+G      G + A+ + I+Y       W  Y++  E +     + T   I                       + HL          IV       P+S+    +C+ ++++GC + ++++ Y +  G L    +  I    + D SYDG L ++  L  G+GKL  +D E   NN F ++ + +VGW R   +  ++ + F F   R    + +  +N +  S        + FS +G+ F    +I H    ED E+   RWI I +  R  +   I L+F   S W+ + E+ F S
Sbjct:   37 AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAI-----------------------RRHLDRAIIARRIRIV-------PVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQGDL----QSGIS---YHDFSYDGNLANSPHLTGGIGKL--YDGEVGKNNVF-VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFS--DTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 322          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 122.479 bits (306), Expect = 3.505e-28
Identity = 84/284 (29.58%), Postives = 138/284 (48.59%), Query Frame = 1
Query: 1945 EGKFSDTILC--------VRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLIS-------IEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETI-DIIEQCLVDEALQRPTFKEIHI 2748
            +G+F +  LC        V+K+   S  + + +FH+E+  L  + H N++  V V   C +             I  ++E +     N DL S       I+ SQ + I  QL+  L+YLE    VHRDIA RN LV      +K++D  +A++ +  +Y++V                +   ++PIRWM WE +    FST SDV+GFGV MWE+F+ C + PY  +++  +  N  S++S     Q L  P+    +   + I  C   E+ +RP+F+ +H+
Sbjct:  505 QGEFGEVDLCQLENRKVAVKKLHGISQAD-EFSFHREIRVLGSLKHPNVVEVVGV---CTIQK----------PILCIMEYME----NGDLKSYILKNPTIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEG-NVKIADFGMARSLYSQEYYKV----------------EGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHL 753          

HSP 2 Score: 74.7146 bits (182), Expect = 2.311e-13
Identity = 79/330 (23.94%), Postives = 142/330 (43.03%), Query Frame = 1
Query:  196 AWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL--SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINH-AIKEDRENFDTRWIVIDLKKRTGRFVSINLHF--QSQWIMVREILFSS 1170
            AWCP+ ++++ +KE++ I      V+  + T+G      G + A+ + I+Y       W  Y++  E +     + T   I                       + HL          IV       P+S+    +C+ ++++GC + ++++ Y +  G L    +  I    + D SYDG L ++  L  G+GKL  +D E   NN F ++ + +VGW R   +  ++ + F F   R    + +  +N +  S        + FS +G+ F    +I H    ED E+   RWI I +  R  +   I L+F   S W+ + E+ F S
Sbjct:   37 AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAI-----------------------RRHLDRAIIARRIRIV-------PVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQGDL----QSGIS---YHDFSYDGNLANSPHLTGGIGKL--YDGEVGKNNVF-VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFS--DTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 322          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 122.479 bits (306), Expect = 4.065e-28
Identity = 84/284 (29.58%), Postives = 138/284 (48.59%), Query Frame = 1
Query: 1945 EGKFSDTILC--------VRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLIS-------IEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETI-DIIEQCLVDEALQRPTFKEIHI 2748
            +G+F +  LC        V+K+   S  + + +FH+E+  L  + H N++  V V   C +             I  ++E +     N DL S       I+ SQ + I  QL+  L+YLE    VHRDIA RN LV      +K++D  +A++ +  +Y++V                +   ++PIRWM WE +    FST SDV+GFGV MWE+F+ C + PY  +++  +  N  S++S     Q L  P+    +   + I  C   E+ +RP+F+ +H+
Sbjct:  535 QGEFGEVDLCQLENRKVAVKKLHGISQAD-EFSFHREIRVLGSLKHPNVVEVVGV---CTIQK----------PILCIMEYME----NGDLKSYILKNPTIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEG-NVKIADFGMARSLYSQEYYKV----------------EGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHL 783          

HSP 2 Score: 75.0998 bits (183), Expect = 2.067e-13
Identity = 88/378 (23.28%), Postives = 162/378 (42.86%), Query Frame = 1
Query:   64 EDKDSCYQKLLTNRTNVPDDAFIVSSFEID----YEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL--SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINH-AIKEDRENFDTRWIVIDLKKRTGRFVSINLHF--QSQWIMVREILFSS 1170
            E ++  +Q  ++NR    +     SSF++       A+  ++S     AWCP+ ++++ +KE++ I      V+  + T+G      G + A+ + I+Y       W  Y++  E +     + T   I                       + HL          IV       P+S+    +C+ ++++GC + ++++ Y +  G L    +  I    + D SYDG L ++  L  G+GKL  +D E   NN F ++ + +VGW R   +  ++ + F F   R    + +  +N +  S        + FS +G+ F    +I H    ED E+   RWI I +  R  +   I L+F   S W+ + E+ F S
Sbjct:   21 ELRECSHQLGMSNRKIRDEQISASSSFDLQSTGPQHARAHQESG--SGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAI-----------------------RRHLDRAIIARRIRIV-------PVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQGDL----QSGIS---YHDFSYDGNLANSPHLTGGIGKL--YDGEVGKNNVF-VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFS--DTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 352          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 110.153 bits (274), Expect = 3.197e-24
Identity = 75/262 (28.63%), Postives = 129/262 (49.24%), Query Frame = 1
Query: 1969 LCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQS--QFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            + V+K + D+    +    QE+  +   +H N+I  + V   C  D +   V EY    D+  LL+ + +  +++D+  I ++  +FLYIA Q++  + YL  +  VHRD+A RN LV      IK++D  + +  + S Y++                +     +P+RWM  E I +  FS  SDV+ FGV +WE++++ +Q PYE  SN Q+      L +N      L+ P +       ++ +C  +   +RPTF EI
Sbjct:  621 VAVKKCRHDATNAERAQLEQEIRAVATFDHPNVIKLIGV---CYMDNSLLAVFEYMVHGDLHELLK-VRVPPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRT-IKIADFGLMRTSYGSDYYK----------------MLHRSWMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQ-PYEGASNQQVI----ELVAN---RHLLECPHNCPTNIYSLMVECWHENIERRPTFSEI 853          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 109.768 bits (273), Expect = 3.309e-24
Identity = 76/262 (29.01%), Postives = 131/262 (50.00%), Query Frame = 1
Query: 1969 LCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQS--QFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            + V+K + D+    +    QE+  +   +H N+I  + V   C  D +   V EY    D+  LL+ + +  +++D+  I ++  +FLYIA Q++  + YL  +  VHRD+A RN LV      IK++D  + +  + S Y+     ++L  +            +P+RWM  E I +  FS  SDV+ FGV +WE++++ +Q PYE  SN Q+      L +N      L+ P +       ++ +C  +   +RPTF EI
Sbjct:  462 VAVKKCRHDATNAERAQLEQEIRAVATFDHPNVIKLIGV---CYMDNSLLAVFEYMVHGDLHELLK-VRVPPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRT-IKIADFGLMRTSYGSDYY-----KMLHRS-----------WMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQ-PYEGASNQQVI----ELVAN---RHLLECPHNCPTNIYSLMVECWHENIERRPTFSEI 694          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344771)

HSP 1 Score: 128.257 bits (321), Expect = 1.159e-29
Identity = 75/278 (26.98%), Postives = 139/278 (50.00%), Query Frame = 1
Query: 1963 TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSILQSNNDLI--SIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNR--FRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 2778
            T++ V  ++  +  ++++ F  +   L Q++  N+   V     C  D    +V +Y+  +          + +++  +   S+     +YIA Q++  + +LE +  VHRD+A R+ ++  P L +K+  +    NR  + S Y      QL     +Q      S  +PIRWM WE +    F+TKSDV+ F V +WE+  + ++ PYE LS+  +  N   +  + + H+ L  P +  RE  D++ +C   +   RP+F+EIH++  +KN G+K
Sbjct:  784 TLVAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARLV---GACLRDEPICIVQDYSHCLGDLNQFLQEHVAETSGLMAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCII-GPELCVKVCSIGTVINRSAYASDYC-----QLEGFTGRQ------SQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGFK 1046          

HSP 2 Score: 103.219 bits (256), Expect = 5.846e-22
Identity = 81/334 (24.25%), Postives = 145/334 (43.41%), Query Frame = 1
Query:  196 AWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL--SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKN----DNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESL 1179
            AWCP++ V     E++ +DL  ++++  I T+G      G +    Y I+Y     ++WIR+R++                    K +LP            GN +  +E  N+  PS+    +R+YP S +   +CL  ++ GC +   ++ Y +  G       ++  +   +D++YDG         +GLG+L D    K+    D N        ++GW         + I+F F   R    V +   N ++  V +    ++ FS  GR F  G+ +  +   D      R + I L  R GR+V ++L+F ++W+M+ EI F S  +
Sbjct:  148 AWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQG------------------KEVLP------------GNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKGM------QRGMDIDLSDKTYDG-YEEGDHYVNGLGQLVDGQRGKDNFRADINGLGKGYE-WIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFS-GEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPV 442          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344770)

HSP 1 Score: 128.257 bits (321), Expect = 1.159e-29
Identity = 75/278 (26.98%), Postives = 139/278 (50.00%), Query Frame = 1
Query: 1963 TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSILQSNNDLI--SIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNR--FRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 2778
            T++ V  ++  +  ++++ F  +   L Q++  N+   V     C  D    +V +Y+  +          + +++  +   S+     +YIA Q++  + +LE +  VHRD+A R+ ++  P L +K+  +    NR  + S Y      QL     +Q      S  +PIRWM WE +    F+TKSDV+ F V +WE+  + ++ PYE LS+  +  N   +  + + H+ L  P +  RE  D++ +C   +   RP+F+EIH++  +KN G+K
Sbjct:  784 TLVAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARLV---GACLRDEPICIVQDYSHCLGDLNQFLQEHVAETSGLMAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCII-GPELCVKVCSIGTVINRSAYASDYC-----QLEGFTGRQ------SQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGFK 1046          

HSP 2 Score: 103.219 bits (256), Expect = 5.846e-22
Identity = 81/334 (24.25%), Postives = 145/334 (43.41%), Query Frame = 1
Query:  196 AWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL--SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKN----DNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESL 1179
            AWCP++ V     E++ +DL  ++++  I T+G      G +    Y I+Y     ++WIR+R++                    K +LP            GN +  +E  N+  PS+    +R+YP S +   +CL  ++ GC +   ++ Y +  G       ++  +   +D++YDG         +GLG+L D    K+    D N        ++GW         + I+F F   R    V +   N ++  V +    ++ FS  GR F  G+ +  +   D      R + I L  R GR+V ++L+F ++W+M+ EI F S  +
Sbjct:  148 AWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQG------------------KEVLP------------GNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKGM------QRGMDIDLSDKTYDG-YEEGDHYVNGLGQLVDGQRGKDNFRADINGLGKGYE-WIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFS-GEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPV 442          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ror (gene:FBgn0010407 transcript:FBtr0079978)

HSP 1 Score: 124.02 bits (310), Expect = 1.204e-28
Identity = 78/262 (29.77%), Postives = 142/262 (54.20%), Query Frame = 1
Query: 1969 LCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFV-VVQDK---CDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            + ++ +K+++ V  +++F +E++ ++ + H+N++  + VV +K   C L  Y+ N      D+   L    I  S  +  S+ Q +FL IA+Q+S+ + YL     VHRD+A RN LV    L +K+SD  ++++ + S Y+ V                +S  L+P+RWMP E I    F+T+SDV+ FGV +WE+++Y  Q PY   SN ++        + I+  Q L  P++       ++ +C  +++++RPTF +I
Sbjct:  439 VAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANG-----DLHEFL----ISNSPTEGKSLSQLEFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNE-GLVVKISDFGLSRDIYSSDYYRV----------------QSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQ-PYYGFSNQEVI-------NLIRSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0330693)

HSP 1 Score: 106.686 bits (265), Expect = 9.925e-24
Identity = 71/263 (27.00%), Postives = 127/263 (48.29%), Query Frame = 1
Query: 1948 GKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFK 2736
            GK+  +I    K+ ++  ++ +++F +E   + ++ H NL+    V  K     Y+V EY     +      L+ L+ +   +       L + +Q+S  ++YLE    +HRD+A RN LV S ++ +K++D  +A+     QY      +                  PI+W P EV++   FS+KSDV+ +GV MWE+F  C ++PY  L N ++          +Q    L+ P+S A+E  D+++ C      +RP F+
Sbjct:  221 GKWRGSIDTAVKMMKEGTMS-EDDFIEEAKVMTKLQHPNLVQLYGVCSK-HRPIYIVTEYMKHGSL------LNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENV-VKVADFGLARYVLDDQYTSSGGTKF-----------------PIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFT-CGKMPYGRLKNTEVV-------ERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFR 449          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0330692)

HSP 1 Score: 106.686 bits (265), Expect = 2.024e-23
Identity = 71/264 (26.89%), Postives = 127/264 (48.11%), Query Frame = 1
Query: 1945 EGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFK 2736
             GK+  +I    K+ ++  ++ +++F +E   + ++ H NL+    V  K     Y+V EY     +      L+ L+ +   +       L + +Q+S  ++YLE    +HRD+A RN LV S ++ +K++D  +A+     QY      +                  PI+W P EV++   FS+KSDV+ +GV MWE+F  C ++PY  L N ++          +Q    L+ P+S A+E  D+++ C      +RP F+
Sbjct:  321 RGKWRGSIDTAVKMMKEGTMS-EDDFIEEAKVMTKLQHPNLVQLYGVCSK-HRPIYIVTEYMKHGSL------LNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENV-VKVADFGLARYVLDDQYTSSGGTKF-----------------PIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFT-CGKMPYGRLKNTEVV-------ERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFR 550          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: FP015875.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 136.732 bits (343), Expect = 2.384e-32
Identity = 90/325 (27.69%), Postives = 154/325 (47.38%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPY--EMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL---ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            S  EF +Q     L   E +    +G + +     G + +  E  P  + D   +       ++ V++++ D+  N + +F +E+  ++++N+ N+I  + V    D    +V EY    D+   L   E  S L   N++ S+  +  L+++VQ+S  + YL  L  VHRD+A RN L+   HL IK+SD  +++N + S Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C++ PY  LS+ Q+  N      N      L  P         ++ +C   +   RP+F ++H
Sbjct:  547 SVAEFPRQ----RLLFREKLGEGQFGEVHLCEAE-GLAEFLGEGAPLPEQDGRPV-------LVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSDPLC-MVTEYMENGDLNMFLSQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDR-HLTIKISDFGMSRNLYSSDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLH 841          

HSP 2 Score: 90.8929 bits (224), Expect = 4.347e-18
Identity = 89/404 (22.03%), Postives = 161/404 (39.85%), Query Frame = 1
Query:   67 DKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKG-LSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDG-RRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            D   C   L      + +D    SS   D    +YAR +    E AWC   ++  S  +++ IDL  +  L ++ T+G  +R+     +  Y      +   WI +RN                              FG  + I GN +          P I+TR++R+ P++     +C+ ++L+GC + + ++ Y   +G +       I      D +YDG  L    L  GLG+L D     +D   +  + +     +VGW        ++ + F+F   R F ++ + + N ++  V +   +   F       +E      H + +DR N   R++ + LK R+   +    +F   W+M  EI F S ++     + T +P   T  SY   ++I
Sbjct:   19 DPAHCRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN-----------------------------RFGNEI-IMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITS--LNDSTYDGP-LERRKLSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDR-NPSARYVTVPLKHRSATALRCRFYFADTWMMFSEISFQSVTIV----LPTKKPPVLTPPSYEANSEI 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: BX088694.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 136.732 bits (343), Expect = 2.692e-32
Identity = 90/325 (27.69%), Postives = 154/325 (47.38%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPY--EMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL---ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            S  EF +Q     L   E +    +G + +     G + +  E  P  + D   +       ++ V++++ D+  N + +F +E+  ++++N+ N+I  + V    D    +V EY    D+   L   E  S L   N++ S+  +  L+++VQ+S  + YL  L  VHRD+A RN L+   HL IK+SD  +++N + S Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C++ PY  LS+ Q+  N      N      L  P         ++ +C   +   RP+F ++H
Sbjct:  547 SVAEFPRQ----RLLFREKLGEGQFGEVHLCEAE-GLAEFLGEGAPLPEQDGRPV-------LVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSDPLC-MVTEYMENGDLNMFLSQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDR-HLTIKISDFGMSRNLYSSDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLH 841          

HSP 2 Score: 91.6633 bits (226), Expect = 2.809e-18
Identity = 90/404 (22.28%), Postives = 161/404 (39.85%), Query Frame = 1
Query:   67 DKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKG-LSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDG-RRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            D   C   L      + +D    SS   D    +YAR +    E AWC   ++  S  +++ IDL  +  L ++ T+G  +R+     +  Y      +   WI +RN                              FG  + I GN +          P I+TR++R+ P++     +C+ ++L+GC + + ++ Y   +G +       I      D +YDG  L    L  GLG+L D     +D   +  + +     +VGW        ++ + F+F   R F ++ + + N ++  V +   +   F       +E      H + +DR N   R++ I LK R+   +    +F   W+M  EI F S ++     + T +P   T  SY   ++I
Sbjct:   19 DPAHCRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN-----------------------------RFGNEI-IMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITS--LNDSTYDGP-LERRKLSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPGYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDR-NPSARYVTIPLKHRSATALRCRFYFADTWMMFSEISFQSVTIV----LPTKKPPVLTPPSYEANSEI 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 136.346 bits (342), Expect = 3.091e-32
Identity = 90/325 (27.69%), Postives = 154/325 (47.38%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPY--EMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL---ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            S  EF +Q     L   E +    +G + +     G + +  E  P  + D   +       ++ V++++ D+  N + +F +E+  ++++N+ N+I  + V    D    +V EY    D+   L   E  S L   N++ S+  +  L+++VQ+S  + YL  L  VHRD+A RN L+   HL IK+SD  +++N + S Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C++ PY  LS+ Q+  N      N      L  P         ++ +C   +   RP+F ++H
Sbjct:  557 SVAEFPRQ----RLLFREKLGEGQFGEVHLCEAE-GLAEFLGEGAPLPEQDGRPV-------LVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSDPLC-MVTEYMENGDLNMFLSQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDR-HLTIKISDFGMSRNLYSSDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLH 851          

HSP 2 Score: 90.8929 bits (224), Expect = 4.863e-18
Identity = 89/404 (22.03%), Postives = 161/404 (39.85%), Query Frame = 1
Query:   67 DKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKG-LSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDG-RRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            D   C   L      + +D    SS   D    +YAR +    E AWC   ++  S  +++ IDL  +  L ++ T+G  +R+     +  Y      +   WI +RN                              FG  + I GN +          P I+TR++R+ P++     +C+ ++L+GC + + ++ Y   +G +       I      D +YDG  L    L  GLG+L D     +D   +  + +     +VGW        ++ + F+F   R F ++ + + N ++  V +   +   F       +E      H + +DR N   R++ + LK R+   +    +F   W+M  EI F S ++     + T +P   T  SY   ++I
Sbjct:    7 DPAHCRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN-----------------------------RFGNEI-IMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITS--LNDSTYDGP-LERRKLSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDR-NPSARYVTVPLKHRSATALRCRFYFADTWMMFSEISFQSVTIV----LPTKKPPVLTPPSYEANSEI 372          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 136.346 bits (342), Expect = 3.382e-32
Identity = 90/325 (27.69%), Postives = 154/325 (47.38%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPY--EMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL---ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            S  EF +Q     L   E +    +G + +     G + +  E  P  + D   +       ++ V++++ D+  N + +F +E+  ++++N+ N+I  + V    D    +V EY    D+   L   E  S L   N++ S+  +  L+++VQ+S  + YL  L  VHRD+A RN L+   HL IK+SD  +++N + S Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C++ PY  LS+ Q+  N      N      L  P         ++ +C   +   RP+F ++H
Sbjct:  569 SVAEFPRQ----RLLFREKLGEGQFGEVHLCEAE-GLAEFLGEGAPLPEQDGRPV-------LVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSDPLC-MVTEYMENGDLNMFLSQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDR-HLTIKISDFGMSRNLYSSDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLH 863          

HSP 2 Score: 90.8929 bits (224), Expect = 4.959e-18
Identity = 89/404 (22.03%), Postives = 161/404 (39.85%), Query Frame = 1
Query:   67 DKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKG-LSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDG-RRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            D   C   L      + +D    SS   D    +YAR +    E AWC   ++  S  +++ IDL  +  L ++ T+G  +R+     +  Y      +   WI +RN                              FG  + I GN +          P I+TR++R+ P++     +C+ ++L+GC + + ++ Y   +G +       I      D +YDG  L    L  GLG+L D     +D   +  + +     +VGW        ++ + F+F   R F ++ + + N ++  V +   +   F       +E      H + +DR N   R++ + LK R+   +    +F   W+M  EI F S ++     + T +P   T  SY   ++I
Sbjct:   19 DPAHCRYPLGMEDGRIKNDDITASSQWYDSTGPQYARLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN-----------------------------RFGNEI-IMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITS--LNDSTYDGP-LERRKLSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDR-NPSARYVTVPLKHRSATALRCRFYFADTWMMFSEISFQSVTIV----LPTKKPPVLTPPSYEANSEI 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2a [Source:ZFIN;Acc:ZDB-GENE-090316-2])

HSP 1 Score: 120.553 bits (301), Expect = 2.972e-27
Identity = 83/325 (25.54%), Postives = 147/325 (45.23%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL-----ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            +  EF ++L    L   E +    +G + +           M+ + D D S    +    ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V    D    ++ EY    D+   L     E +  L SN   +S   S   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+  +C++ PY  LS+ Q+  N      + +    L  P         ++  C      +RP+F+EIH
Sbjct:  566 AVEEFSRKL----LTFKEKLGEGQFGEVHLCEAE------GMQDFMDKDFSFDVTENQTVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCMSSDPLC-MITEYMENGDLNQFLSRHEPEGMIALLSNAPTVSY--SNLHHMASQIASGMKYLSSLNFVHRDLATRNCLVGK-NFTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTSSDVWAFGVTLWEMLTFCKEQPYSQLSDEQVIENTGEFFRDQRRQIYLPQPPMCPDPVYKLMLSCWHRNTKERPSFQEIH 860          

HSP 2 Score: 101.293 bits (251), Expect = 2.968e-21
Identity = 95/411 (23.11%), Postives = 169/411 (41.12%), Query Frame = 1
Query:   10 MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQP 1212
            MHF +  +  LS       +   C   L  +R  + D+    SS +     AKY R D    + AWCP       + KEF+ IDL S++ + ++ T+G  RH     + +   YKI+  ++   WI +RN    +                               I GN++          P I+ R++R  P+  H   +C+ ++LYGC + + ++ Y    G       + I   Y  D  YDG + ++  +  GLG+LTD     +D   ++ +N+     +VGW+   F   ++ I+F F   R F  + +   N ++  V   +++   F S+         ++ +   D  N   R++ + L       +    +F   W+M  EI F S++  ++ N   T P
Sbjct:   15 MHFPLLILLYLSGAVQSQVNPGVCRSPLGMSRGQILDEDISASSQWSESTAAKYGRLDCEEGDGAWCPEIPAEPENMKEFLQIDLRSLHFITLVGTQG--RHAGGIGNEFAQTYKIKYSRDGSRWISWRNRQGKEV------------------------------IEGNRNAYDIVLKDLEPPIIARFVRFMPVIDHSMNVCMRVELYGCEWLDGLVSYNSPLGQQMSLNGQHI---YLNDSVYDGAMSYS--MTEGLGQLTDGMCGLDDFTLSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSRRVKTFQKVVCYFRSELDW--EATPVSFSPVMDDVNPSARFVTVSLYNHMASAIKCQYYFSDIWMMFSEITFQSDT--AMYNTTLTPP 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 126.331 bits (316), Expect = 5.300e-29
Identity = 82/322 (25.47%), Postives = 147/322 (45.65%), Query Frame = 1
Query: 1801 VKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFF 2754
            V +   ++L+  E +    +G + +          EM P +  D  N+        + V+ ++ D     + +F +E+  ++++ H N+I    V V+D   C +  Y+ N    L    +  E  S     N++ S+ +   LY+A Q++  + YL  L  VHRD+A RN LV + +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SD + FGV +WE+F+ C++ PY  L++ Q+  N      +      L           +++ +C   +   RPTF+ IH F 
Sbjct:  516 VGEFPRNQLRLKEKLGEGQFGEVHLCEAEGLQEFLEMSPNEFSDQPNM--------VAVKMLRPDVTKTARNDFLKEIKIISRLKHPNIIRLLGVCVRDDPLCMITEYMEN--GDLNQFLSQREIRSQFTKANNIPSVSRQNLLYMAAQIAAGMKYLASLNFVHRDLATRNCLVGNSYT-IKVADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMAWESILLGKFTTCSDAWAFGVTLWEMFSLCKEQPYSVLTDEQVIENTGEFFRDQGRQIYLSQTPLCPGPVFELMMRCWSRDIKDRPTFETIHHFL 810          

HSP 2 Score: 100.138 bits (248), Expect = 8.106e-21
Identity = 84/379 (22.16%), Postives = 155/379 (40.90%), Query Frame = 1
Query:   70 KDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQ---EWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMS-------SNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSS 1170
            K SC   L  +   + D+  I SS   +    +YAR      + AWCP   +     +++ IDL  ++ + +I T+G  RH   +   +   Y+++  +    W+ +R+        H  +  +                       GN D          P I+ R+IR+ P++  P  +C+ ++LYGC++++ +  Y + +G  Y    + I   +  D +YDG L        GLG+LTD  +  +D   F  S          ++GW        ++ + F F   R F  + +   N ++  V + ++ E  F          + +   +  D +N   R++ I L++R G  +    +F   W+M  EI F S
Sbjct:   11 KASCRYALGMHDRTIRDEDIIASSQWYESTGPQYARLQREEGDGAWCPAGLLQPEDVQYLQIDLHELHFITLIGTQG--RHARATGKEFARAYRVDYSRNGGRWLSWRD--------HQGQQVM----------------------RGNVDEYEVVLADLRPPIIARYIRVIPVTKVPMTVCMRVELYGCKWSDGLTSYSVPEGETYIAPGQPIA--FLNDSTYDGYLEKRRQF-GGLGQLTDGIHGLDD---FTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFKPRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFES 351          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 126.331 bits (316), Expect = 6.117e-29
Identity = 82/322 (25.47%), Postives = 147/322 (45.65%), Query Frame = 1
Query: 1801 VKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFF 2754
            V +   ++L+  E +    +G + +          EM P +  D  N+        + V+ ++ D     + +F +E+  ++++ H N+I    V V+D   C +  Y+ N    L    +  E  S     N++ S+ +   LY+A Q++  + YL  L  VHRD+A RN LV + +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SD + FGV +WE+F+ C++ PY  L++ Q+  N      +      L           +++ +C   +   RPTF+ IH F 
Sbjct:  553 VGEFPRNQLRLKEKLGEGQFGEVHLCEAEGLQEFLEMSPNEFSDQPNM--------VAVKMLRPDVTKTARNDFLKEIKIISRLKHPNIIRLLGVCVRDDPLCMITEYMEN--GDLNQFLSQREIRSQFTKANNIPSVSRQNLLYMAAQIAAGMKYLASLNFVHRDLATRNCLVGNSYT-IKVADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMAWESILLGKFTTCSDAWAFGVTLWEMFSLCKEQPYSVLTDEQVIENTGEFFRDQGRQIYLSQTPLCPGPVFELMMRCWSRDIKDRPTFETIHHFL 847          

HSP 2 Score: 100.908 bits (250), Expect = 5.163e-21
Identity = 84/379 (22.16%), Postives = 155/379 (40.90%), Query Frame = 1
Query:   70 KDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQ---EWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMS-------SNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSS 1170
            K SC   L  +   + D+  I SS   +    +YAR      + AWCP   +     +++ IDL  ++ + +I T+G  RH   +   +   Y+++  +    W+ +R+        H  +  +                       GN D          P I+ R+IR+ P++  P  +C+ ++LYGC++++ +  Y + +G  Y    + I   +  D +YDG L        GLG+LTD  +  +D   F  S          ++GW        ++ + F F   R F  + +   N ++  V + ++ E  F          + +   +  D +N   R++ I L++R G  +    +F   W+M  EI F S
Sbjct:   11 KASCRYALGMHDRTIRDEDIIASSQWYESTGPQYARLQREEGDGAWCPAGLLQPEDVQYLQIDLHELHFITLIGTQG--RHARATGKEFARAYRVDYSRNGGRWLSWRD--------HQGQQVM----------------------RGNVDEYEVVLADLRPPIIARYIRVIPVTKVPMTVCMRVELYGCKWSDGLTSYSVPEGETYIAPGQPIA--FLNDSTYDGYLEKRRQF-GGLGQLTDGIHGLDD---FTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFKPRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFES 351          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 126.331 bits (316), Expect = 7.172e-29
Identity = 82/322 (25.47%), Postives = 147/322 (45.65%), Query Frame = 1
Query: 1801 VKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFF 2754
            V +   ++L+  E +    +G + +          EM P +  D  N+        + V+ ++ D     + +F +E+  ++++ H N+I    V V+D   C +  Y+ N    L    +  E  S     N++ S+ +   LY+A Q++  + YL  L  VHRD+A RN LV + +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SD + FGV +WE+F+ C++ PY  L++ Q+  N      +      L           +++ +C   +   RPTF+ IH F 
Sbjct:  577 VGEFPRNQLRLKEKLGEGQFGEVHLCEAEGLQEFLEMSPNEFSDQPNM--------VAVKMLRPDVTKTARNDFLKEIKIISRLKHPNIIRLLGVCVRDDPLCMITEYMEN--GDLNQFLSQREIRSQFTKANNIPSVSRQNLLYMAAQIAAGMKYLASLNFVHRDLATRNCLVGNSYT-IKVADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMAWESILLGKFTTCSDAWAFGVTLWEMFSLCKEQPYSVLTDEQVIENTGEFFRDQGRQIYLSQTPLCPGPVFELMMRCWSRDIKDRPTFETIHHFL 871          

HSP 2 Score: 108.612 bits (270), Expect = 2.062e-23
Identity = 89/414 (21.50%), Postives = 170/414 (41.06%), Query Frame = 1
Query:   28 FITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQ---EWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMS-------SNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKS 1233
             + +LS +        SC   L  +   + D+  I SS   +    +YAR      + AWCP   +     +++ IDL  ++ + +I T+G  RH   +   +   Y+++  +    W+ +R+        H  +  +                       GN D          P I+ R+IR+ P++  P  +C+ ++LYGC++++ +  Y + +G  Y    + I   +  D +YDG L        GLG+LTD  +  +D   F  S          ++GW        ++ + F F   R F  + +   N ++  V + ++ E  F          + +   +  D +N   R++ I L++R G  +    +F   W+M  EI F S+   +V  +GT  P+   +++
Sbjct:    7 LLALLSGRAKCAVIPASCRYALGMHDRTIRDEDIIASSQWYESTGPQYARLQREEGDGAWCPAGLLQPEDVQYLQIDLHELHFITLIGTQG--RHARATGKEFARAYRVDYSRNGGRWLSWRD--------HQGQQVM----------------------RGNVDEYEVVLADLRPPIIARYIRVIPVTKVPMTVCMRVELYGCKWSDGLTSYSVPEGETYIAPGQPIA--FLNDSTYDGYLEKRRQF-GGLGQLTDGIHGLDD---FTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFKPRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFESDMGIAVPTLGTQSPTSAPAQT 382          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ntrk2 (neurotrophic receptor tyrosine kinase 2 [Source:NCBI gene;Acc:780110])

HSP 1 Score: 122.865 bits (307), Expect = 3.485e-28
Identity = 80/266 (30.08%), Postives = 132/266 (49.62%), Query Frame = 1
Query: 1960 DTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLS----ILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            D IL   K  +D+  N +++FH+E + L  + H++++ F  V  + D    +V EY    D+   L +      ++   N    + QSQ L+IA Q++  + YL     VHRD+A RN LV   +L +K+ D  ++++ + + Y+ V    +L                PIRWMP E I  + F+T+SDV+  GV +WE+F Y +Q P+  LSN ++          I   + L+ P++  +E  D++  C   E   R   KEIH
Sbjct:  351 DKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGD-PLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNRPAELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGE-NLLVKIGDFGMSRDVYSTDYYRVGGHTML----------------PIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQ-PWYQLSNNEVI-------ECITQGRVLQRPRTCPKEVYDLMLGCWQREPHMRLNIKEIH 590          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ntrk2 (neurotrophic receptor tyrosine kinase 2 [Source:NCBI gene;Acc:780110])

HSP 1 Score: 122.479 bits (306), Expect = 9.326e-28
Identity = 80/266 (30.08%), Postives = 132/266 (49.62%), Query Frame = 1
Query: 1960 DTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLS----ILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            D IL   K  +D+  N +++FH+E + L  + H++++ F  V  + D    +V EY    D+   L +      ++   N    + QSQ L+IA Q++  + YL     VHRD+A RN LV   +L +K+ D  ++++ + + Y+ V    +L                PIRWMP E I  + F+T+SDV+  GV +WE+F Y +Q P+  LSN ++          I   + L+ P++  +E  D++  C   E   R   KEIH
Sbjct:  550 DKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGD-PLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNRPAELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLV-GENLLVKIGDFGMSRDVYSTDYYRVGGHTML----------------PIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQ-PWYQLSNNEVI-------ECITQGRVLQRPRTCPKEVYDLMLGCWQREPHMRLNIKEIH 789          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 130.183 bits (326), Expect = 3.190e-30
Identity = 77/287 (26.83%), Postives = 135/287 (47.04%), Query Frame = 1
Query: 1909 MEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNS 2769
            ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V    D    ++ EY    D+   L     L S +   ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   E   RP+F+EIH+   ++ +
Sbjct:  585 MEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITEDPLC-MITEYMENGDLNQFLSRHEPLSSCSSDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQIYLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLLLQQGA 853          

HSP 2 Score: 114.775 bits (286), Expect = 2.211e-25
Identity = 97/402 (24.13%), Postives = 167/402 (41.54%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            C   L  +  ++PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R+ P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW         I I+F F   R F  + +   N +   V + K ++  F S+   +E   ++   +  D  N   R++ + L  R    +    HF   W+M  EI F S++    +N G    S     +Y  + K+
Sbjct:   30 CRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGSRWISWRN-------RHGKQV-----------------------LDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-TAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA-AMYNNSGALPTSPMAPTTYDPMLKV 393          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 130.183 bits (326), Expect = 3.190e-30
Identity = 77/287 (26.83%), Postives = 135/287 (47.04%), Query Frame = 1
Query: 1909 MEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNS 2769
            ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V    D    ++ EY    D+   L     L S +   ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   E   RP+F+EIH+   ++ +
Sbjct:  585 MEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITEDPLC-MITEYMENGDLNQFLSRHEPLSSCSSDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQIYLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLLLQQGA 853          

HSP 2 Score: 114.775 bits (286), Expect = 2.211e-25
Identity = 97/402 (24.13%), Postives = 167/402 (41.54%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            C   L  +  ++PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R+ P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW         I I+F F   R F  + +   N +   V + K ++  F S+   +E   ++   +  D  N   R++ + L  R    +    HF   W+M  EI F S++    +N G    S     +Y  + K+
Sbjct:   30 CRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGSRWISWRN-------RHGKQV-----------------------LDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-TAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA-AMYNNSGALPTSPMAPTTYDPMLKV 393          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 130.183 bits (326), Expect = 3.190e-30
Identity = 77/287 (26.83%), Postives = 135/287 (47.04%), Query Frame = 1
Query: 1909 MEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNS 2769
            ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V    D    ++ EY    D+   L     L S +   ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   E   RP+F+EIH+   ++ +
Sbjct:  585 MEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITEDPLC-MITEYMENGDLNQFLSRHEPLSSCSSDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQIYLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLLLQQGA 853          

HSP 2 Score: 114.775 bits (286), Expect = 2.211e-25
Identity = 97/402 (24.13%), Postives = 167/402 (41.54%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            C   L  +  ++PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R+ P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW         I I+F F   R F  + +   N +   V + K ++  F S+   +E   ++   +  D  N   R++ + L  R    +    HF   W+M  EI F S++    +N G    S     +Y  + K+
Sbjct:   30 CRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGSRWISWRN-------RHGKQV-----------------------LDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-TAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA-AMYNNSGALPTSPMAPTTYDPMLKV 393          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 123.25 bits (308), Expect = 4.383e-28
Identity = 80/325 (24.62%), Postives = 151/325 (46.46%), Query Frame = 1
Query: 1819 SELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIE---GKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYV----VNEYTSLMDIFT-LLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFS 2757
            S L+  E +    +G + +          E+E  +D+ +S+      K    ++ V+ ++ D+  N + +F +E+  ++++   N+I    V VQD   C +  Y+    +N++ S   +     + LS    ++   +I     L++  Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+ V                +   ++PIRWM WE I    F+T SDV+ FGV +WE+   C+  P+  L++ Q+  N      +      L  P +  +   +++ +C   E  QRP F ++H F +
Sbjct:  569 SRLRFKEKLGEGQFGEVHLC---------EVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGE-NFTIKIADFGMSRNLYAGDYYRV----------------QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLA 867          

HSP 2 Score: 94.7449 bits (234), Expect = 3.101e-19
Identity = 79/351 (22.51%), Postives = 142/351 (40.46%), Query Frame = 1
Query:  160 AKYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLH-TDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDG----VLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSN 1194
            A+++R +SS  + AWCP   V    +E++ +DL  ++++ ++ T+G  RH       +             R R   + ++W+   D+    +                   ISGN+D          P +V R +R YP +     +CL ++LYGC + + ++ Y    G      E  +   +  D +YDG     L + G+ +   G +   D+ ++         + +VGWS   F   ++ + F F   R F  + +   N  T    LP  +E  F         G+ + HA+     +   R I + L    GRF+     F   W++  EI F S+ +   S+
Sbjct:   60 ARHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQG--RHAGGLGKEFSRS---------YRLRYSRDGRRWMDWKDRWGQEV-------------------ISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMV---HLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYD-YVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVNDSSD 376          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 123.25 bits (308), Expect = 5.211e-28
Identity = 80/325 (24.62%), Postives = 151/325 (46.46%), Query Frame = 1
Query: 1819 SELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIE---GKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYV----VNEYTSLMDIFT-LLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFS 2757
            S L+  E +    +G + +          E+E  +D+ +S+      K    ++ V+ ++ D+  N + +F +E+  ++++   N+I    V VQD   C +  Y+    +N++ S   +     + LS    ++   +I     L++  Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+ V                +   ++PIRWM WE I    F+T SDV+ FGV +WE+   C+  P+  L++ Q+  N      +      L  P +  +   +++ +C   E  QRP F ++H F +
Sbjct:  606 SRLRFKEKLGEGQFGEVHLC---------EVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGE-NFTIKIADFGMSRNLYAGDYYRV----------------QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLA 904          

HSP 2 Score: 94.7449 bits (234), Expect = 3.264e-19
Identity = 79/352 (22.44%), Postives = 142/352 (40.34%), Query Frame = 1
Query:  160 AKYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLH-TDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDG----VLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNV 1197
            A+++R +SS  + AWCP   V    +E++ +DL  ++++ ++ T+G  RH       +             R R   + ++W+   D+    +                   ISGN+D          P +V R +R YP +     +CL ++LYGC + + ++ Y    G      E  +   +  D +YDG     L + G+ +   G +   D+ ++         + +VGWS   F   ++ + F F   R F  + +   N  T    LP  +E  F         G+ + HA+     +   R I + L    GRF+     F   W++  EI F S+ +   S+ 
Sbjct:   60 ARHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQG--RHAGGLGKEFSRS---------YRLRYSRDGRRWMDWKDRWGQEV-------------------ISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMV---HLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYD-YVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVNDSSDT 377          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q62371|DDR2_MOUSE (Discoidin domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ddr2 PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 2.231e-29
Identity = 77/287 (26.83%), Postives = 135/287 (47.04%), Query Frame = 1
Query: 1909 MEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNS 2769
            ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V    D    ++ EY    D+   L     L S +   ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   E   RP+F+EIH+   ++ +
Sbjct:  585 MEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITEDPLC-MITEYMENGDLNQFLSRHEPLSSCSSDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQIYLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLLLQQGA 853          

HSP 2 Score: 114.775 bits (286), Expect = 1.546e-24
Identity = 97/402 (24.13%), Postives = 167/402 (41.54%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKI 1254
            C   L  +  ++PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R+ P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW         I I+F F   R F  + +   N +   V + K ++  F S+   +E   ++   +  D  N   R++ + L  R    +    HF   W+M  EI F S++    +N G    S     +Y  + K+
Sbjct:   30 CRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGSRWISWRN-------RHGKQV-----------------------LDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-TAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA-AMYNNSGALPTSPMAPTTYDPMLKV 393          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q16832|DDR2_HUMAN (Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 3.533e-28
Identity = 89/370 (24.05%), Postives = 160/370 (43.24%), Query Frame = 1
Query: 1708 GPLGNSQMYRMNLINFISTTNYPEFS--------------SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKC--DLASYVVNEYTSLMDIFTLLESLSIL-QSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKN 2766
            GP G       +++N    T    +S              +  EF ++L    L   E +    +G + +           ME +KD D +         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V   C  D    ++ EY    D+   L        S++D+ ++  +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE F +CQ+ PY  LS+ Q+  N      +      L  P         ++  C   +   RP+F+EIH+   ++ 
Sbjct:  514 GPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPRKL----LTFKEKLGEGQFGEVHLCEVE------GMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQG 853          

HSP 2 Score: 112.464 bits (280), Expect = 6.925e-24
Identity = 93/376 (24.73%), Postives = 158/376 (42.02%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSES 1176
            C   L  +   +PD+    SS +     AKY R DS   + AWCP   V  +  KEF+ IDL +++ + ++ T+G  RH       +   YKI   ++   WI +RN        H  +                        + GN +          P IV R++R  P++ H   +C+ ++LYGC + + ++ Y    G  +      I   Y  D  YDG + ++  +  GLG+LTD     +D    + +++     +VGW        +I I+F F   R F  + +   N +   V + K ++  F S+   +E   +I+  +  D  N   R++ + L  R    +    HF   W+M  EI F S++
Sbjct:   30 CRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQG--RHAGGHGIEFAPMYKINYSRDGTRWISWRN-------RHGKQV-----------------------LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII--YLNDSVYDGAVGYS--MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEP-NAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDA 368          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q24488|ROR1_DROME (Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster OX=7227 GN=Ror PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.206e-27
Identity = 78/262 (29.77%), Postives = 142/262 (54.20%), Query Frame = 1
Query: 1969 LCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFV-VVQDK---CDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            + ++ +K+++ V  +++F +E++ ++ + H+N++  + VV +K   C L  Y+ N      D+   L    I  S  +  S+ Q +FL IA+Q+S+ + YL     VHRD+A RN LV    L +K+SD  ++++ + S Y+ V                +S  L+P+RWMP E I    F+T+SDV+ FGV +WE+++Y  Q PY   SN ++        + I+  Q L  P++       ++ +C  +++++RPTF +I
Sbjct:  439 VAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANG-----DLHEFL----ISNSPTEGKSLSQLEFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNE-GLVVKISDFGLSRDIYSSDYYRV----------------QSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQ-PYYGFSNQEVI-------NLIRSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q03146|DDR1_MOUSE (Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 3.645e-27
Identity = 80/325 (24.62%), Postives = 151/325 (46.46%), Query Frame = 1
Query: 1819 SELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIE---GKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDK--CDLASYV----VNEYTSLMDIFT-LLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFS 2757
            S L+  E +    +G + +          E+E  +D+ +S+      K    ++ V+ ++ D+  N + +F +E+  ++++   N+I    V VQD   C +  Y+    +N++ S   +     + LS    ++   +I     L++  Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+ V                +   ++PIRWM WE I    F+T SDV+ FGV +WE+   C+  P+  L++ Q+  N      +      L  P +  +   +++ +C   E  QRP F ++H F +
Sbjct:  606 SRLRFKEKLGEGQFGEVHLC---------EVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGE-NFTIKIADFGMSRNLYAGDYYRV----------------QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFLA 904          

HSP 2 Score: 94.7449 bits (234), Expect = 2.283e-18
Identity = 79/352 (22.44%), Postives = 142/352 (40.34%), Query Frame = 1
Query:  160 AKYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLH-TDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDG----VLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNV 1197
            A+++R +SS  + AWCP   V    +E++ +DL  ++++ ++ T+G  RH       +             R R   + ++W+   D+    +                   ISGN+D          P +V R +R YP +     +CL ++LYGC + + ++ Y    G      E  +   +  D +YDG     L + G+ +   G +   D+ ++         + +VGWS   F   ++ + F F   R F  + +   N  T    LP  +E  F         G+ + HA+     +   R I + L    GRF+     F   W++  EI F S+ +   S+ 
Sbjct:   60 ARHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQG--RHAGGLGKEFSRS---------YRLRYSRDGRRWMDWKDRWGQEV-------------------ISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMV---HLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYD-YVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVNDSSDT 377          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q95ZV7|DDRB_CAEEL (Discoidin domain-containing receptor tyrosine kinase B OS=Caenorhabditis elegans OX=6239 GN=ddr-2 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 5.170e-27
Identity = 84/284 (29.58%), Postives = 138/284 (48.59%), Query Frame = 1
Query: 1945 EGKFSDTILC--------VRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLIS-------IEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETI-DIIEQCLVDEALQRPTFKEIHI 2748
            +G+F +  LC        V+K+   S  + + +FH+E+  L  + H N++  V V   C +             I  ++E +     N DL S       I+ SQ + I  QL+  L+YLE    VHRDIA RN LV      +K++D  +A++ +  +Y++V                +   ++PIRWM WE +    FST SDV+GFGV MWE+F+ C + PY  +++  +  N  S++S     Q L  P+    +   + I  C   E+ +RP+F+ +H+
Sbjct:  535 QGEFGEVDLCQLENRKVAVKKLHGISQAD-EFSFHREIRVLGSLKHPNVVEVVGV---CTIQK----------PILCIMEYME----NGDLKSYILKNPTIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEG-NVKIADFGMARSLYSQEYYKV----------------EGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHL 783          

HSP 2 Score: 75.0998 bits (183), Expect = 2.630e-12
Identity = 88/378 (23.28%), Postives = 162/378 (42.86%), Query Frame = 1
Query:   64 EDKDSCYQKLLTNRTNVPDDAFIVSSFEID----YEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL--SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINH-AIKEDRENFDTRWIVIDLKKRTGRFVSINLHF--QSQWIMVREILFSS 1170
            E ++  +Q  ++NR    +     SSF++       A+  ++S     AWCP+ ++++ +KE++ I      V+  + T+G      G + A+ + I+Y       W  Y++  E +     + T   I                       + HL          IV       P+S+    +C+ ++++GC + ++++ Y +  G L    +  I    + D SYDG L ++  L  G+GKL  +D E   NN F ++ + +VGW R   +  ++ + F F   R    + +  +N +  S        + FS +G+ F    +I H    ED E+   RWI I +  R  +   I L+F   S W+ + E+ F S
Sbjct:   21 ELRECSHQLGMSNRKIRDEQISASSSFDLQSTGPQHARAHQESG--SGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAI-----------------------RRHLDRAIIARRIRIV-------PVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQGDL----QSGIS---YHDFSYDGNLANSPHLTGGIGKL--YDGEVGKNNVF-VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFS--DTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 352          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: K7FA64 (Uncharacterized protein OS=Pelodiscus sinensis OX=13735 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.057e-48
Identity = 205/922 (22.23%), Postives = 371/922 (40.24%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSSFEIDYEA-KYAR-DSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGL-SRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSN-------PFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLS-------TLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQS---NNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKS----SLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSG 2772
            C   L  +   + D+    SS   D    +YAR      + AWCP   +     +F+ IDL  ++ + +I T+G  +R   K  +  Y        + WI +++                 G V                I GN D          P I+ R+IR+ P++  P  +C+ ++LYGC + + +  Y + +G         I   Y  D +YDG       L  GLG+LTD     +D   F  S          ++GW    F    + + F+F   R F ++ +   N +   V +  + +  +  D         +  +   D +N   R++ I L +R G+ V    HF   W+M+ EI F S  L           +    K+  + T ++V      I  +     + L   ++           +  S            S D     IL+L H N+++ ++ Y     S       T+++K   EE    F  M +P++       D+     +    H  + +   +++     +TD+  + ++G  GN+ MY +  +   S T   + S     V +  + +L+  E +    +G + +     G   +       +  S++E      ++ V+ ++ +     + +F +E+  ++++   N+I  + V  + D    ++ EY    D+   L    I  S   +N++  +  S  L++A Q++  + YL  L  VHRD+A RN LV + +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C++ PY  LS+ Q+  N      S    I   Q+   P +      D++ +C   +   RPTF  IH F  ++  G
Sbjct:    4 CRYPLGMHEGTIRDEDITASSQWYDSTGPQYARLQREEGDGAWCPAGLLQPEDVQFLQIDLHKLFFITLIGTQGRHARATGKEFARAYRIDYSRNGERWISWKDRQG--------------GQV----------------IQGNTDTYDVVLKDLRPPIIARYIRVIPVTELPMTVCMRVELYGCLWFDGLASYSIPEGGTIAAPGSPIV--YLNDSTYDG-FQERRHLYGGLGQLTDGVLGLDD---FTQSHQYRVWPGYDYIGWKNESFSAGFVEMEFQFDRQRNFTSMKVHCNNMFPKGVKIFHKADCEWEPD--------PVGVSTILDDKNPSARFVTIPLNQRVGKAVLCRFHFADTWLMISEISFQSVCLLCTETTSVLTSTWVGEKADDSSTSVLVGCLVAIILLLLAFIVVILWKQYVHKRLAKGYSNNEDDSI-----------STDFTCISILSLVH-NLRDSSVLYLGCGPSFSDTFQCTVSSKCPQEEL---FSMMYLPQSEQPACSGDYAEPDLTKSTPHQGFQNNVPHYA-----ETDI--VSLQGVTGNN-MYAVPALTVDSLTK-KDIS-----VGEFPWQQLRLKEKLGEGQFGEVHLCEAD-GLLEF-------LGLSSLELPTQPVLVAVKMLRSNVNKTARNDFLKEIKIMSRLKDPNIIRLLGVCVR-DDPLCMITEYMENGDLNQFLSQREICSSFALSNNIPCVSYSNLLFMATQIASGMKYLASLNFVHRDLATRNCLVGNSYT-IKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEMFTLCKEQPYSLLSDEQVIENTGEFFRSQGRQIYLSQTPLCPNA----VFDLMLKCWSRDIKDRPTFDMIHHFLVEQMDG 822          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A4S2LYV3 (F5/8 type C domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005019 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.309e-39
Identity = 120/436 (27.52%), Postives = 191/436 (43.81%), Query Frame = 1
Query:   28 FITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA--KYARDSSLIE---KAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSL----YYNQEKK---IKEP------------------YFTDQSYDGVLLHTG-MLKSGLGKLTDHDYEKNDNNPFNMSSN---P--------------FVGW-------SRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSS 1170
             ++  ++   +  ++ +C Q L  +R  +P  AF  +S ++D     +YA D+   E    AWCPR +V     EF+ +D+G + V+  ++  GL   G  S    +          +IRY+  S   +W    +T+  +  V               ++ G+   L  KF +  P +V RWIRIYP    P  +C+ L+ YGCR T++++EYQ+ +GS+    Y+        +K P                   F+D SYDG  +  G +L  GLG LTD      +  P  M+++   P              FVGW       S+++ + D + ++FRF   R F  + L A+N +   V LP+RIE+ FS  G  F     I      D        I +DL  R GR V +   F  +W++  EI F S
Sbjct:   55 LVSAETVGEQINSEQSACVQSLFLDRYRIPSTAFTATSEQVDTTGSRRYAADAVRTENTDSAWCPRNRVGPELSEFVQVDMGELNVITKLVISGLLVEGGGSRFAPHF---------FIRYKRESTESEW----RTYRQLRPV------------QTPQLLGSGSALVPKFVVLDPPVVARWIRIYPYRDSPGFVCIRLEAYGCRSTDDLVEYQIPEGSIAVPPYHAPPSSNVLLKPPKDRTKDNHTRYYQAGGGSAFSDTSYDGYRIEPGSLLDGGLGCLTDLGIAPQNVAPTPMATSVSIPSSVRGGSSEESNRWFVGWHRDRWRMSKTEGREDVVDMLFRFTTIRSFKRLKLYASNNYREKVRLPRRIELRFSIRGVLFSGQPVITQDFLPDNRTNGVMSIELDLNDRIGRVVQLKAFFADEWMLFSEIKFQS 465          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: G4V7C2 (Putative discoidin domain receptor OS=Schistosoma mansoni OX=6183 GN=Smp_150730 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 3.848e-39
Identity = 118/426 (27.70%), Postives = 187/426 (43.90%), Query Frame = 1
Query:   46 IKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEID------YEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYY-----------------------NQEKKIKEPYFTDQSYDGVLLHTG-MLKSGLGKLTDHDYEKNDNNP-----FNMSSNP-------FVGWSRSDFKF------DHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESL 1179
            I+N    DK  C Q LL NR  +PD AF  +S  +D      Y A   R+ +  + AWCP  ++     E++ ID+G + ++  ++  GL   G  S    Y          +IRY+     + W             ++ L P      +I ++ G  D L  KF +  P ++ RWIRIYP    P  +C+ L+ YGCR++++++EY++ +GSL +                       N  +      F+D  YDG  +  G +L  GLG L D +    D  P       +SS         FVGW R  +K       D + ++FRF + R F  + L  +N +   + LP+R+E+ FS  G  F     I+   K +  +     I++DL  R G+ V +   F   W++  EI F SE +
Sbjct:   45 IQNDYDLDKTKCIQSLLVNRHQIPDSAFNATSEVVDPSGAKRYNAHSIRNEN-TDFAWCPGKRISTECDEYVEIDMGELNIITKVVISGLLAEGGGSRYTPYF---------YIRYKREINEENW-----------RTYRQLRPT-----IISRLLGGLDALVPKFVVLDPPLIARWIRIYPYRDTPGFVCIRLEAYGCRFSDDLVEYRIPEGSLAHPPYQAETNLYKSQGSEVFTTEKLNSSQAGGGLPFSDTCYDGHRIEPGSLLDGGLGCLIDLNSANRDTIPSIRQTVGVSSKADSSMNHQFVGWHRDRWKSSQDKDNDVVDMLFRFASVRNFTRLRLYISNNYLEKIRLPRRLEVKFSVGGVHFSGQLPISREFKLENRSLGVFSIILDLSHRIGQVVQLKAFFADDWLLFSEIRFESEKV 444          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A5J4NMD0 (Discoidin domain receptor family member 2 OS=Paragonimus westermani OX=34504 GN=DEA37_0002294 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 4.107e-39
Identity = 129/486 (26.54%), Postives = 205/486 (42.18%), Query Frame = 1
Query:   19 IMNFITILSIKNAL-----------TEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEA--KYARDSSLIEKA---WCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYY--------NQEKKIKE-------------------PYFTDQSYDGVLLHTG-MLKSGLGKLTDHDYEKNDNNPFNMSSNP--------FVGWSRSDFKF------------DHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSE-SLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITI 1281
            I N + +L I  A+           + D++ C Q LL+NR  +P  AF  +S +ID     +Y+ DS   E A   WCP  +V     EF+  D+G + V+  I+  GL   G  S    +          +IRY+   + + W            +++ L P         ++ G+   L  KF +  P ++ RWIRIYP    P  +C+ L+ YGCR+T++++EYQ+ +G + +        +  + +K                    P F+D  YDG  +  G +L  GLG LTD      +  P  + + P         VGW R  ++             D + ++FRF   R F  + L  +N +   + LP+RIE+ FS  G  F     I+     D        I + L  R GRFV + + F   W+++ E+ F S  S+ES        PS     S   L  +IV +  I +
Sbjct:   32 IANLLVLLHILPAVWAHVERIPDYHSHDQEQCIQSLLSNRYRMPPTAFNATSEQIDSTGARRYSADSVRAEHADFAWCPVKRVGTELNEFVQADMGELNVITKIVISGLLTEGGGSRFTPHF---------YIRYKREPDEQTW-----------RIYRQLYPTQTS-----QLVGSNSPLVPKFVVLDPPLIARWIRIYPYRDPPGFVCVRLEAYGCRFTDDLVEYQIPEGCVIHPPYQAPSTSHSQMLKPPKSTKPIDNRTRYYQAGGGPAFSDVCYDGYRVEPGSLLDGGLGCLTDLGIAPQNTLPRGLITEPAPDSSRHWLVGWHRDRWRTKARTESASEESEDVVDMLFRFATVRNFKRLKLYVSNNYQEKIRLPRRIEVRFSIRGLLFSGQPVISQDYLLDNRTNGVMNIELSLDNRIGRFVQLKVFFADDWLLLSEVKFYSPFSVESAK-----IPSGLADLSDRHLLIVIVLALVIAL 487          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A183QKB0 (F5/8 type C domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.821e-39
Identity = 118/426 (27.70%), Postives = 187/426 (43.90%), Query Frame = 1
Query:   46 IKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEID------YEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYY-----------------------NQEKKIKEPYFTDQSYDGVLLHTG-MLKSGLGKLTDHDYEKNDNNP-----FNMSSNP-------FVGWSRSDFKF------DHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESL 1179
            I+N    DK  C Q LL NR  +PD AF  +S  +D      Y A   R+ +  + AWCP  ++     E++ ID+G + ++  ++  GL   G  S    Y          +IRY+     + W             ++ L P      +I ++ G  D L  KF +  P ++ RWIRIYP    P  +C+ L+ YGCR++++++EY++ +GSL +                       N  +      F+D  YDG  +  G +L  GLG L D +    D  P       +SS         FVGW R  +K       D + ++FRF + R F  + L  +N +   + LP+R+E+ FS  G  F     I+   K +  +     I++DL  R G+ V +   F   W++  EI F SE +
Sbjct:   47 IQNDYDLDKTKCIQSLLVNRHQIPDSAFNATSEVVDPSGAKRYNAHSIRNEN-TDFAWCPGKRISTECDEYVEIDMGELNIITKVVISGLLAEGGGSRYTPYF---------YIRYKREINEENW-----------RTYRQLRPT-----IISRLLGGLDALVPKFVVLDPPLIARWIRIYPYRDTPGFVCIRLEAYGCRFSDDLVEYRIPEGSLAHPPYQAETNLYKSQGSEVFNTEKLNSSQAGGGLPFSDTCYDGHRIEPGSLLDGGLGCLIDLNSANRDTIPSIRQTVGVSSKADSSMNHQFVGWHRDRWKSSQDKDNDVVDMLFRFASVRNFTRLRLYISNNYLEKIRLPRRLEVKFSVGGVHFSGQLPISREFKLENRSLGVFSIILDLSHRIGQVVQLKAFFADDWLLFSEIRFESEKV 446          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 126.716 bits (317), Expect = 2.483e-29
Identity = 82/308 (26.62%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1837 ENISNNSYGRIDVARPSIGYSPY--EMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL---ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            E +    +G + +     G + +  E  P  + D  ++       ++ V++++ D+  N + +F +E+  ++++N  N+I  + V  + D    +V EY    D+   L   E  S L   N++ S+  +  L++AVQ++  + YL  L  VHRD+A RN L+    L IK+SD  +++N + S Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C + PY  L++ Q+  N      N      L  P        +++ +C   +   RP+F  ++
Sbjct:  536 EKLGEGQFGEVHLCEAE-GLAEFLGEGAPLPEQDGRSV-------LVAVKQLRADATSNARNDFLKEIKIMSRLNDPNIIRLLCVCVRSDPLC-MVTEYMENGDLNMFLSQRELESTLTHANNIPSVSMADLLHMAVQIASGMKYLASLNFVHRDLATRNCLLDR-QLTIKISDFGMSRNLYSSDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCTEQPYSLLTDEQVIENSGEFFRNQGRQIYLSPPPLCPPSLYELMMRCWSRDIRDRPSFSSLY 817          

HSP 2 Score: 56.6102 bits (135), Expect = 1.408e-7
Identity = 42/195 (21.54%), Postives = 79/195 (40.51%), Query Frame = 1
Query:  613 LYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFT-----DQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSS 1170
            ++GC + + +  Y   +G       + +  P F      D +YDGVL    +L  GLG+LTD    ++D      + +     ++GW        ++ + F+F   R F ++ +   N ++  V +   +   F          + +  +   D  N   R++ + L +R+G        F   W+M  EI F S
Sbjct:  143 VFGCPWQDGLTAYSAPEG-------QTMMAPGFPNTLLNDSTYDGVLERRKLL-GGLGQLTDGVIGQDDFVQTRQYQLWPGYDYLGWRNDSLGPGYVEMEFQFDRQRNFTSMKVHCNNMFSRGVKVFSSVSCVFKPHLISEWEAEPVVFSTVLDDRNPSARYVTVPLLQRSGTATRCRFFFADTWMMFSEISFHS 329          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103037878])

HSP 1 Score: 122.479 bits (306), Expect = 6.503e-28
Identity = 85/325 (26.15%), Postives = 147/325 (45.23%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL-----ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            +  EF ++L    L   E +    +G + +          +ME Y D D S         ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V    D    ++ EY    D+   L     E +  L SN   +S   +   ++A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE   +C++ PY  LS+ Q+  N      + +    L  P         ++  C    A +RP+F+EIH
Sbjct:  566 AVEEFPRKL----LTFKEKLGEGQFGEVHLCEAE------DMEDYMDEDFSFDVSDNQTVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCMSSDPLC-MITEYMENGDLNQFLSRHEPEGMIALLSNAPTVSY--NNLHHMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETLTFCKEQPYSQLSDEQVIENTGEFFRDQRRQIYLPQPPLCPDPAYKLMLSCWNRNAKERPSFQEIH 860          

HSP 2 Score: 100.908 bits (250), Expect = 3.254e-21
Identity = 83/348 (23.85%), Postives = 147/348 (42.24%), Query Frame = 1
Query:  160 AKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSES 1176
            AKY R D    + AWCP       + KEF+ IDL S++ + ++ T+G  RH     + +   YKI+  ++   WI +RN        H  +                        I GN++          P I+ R++R  P+  H   +C+ ++LYGC + + ++ Y    G       + I   Y  D  YDG + ++  +  GLG+LTD     +D   ++ +N+     +VGW+   F   ++ I+F F   R F  + +   N ++  V   +++   F S+        S +  +  D  N   R++ + L       +    +F   W+M  EI F S++
Sbjct:   66 AKYGRLDCEEGDGAWCPEIPGEPENMKEFLQIDLRSLHFITLVGTQG--RHAGGIGNEFAQTYKIKYSRDGSRWISWRN-------RHGKQV-----------------------IEGNRNAYDVVLQDLQPPIIARFVRFMPVIDHSMNVCMRVELYGCEWLDGLVSYNAPLGQKMILHSQPI---YLNDSVYDGAMSYS--MTEGLGQLTDGMCGLDDFTFSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSQRVKTFQKVVCYFRSESDWEPTPVSFSPVV--DDVNPSARFVTVSLNNHMASAIKCQYYFSDMWMMFSEITFQSDT 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 122.094 bits (305), Expect = 1.002e-27
Identity = 89/382 (23.30%), Postives = 162/382 (42.41%), Query Frame = 1
Query: 1753 FISTTNYPEFSSFHEFVKQLNFSELKTIENIS-NNSYGRIDVARPSIGYSPYEMEPYKDMDNSNI-------EGKFSDTILC----------------VRK----------IKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDL---ISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTS---------PHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSK 2760
             +S  +Y E S     V     +++ +++ +S NN+Y     A P++  +P +  P  ++    +       EG+F +  LC                VRK          ++ D+  N + +F +E+  L+++   N+I  + V    D    +V EY    D+   L    +L     L    +I     + +A Q++  + +L  L  VHRD+A RN LV              +IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+ + CQ+ PY  +++ Q+  N      +      L  P    +   +++  C   +   RP+F  +H F ++
Sbjct:  570 LLSGAHYAEASGGGASVPHYAEADIISLQGVSGNNTY-----AVPALSATPTDCPPLPELPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSSDPLC-MVTEYMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYR----------------IQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAE 929          

HSP 2 Score: 94.3597 bits (233), Expect = 3.102e-19
Identity = 84/355 (23.66%), Postives = 145/355 (40.85%), Query Frame = 1
Query:  157 EAKYARDSSL-IEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXX-XXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSN-------PFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIK-EDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVS 1191
            EAK+ R S+   + AWCP   V  S  EF+ ++L  ++ L ++ T+G    G+    +  Y      + ++WI +++     +W                             ISGN++          P I+ R +R YP++     +CL ++LYGC + + +  Y    G + +     I   Y  D  YDG  +  G L  GLG+L D     +D   F  S          +VGWSR       + I F F   R F  + + + N  T  V +   +   F +         ++   +  ED ++  +R + + L  R  + +  +  F  +W+++ EI F+SE  E  S
Sbjct:   62 EAKHGRLSTGEGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGRQWITWKD-----RWGQE-------------------------VISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPI---YLNDSIYDGS-IEAGTLFGGLGQLCDGVLGGDD---FMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEPFEGSS 379          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019857.2 (discoidin domain-containing receptor 2-like [Source:NCBI gene;Acc:103025914])

HSP 1 Score: 121.324 bits (303), Expect = 1.243e-27
Identity = 73/283 (25.80%), Postives = 133/283 (47.00%), Query Frame = 1
Query: 1909 MEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDL----ISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            M+ +   D   +E +    ++ V+ +++D+  N + +F +E+  ++++   N+I  + V  + D    ++ EY    D+   L    +  S  +      +I  S  + +A Q++  + YL  L  VHRD+A RN LV + +  IK++D  +++N +R  Y+                 I+   ++PIRWM WE I    F+  SDV+ FGV +WE    C++ PY  LS+ Q+  N      +      L  P         +++ C    A +RP+F+ IH
Sbjct:  579 MQDFMKEDEDGVENE--PILVAVKTLREDATKNTRNDFLKEIRIMSRLRDPNIIRLLAVCVESDPLC-MITEYMENGDLNKFLSRHKLQDSGEEQKDTSSTISYSTLIRMATQIASGMKYLSSLNFVHRDLATRNCLVGT-NYTIKIADFGMSRNLYRGDYYR----------------IQGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWETLTLCKEQPYSQLSDDQVIENTGEFFRDQNKQVYLPRPACCPDAVHSLMQSCWRRNAKERPSFQHIH 841          

HSP 2 Score: 101.293 bits (251), Expect = 2.032e-21
Identity = 92/391 (23.53%), Postives = 160/391 (40.92%), Query Frame = 1
Query:   28 FITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMS-------SNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSS 1170
            F+ ILS       +   C   L      + D+    SS +     A+Y R D    + AWCP       S KEF+ IDL +++ + ++ T+G  RH     + +   Y+I+  ++ +R+ +      W   +      G V                I GNK+          P I+ R++R  P+S     +C+ ++LYGC + + ++ Y    G     Q   +   Y  D  YDG + H+  +  GLG+LTD  +  ++   F  S          +VGW+ + F    + +VF F   R F ++ +   N +T+ V   ++    F S+       + ++   + D  N   R++ + L  R    +     F   W+M  EI F S
Sbjct:    9 FLVILSGAVRSQVNPGVCRYPLGMTGGKIQDEDISASSQWSESTAARYGRLDFDDGDGAWCPDVVAEAKSLKEFLQIDLRTLHFVTLVGTQG--RHADGMGNEFAQSYRIKYSRDGVRWVS------WHDRNG-----GQV----------------IDGNKNPYEVVLKDLEPPIIARFVRFMPVSDPSMTVCMRVELYGCEWLDGLVSYSAPVGQEMTFQNLHV---YLNDTVYDGTVDHS--MTEGLGQLTDGSWGLDN---FTQSQVYGVWPGYDYVGWTNASFPSGSVEMVFEFDRVRNFTSMKVHCNNMYTSGVRAFQQAVCYFRSESDW--EARPVSFKPEADNTNTSARFVTVALGHRMASAIKCRFAFSDAWMMFSEIAFQS 360          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 121.709 bits (304), Expect = 1.282e-27
Identity = 89/382 (23.30%), Postives = 162/382 (42.41%), Query Frame = 1
Query: 1753 FISTTNYPEFSSFHEFVKQLNFSELKTIENIS-NNSYGRIDVARPSIGYSPYEMEPYKDMDNSNI-------EGKFSDTILC----------------VRK----------IKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDL---ISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTS---------PHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSK 2760
             +S  +Y E S     V     +++ +++ +S NN+Y     A P++  +P +  P  ++    +       EG+F +  LC                VRK          ++ D+  N + +F +E+  L+++   N+I  + V    D    +V EY    D+   L    +L     L    +I     + +A Q++  + +L  L  VHRD+A RN LV              +IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+ + CQ+ PY  +++ Q+  N      +      L  P    +   +++  C   +   RP+F  +H F ++
Sbjct:  608 LLSGAHYAEASGGGASVPHYAEADIISLQGVSGNNTY-----AVPALSATPTDCPPLPELPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSSDPLC-MVTEYMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYR----------------IQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAE 967          

HSP 2 Score: 94.7449 bits (234), Expect = 2.669e-19
Identity = 84/355 (23.66%), Postives = 145/355 (40.85%), Query Frame = 1
Query:  157 EAKYARDSSL-IEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXX-XXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSN-------PFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIK-EDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVS 1191
            EAK+ R S+   + AWCP   V  S  EF+ ++L  ++ L ++ T+G    G+    +  Y      + ++WI +++     +W                             ISGN++          P I+ R +R YP++     +CL ++LYGC + + +  Y    G + +     I   Y  D  YDG  +  G L  GLG+L D     +D   F  S          +VGWSR       + I F F   R F  + + + N  T  V +   +   F +         ++   +  ED ++  +R + + L  R  + +  +  F  +W+++ EI F+SE  E  S
Sbjct:   62 EAKHGRLSTGEGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGRQWITWKD-----RWGQE-------------------------VISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPI---YLNDSIYDGS-IEAGTLFGGLGQLCDGVLGGDD---FMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEPFEGSS 379          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009339.1 (pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gene:ENSPMAG00000008449.1 transcript:ENSPMAT00000009339.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 9.704e-24
Identity = 59/211 (27.96%), Postives = 104/211 (49.29%), Query Frame = 1
Query: 2011 KENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLS--------ILQSNNDLISI--EQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKS 2613
            + +F +E+  ++++   N++  + V  + D  S ++ EY    D+   L  L             +  LIS+  +  + +Y+A Q+   ++YL  L  VHRD+A RN LV   H  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+  SDV+ FGV +WE+   C++ PY +L++ Q+  N  
Sbjct:    8 RNDFLKEIKIMSRLKDPNIVRLLGVCMRDDPLS-MITEYMVNGDLNQFLSRLPSAIGDIFIFFAPHQKLISVPPKLDKLVYMASQIVSGMAYLSSLNFVHRDLATRNCLVGEHHT-IKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMAWESILLGKFTPASDVWAFGVTLWEMLTLCREQPYGALTDEQVIENTG 200          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.198e-22
Identity = 68/270 (25.19%), Postives = 131/270 (48.52%), Query Frame = 1
Query: 2005 NVKENFHQELDNLNQINHKNLITFVVV----QDKCDLASYV----VNEYTSLMDIFTLLESLSI-----LQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQI--FVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNS 2769
            +++ NFH+E   + +  H N++  + V    +  C L  ++    +NEY         L + S        S ++ +S+  +  L++A Q++  ++YL     VHRD+A RN LV +  L +K+SD  ++Q+ + + Y++ N          +N+ I      PIRWMP E I    ++++SDV+ FGV +WE+F++  Q PY  +S+ ++  FV   ++         L  P     +  +++  C       RP+F  +    ++ ++
Sbjct:    3 DMQANFHREAALMAEFTHPNIVKLLGVCAVGKPFCLLFEFMPHGDLNEYLRRCSSEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVGN-RLVVKISDFGLSQSIYAADYYKAN----------ENDAI------PIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQ-PYFGMSHEEVIYFVRDGNV---------LACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVLARMHA 245          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 95.1301 bits (235), Expect = 4.259e-21
Identity = 73/271 (26.94%), Postives = 128/271 (47.23%), Query Frame = 1
Query: 1960 DTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITF--VVVQDKCDLASYVVNEYTSLMDI--FTLLESLSIL------QSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            + +L   K  +D     +++F++E + L  + H++++ F  V V+ +      +V EY    D+  F  L     +      Q+   L+S  Q+Q L +  Q++  ++YL     VHRD+A RN LV +  L +K+ D  ++++ + + Y+ V    +L                PIRWMP E I  + F+  SDV+  GV +WE+F Y +Q P+  LSN ++          I   + L+ P+S   E  +++  C   E   R   K+I
Sbjct:  103 EPMLVAAKTLKDLSDGARKDFYREAELLTNLQHEHIVRFYGVCVEGE---PLIMVFEYMKNGDLNKFLRLRGPDAVFMGDAPQAEPRLLS--QAQMLNMGSQIAAGMAYLASQHFVHRDLATRNCLVGA-GLVVKIGDFGMSRDVYSTDYYRVGGHTML----------------PIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTYGKQ-PWYQLSNTEVI-------DCICQGRVLERPRSCPMEVYELMLGCWHREPQHRLGIKDI 343          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 3.950e-19
Identity = 66/287 (23.00%), Postives = 123/287 (42.86%), Query Frame = 1
Query: 1918 YKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLS----------ILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQI--FVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            Y+ +    ++G+  +T + ++ + + + +  +  F  E   +   N  +++  + V  +      V+ E  +  D+ + L SL           +L+           + L +A +++D ++YL     VHRD+A RN +V      +K+ D  + ++ + + Y+                      L+P+RWM  E +    F+T SDV+ FGV +WE+    +Q PY+ LSN Q+  FV    L         L  P +      ++I +C       RPTF EI
Sbjct:   28 YEGLARGIVKGE-DETRVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQAQ-PILVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAE-DFTVKIGDFGMTRDIYETDYYRKG----------------GKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQ-PYQGLSNEQVLKFVMDGGL---------LVLPPACPERLQELIRKCWQYNPRMRPTFLEI 285          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006545.1 (pep scaffold:Pmarinus_7.0:GL476470:1226125:1235807:-1 gene:ENSPMAG00000005912.1 transcript:ENSPMAT00000006545.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 5.532e-19
Identity = 65/251 (25.90%), Postives = 124/251 (49.40%), Query Frame = 1
Query: 2005 NVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNND----LISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRS-QYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
              +  F +E+D   + +H  +   + V   C     +V EYT L D+   L+    L   +D    +  +   Q L + VQ++  + +L    LVH D+A RN LV+S +  +K+S   ++++ + S +Y+E          ++Q        LIP+RWM  E +++ D STKSDV+  GV +WE+     +LPY  L + ++F  ++  + +++P  +    ++       ++++CL      RP+F ++
Sbjct:   88 RAQAEFQREVDLFGKASHVAVARLLAV---CKEPLQMVLEYTDLGDLKQYLK----LSRGDDKEIKMKPLTAQQKLSVCVQVAQGMVHLSSQRLVHGDLAARNCLVSSDN-SVKISCPGLSRDVYISPEYFE----------HRQA-------LIPLRWMAPEAVAEGDLSTKSDVWAVGVLLWEVCTL-GELPYAKLKDEEVF--RAVQSGSLKPLST----KACLAHVSKLLQRCLAPSPRDRPSFPDV 306          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 59.6918 bits (143), Expect = 1.841e-9
Identity = 52/245 (21.22%), Postives = 108/245 (44.08%), Query Frame = 1
Query: 2029 ELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFN----YCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIF 2751
            EL  +N    +N++ F+      D   +V+ EY     +  +L++++   +      + ++Q  YI  +    L +L    ++HRDI   NIL+ S  L +K++D                  +L +  +K+  ++ + +     WM  E++++K +  K DV+  G+ + E+      Y  + P ++L  Y I  N S           L+ P+S +++T   ++ CL      R + +++  F
Sbjct:  422 ELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGL-VKITDFGFCV-------------ELTEKRSKRATMVGTPY-----WMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKAL--YLIANNGSP---------KLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTF 636          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 59.3066 bits (142), Expect = 2.566e-9
Identity = 53/239 (22.18%), Postives = 103/239 (43.10%), Query Frame = 1
Query: 2056 HKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFN----YCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI--HIFF 2754
            HKN++ F+    + D   +VV E+     +  ++E+     ++N    + + Q  YI  +    L +L    ++HRDI   N+L+ +    +K++D                  +L D  +K+  ++ + +     WM  EV+ ++++  K DV+  G+   E+      Y  + P ++L  Y I  N +           LK P+S + E    +  CL  +   R + +E+  H FF
Sbjct:  619 HKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPT--NDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDT-RARVKITDFGFCA-------------RLTDKRSKRATMVGTPY-----WMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKAL--YLIATNGTP---------KLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 825          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: SGV1 (Cyclin (Bur2p)-dependent protein kinase; part of the BUR kinase complex which functions in transcriptional regulation; phosphorylates the carboxy-terminal domain (CTD) of Rpo21p and the C-terminal repeat domain of Spt5p; recruits Spt6p to the CTD at the onset of transcription; regulated by Cak1p; similar to metazoan CDK9 proteins [Source:SGD;Acc:S000006365])

HSP 1 Score: 52.373 bits (124), Expect = 3.116e-7
Identity = 43/182 (23.63%), Postives = 84/182 (46.15%), Query Frame = 1
Query: 2026 QELDNLNQINHKNLITFVVV-----QDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRW--MPWEVISKKDFSTKSDVYGFGVCMWELF 2550
            +E+  L ++NHKN+I  + +      D  + AS  +++   ++  + + +   +L   N  I++E      + +Q+ + L+Y+     +HRDI   NIL+   +  +KL+D  +A+      Y+    P  L          K + ++  RW   P  V+  K ++T  D++G G    E F
Sbjct:  106 REITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVLH--NPRINLEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTANILIDH-NGVLKLADFGLAR-----LYYGC--PPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFF 277          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 51.9878 bits (123), Expect = 4.972e-7
Identity = 58/270 (21.48%), Postives = 115/270 (42.59%), Query Frame = 1
Query: 1951 KFSDTILCVRKI--KQDSPVNVKENFHQELDNLNQINHKNLITF-VVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLI---PIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            K +D ++ ++++  + D  +N   +   E+  L  +NH N++ +   ++   +L  Y++ EY +   +  L+   S   S N+  +      L         L YL   G++HRDI   NIL+++ +  +KL+D  ++                         ++ SS L     + WM  E++  +  ST SD++  G  + E+    +  PY +L++  I+   +  N    P      P S +    D + +C V    +RPT  ++
Sbjct:   45 KHTDQVVAIKEVVYENDEELN---DIMAEISLLKNLNHNNIVKYHGFIRKSYEL--YILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLL--------GLKYLHGEGVIHRDIKAANILLSADNT-VKLADFGVST------------------------IVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLT--KNPPYHNLTDANIYY--AVENDTYYP------PSSFSEPLKDFLSKCFVKNMYKRPTADQL 266          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 51.9878 bits (123), Expect = 5.015e-7
Identity = 55/229 (24.02%), Postives = 101/229 (44.10%), Query Frame = 1
Query: 2074 FVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI--HIFF 2754
            F   QD+  L  Y + EY    D  +L++            S++++   Y A Q+ DA+ YL   G++HRDI   NIL+    + IKL+D   A+         V+KP+   S   ++ V  + ++ P      E+++      + D++ FG  ++++     + P+++ + Y  F     +     P     FP        D++++ LV    +R T  +I  H FF
Sbjct:  244 FSTFQDESSL--YFLLEYAPNGDFLSLMKKYG---------SLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDG-EMKIKLTDFGTAK-LLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSP------ELLNDSFTDYRCDIWAFGCILFQMI--AGKPPFKATNEYLTFQKVMKVQYAFTPG----FPLIIR----DLVKKILVKNLDRRLTISQIKEHHFF 443          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO44269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW90])

HSP 1 Score: 98.2117 bits (243), Expect = 9.189e-23
Identity = 66/258 (25.58%), Postives = 119/258 (46.12%), Query Frame = 1
Query: 2005 NVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNN-DLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQS----LKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKK 2763
            N+K++F +E+  +  + H+N++  + V    D    ++ EY    D+   L+   +   N+ D   +     LY+A+QL+  + Y+     VHRD+A RN LV      +K++D  ++++ +   Y+ +           Q  VI     +PIRWM  E I +  F++ SDV+ FGV +WE+     + PY  L++ ++  N   +    +P       L  P+    +    +  C   E   RP F +IH F   +
Sbjct:    9 NIKQDFFKEVKIMAGVRHENVVRLLGVCK--DDPMCMIVEYMENGDLNQFLKQRELASGNSADPNKVTYQALLYMALQLAAGMKYIASHQFVHRDLATRNCLVGH-SFTVKIADFGMSRHLYSKHYYRI-----------QGRVI-----LPIRWMAPECILQGKFTSASDVWAFGVTLWEILTLAAEYPYGDLTDEKVIENVQLM--FFRPKSDAITFLSRPEICPPDVYAKMRSCWAIEPSARPDFHDIHSFLENR 245          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO41796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S358])

HSP 1 Score: 98.5969 bits (244), Expect = 1.060e-22
Identity = 67/253 (26.48%), Postives = 124/253 (49.01%), Query Frame = 1
Query: 2014 ENFHQELDNLNQINHKNLITF---VVVQDKCDLASYVVNEYTSLMDIFTLLESLS-ILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSK 2760
            E+  +E D +  ++H+N+I      ++  K  +   +V EY        +  SLS IL++ N    ++ ++    ++Q++D + YL    LVHRD+A RN+LV  P L +++SD  +A+               LD    Q + I +   + I W   EV+  ++   K DV+ +GV +WE++++ ++ P++ +   Q+    +      QP + L+ P++   E  +++  C V E   RP F EI    SK
Sbjct:   51 EDVLREADTMMSLDHRNIIRLYGIALITSKTPMGIKLVTEYA-------VFGSLSEILKNPNKPEFLQVTRLRKFSLQIADGMEYLANRHLVHRDLAARNVLVVEPEL-VRISDFGLAKA--------------LD----QGQEITAGREMAIAWCAPEVLKGREVHPKCDVWSYGVLLWEMYSFGKR-PWDGIPIMQVMKIVTQ-----QPEKKLEQPKACPSELYELMLHCWVHEPQDRPGFAEIRSSISK 271          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO45490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSX1])

HSP 1 Score: 94.7449 bits (234), Expect = 8.904e-22
Identity = 66/257 (25.68%), Postives = 124/257 (48.25%), Query Frame = 1
Query: 1960 DTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYV--------VNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQI--FVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQC 2700
            + I+ V+ +KQ     +K +F QE+  +  ++H N++  + V  + +    +        +N+Y      ++L E  S+ Q   DL+SI        ++Q+S  + +L+ +  VHRD+A RN LV    L +K++D  ++++ + S Y++V                +   ++PIRWMP E +    F+ +SDVY FGV +WE++ +  Q PY   +N ++  F+ K            L  P+       D+++ C
Sbjct:    1 ELIVAVKTLKQGCSNEMKTSFLQEVTLMAVLHHPNIVELLAVSTEEEPYGMIFEFMSQGDLNQYMRKRGPYSLEEEKSLTQ--EDLLSI--------SLQVSSGMEHLQSMRFVHRDLATRNCLVGD-GLVVKIADFGMSRDVYASDYYKV----------------EGQAVMPIRWMPPEALLYGRFTVESDVYSFGVLLWEVYAFALQ-PYYGYTNEEVCGFIKKGV---------HLGKPEDCPDHIYDVMKSC 220          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 99.3673 bits (246), Expect = 1.173e-21
Identity = 66/223 (29.60%), Postives = 115/223 (51.57%), Query Frame = 1
Query: 1945 EGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDI--FTLLESLSILQSNNDLIS-----IEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQY-WEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSN 2589
            E +++D  L ++++K + P  V ENF  E+  L  +   N++  V V    +   ++V EY   MD+  +  L   S  Q  +DL        ++  FL  A+Q++  ++YL     +HRD+A RN  +T  ++ +K+S+L I   R+ + Y W                 +  S L+P+RWMP E ++   F+ +SDV+ FGV +WE+++Y +Q PY   +N
Sbjct:  290 ETEYTDVRLAIKRLKPNVPPQVVENFKNEISVLMGLQDINVLCLVGVSAG-EEPLFMVFEYFEDMDMHRYLNLHIPSPAQLQDDLRDDCMHDPDEVLFLDFALQVASGMAYLAENNFIHRDLAARNCFITEDNI-VKISNLGIGSCRYPADYSW-----------------VHGSSLLPVRWMPPEALNSLHFTHRSDVWSFGVVLWEIYSYGRQ-PYSGYNN 492          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO41236 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7S4Y9])

HSP 1 Score: 95.1301 bits (235), Expect = 1.605e-21
Identity = 76/307 (24.76%), Postives = 140/307 (45.60%), Query Frame = 1
Query: 1822 ELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEI 2742
            +L+ +  + N SYGR  +AR S                  I+    +T++ V+ +     + V+E+F +EL++L  + H N+++ + V    +   Y++ E     D+   L S +    +N   ++  S  L +   +   +SYL     VH+D+A RN +VT   L +K+  L ++ + + ++Y+  N                 + LIP+RWMP E I   DF+ KSDV+ FGV  WE+++   Q+PY   S+ ++          ++    L  P +      +++++C       RP F  I
Sbjct:    7 DLEALRTLGNGSYGRAFLARAS-----------------GIKDGERETMVVVKSLIAKDDI-VREDFTRELESLVNMEHSNVVSLLGVCRDSE-PFYMIFECFEKGDLKQFLLSCN----DNGRSTLTSSHKLTMCSNIVSGMSYLAANKFVHKDLAARNCMVTK-DLQVKIGFLNLSYDLYNAEYYRFN-----------------NILIPLRWMPSEAIFHDDFTEKSDVWSFGVLAWEIYSL-GQIPYTDRSDEEVL-------KCVKDDLRLPKPDNCPDNMANVMKKCWEPNPNDRPNFDMI 264          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ENSORLT00000021512.2 (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101165486])

HSP 1 Score: 130.183 bits (326), Expect = 2.222e-30
Identity = 90/325 (27.69%), Postives = 150/325 (46.15%), Query Frame = 1
Query: 1786 SFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPY--EMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLL---ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            S  EF +Q    +L   E +    +G + +     G   +  E  P  D D+  +       ++ V++++ D+ +  + +F +E+  +++++  N+I  + V    D    +V EY    D+   L   E  S L   N + S+     L++AVQ+S  + YL  L  VHRD+A RN LV    L IK++D  +++N + S Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+F  C++ PY  LS+ Q+  N      N      L  P        +++ +C       RPTF  I+
Sbjct:  532 SAAEFPRQ----QLIFREKLGEGQFGEVHLCEAE-GLPEFLGEGSPLPDRDSRPV-------LVAVKQLRADATLQARNDFLKEIKIMSRLDDPNIIRLLCVCVSSDPLC-MVTEYMENGDLNMFLSQREIESTLTHANSIPSVSLCDLLHMAVQISSGMKYLASLNFVHRDLATRNCLVDR-RLTIKIADFGMSRNLYSSDYYR----------------IQGRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLYSPPLCPPSLFELMMRCWSRNITDRPTFDGIY 826          

HSP 2 Score: 87.8113 bits (216), Expect = 3.573e-17
Identity = 73/339 (21.53%), Postives = 135/339 (39.82%), Query Frame = 1
Query:  190 EKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRY------RNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND----NNPFNMSSNPFVGWSRSDFKF--DHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSS 1170
            + AWCP  ++ +S  +++ +DL  +  L ++ T+G    G                +E+ R       R+   +K W +     +                     I GNK+     +    PSI+ R++R+ P++     +C+ ++LYGC + + +I Y   +G L              D  YDG      +   GLG+LTD     +D    +     S   ++GW R+D +    H+ + F F   R F ++ + + N +T  V +   +   F          +++      D  N   R++ + L +RT + +    +F   W+M  EI F S
Sbjct:   62 DGAWCPEGQLQHSDTQYLQVDLSVLTFLTLVGTQGRYARGLG--------------KEFARAYRLNYSRDGLTWKAWKNRQGNTV---------------------IEGNKNTYAIVYKELHPSIIARYVRLIPVTELSSTVCMRVELYGCPWHDGLISYSAPEGQLM--MPPGYPPASLNDSIYDGTHERRPLF-GGLGQLTDGVVGMDDFLLTHEKQVWSGYDYLGW-RNDSQGTQGHVEMEFVFDRQRNFTSMKVHSNNLFTRGVKIFSSVSCWFKPRLIANWEQEAVTFRTVLDDRNPSARYVTVPLNQRTAKALRCRFYFADVWMMFSEISFQS 361          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2b (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101156357])

HSP 1 Score: 124.79 bits (312), Expect = 9.932e-29
Identity = 84/339 (24.78%), Postives = 154/339 (45.43%), Query Frame = 1
Query: 1756 ISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCD----LASYV----VNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETI-DIIEQCLVDEALQRPTFKEIH 2745
            I+  N   F+     +++    +L   E +    +G + +           M+ + D D S  E   S  ++ V+ +++D+  N + +F +E+  ++++   N++  + V    D    +  Y+    +N++ S   IF L  +LS             ++ + +AVQ++  + YL  L  VHRD+A RN LV   +  I+++D  +++N ++  Y+                 I+   ++PIRWM WE I    F+  SDV+ FGV +WE+   C++ PY  LS+ Q+  N      +      L  P         D++  C    A QRP+F+EIH
Sbjct:  530 IAAANMTPFTGTDSSLREFPREKLSFKEKLGEGQFGEVHLCEAE------GMQDFLDEDLSVGEISESLLLVAVKTLREDANKNARNDFLKEIRIMSRLRDPNIVRLLAVCVDTDPLWMITEYMENGDLNQFLSRSKIFFLFGALSY------------TKLINMAVQIASGMKYLSSLNFVHRDLATRNCLVGKNYT-IRIADFGMSRNLYKGDYYR----------------IQGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYSQLSDEQVIENTGEFFRDKGKQVYLPKPPCCPDSVYNDLMLSCWRRNAKQRPSFQEIH 833          

HSP 2 Score: 109.768 bits (273), Expect = 5.387e-24
Identity = 87/374 (23.26%), Postives = 163/374 (43.58%), Query Frame = 1
Query:   79 CYQKLLTNRTNVPDDAFIVSSFEID-YEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRY-RNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKND---NNPFNM-SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSES 1176
            C   L      + D+    SS+  +   AK+ R D    + AWCP      +  KE++ +DL S++ + ++ T+G    G  +      +         I+Y R+ S +  W   D+    +                   I GN++          P I+ R++R  P++ H  ++C+ ++LYGC + + ++ Y + DG     ++ ++    F D  YDG       L  GLG+LTD  +  +D   +  + +     +VGWS   F   ++ ++F F + R F ++ +  +N ++  V + +++   F SD   +E G  I      DR +   R++ + L  RT + +    HF   W++  E+ F S S
Sbjct:   33 CRYPLGMTGGQIQDEDISASSYWSESTAAKFGRLDIGGGDGAWCPDIMSEPHGLKEYLQVDLRSLHFITLVGTQGRHADGMGNEFAQRYR---------IKYSRDGSNWVSW--QDRKGQQV-------------------IEGNRNAYDVVLKDLEPPIIARYVRFMPVTDHSMIVCMRVELYGCEWLDGLVSYSIPDGHQMIYRDLEVS---FNDSVYDGA-----SLTKGLGQLTDGTWGLDDFLHSQIYGVWPGYDYVGWSNRTFPKGYVEMIFDFDHVRNFTSMKVHTSNMFSRGVRVFRQVTCFFWSDS-EWEPGP-ITFRPTPDRVSQRARFVTVTLGDRTAKTIKCRFHFSDVWMLFSEVAFQSGS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101161722])

HSP 1 Score: 122.479 bits (306), Expect = 5.510e-28
Identity = 76/268 (28.36%), Postives = 131/268 (48.88%), Query Frame = 1
Query: 1963 TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLAS--YVVNEYTSLMDIFTLL-----ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
             ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V   C  ++   ++ EY    D+   L     E    L SN   +S   S   Y+A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+ N+C++ PY  L++ Q+  N      + +    L  P   +     I+  C    A +RP+F+EIH
Sbjct:  608 VLVAVKMLRSDANGNARNDFLKEIKIMSRLKDPNIIRLLAV---CIYSNPLCMITEYMENGDLNQFLSRHEPEGQLALLSNTATVSF--SNLCYMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYSQLTDEQVIENTGEFFRDQKRQIYLPQPVLCSDSLYKIMLTCWRRNAKERPSFQEIH 853          

HSP 2 Score: 108.227 bits (269), Expect = 1.860e-23
Identity = 87/383 (22.72%), Postives = 163/383 (42.56%), Query Frame = 1
Query:   67 DKDSCYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEP----YFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNM----SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSE 1173
            + D C   L  +   + D+    SS +     A++ R D    + AWCP   V  ++ KEFI IDL  ++ + ++ T+G  RH     + +   Y I+  ++   WI +RN    +                               I GN++          P I+ R++R  P++ H   +C+ ++LYGC++ + ++ Y    G       +++K P    +F D  YDG + H  M+  GLG+L+D     +D    ++        +VGW+   F    + I+F F   R F  + +   N ++  + + +++   F SD        S +  + E+  +   R+I ++L  R    +    +F+  W++  EI F S+
Sbjct:   26 NPDVCRYPLGMSGGQIRDEDISASSQWSESTAARHGRLDCEEGDGAWCPETTVEPDNLKEFIQIDLNLLHFITLVGTQG--RHAGGMGNEFAQMYMIKYSRDGSRWISWRNRQGKQV------------------------------IEGNRNTYDTVLRDLDPPIIARFVRFMPVTDHSMNVCMRVELYGCKWLDGLVSYNAPAG-------EQMKLPAFPVFFNDSVYDGAITH--MMTEGLGQLSDGVMGLDDFTQSHVYQAWPGYDYVGWNNESFPSGFVEIMFEFDRPRNFTTMKVHCNNMFSQHIKIFRQVVCYFRSDSDWESTVLSFSPVVDENDPS--ARFITVELTNRMANAIKCQFYFKDAWMLFSEITFQSD 365          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101161722])

HSP 1 Score: 122.479 bits (306), Expect = 5.510e-28
Identity = 76/268 (28.36%), Postives = 131/268 (48.88%), Query Frame = 1
Query: 1963 TILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLAS--YVVNEYTSLMDIFTLL-----ESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
             ++ V+ ++ D+  N + +F +E+  ++++   N+I  + V   C  ++   ++ EY    D+   L     E    L SN   +S   S   Y+A Q++  + YL  L  VHRD+A RN LV   +  IK++D  +++N +   Y+                 I+   ++PIRWM WE I    F+T SDV+ FGV +WE+ N+C++ PY  L++ Q+  N      + +    L  P   +     I+  C    A +RP+F+EIH
Sbjct:  608 VLVAVKMLRSDANGNARNDFLKEIKIMSRLKDPNIIRLLAV---CIYSNPLCMITEYMENGDLNQFLSRHEPEGQLALLSNTATVSF--SNLCYMATQIASGMKYLSSLNFVHRDLATRNCLVGK-NYTIKIADFGMSRNLYSGDYYR----------------IQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYSQLTDEQVIENTGEFFRDQKRQIYLPQPVLCSDSLYKIMLTCWRRNAKERPSFQEIH 853          

HSP 2 Score: 108.227 bits (269), Expect = 1.860e-23
Identity = 87/383 (22.72%), Postives = 163/383 (42.56%), Query Frame = 1
Query:   67 DKDSCYQKLLTNRTNVPDDAFIVSS-FEIDYEAKYAR-DSSLIEKAWCPRYKVH-NSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQE---WIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEP----YFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNM----SSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSE 1173
            + D C   L  +   + D+    SS +     A++ R D    + AWCP   V  ++ KEFI IDL  ++ + ++ T+G  RH     + +   Y I+  ++   WI +RN    +                               I GN++          P I+ R++R  P++ H   +C+ ++LYGC++ + ++ Y    G       +++K P    +F D  YDG + H  M+  GLG+L+D     +D    ++        +VGW+   F    + I+F F   R F  + +   N ++  + + +++   F SD        S +  + E+  +   R+I ++L  R    +    +F+  W++  EI F S+
Sbjct:   26 NPDVCRYPLGMSGGQIRDEDISASSQWSESTAARHGRLDCEEGDGAWCPETTVEPDNLKEFIQIDLNLLHFITLVGTQG--RHAGGMGNEFAQMYMIKYSRDGSRWISWRNRQGKQV------------------------------IEGNRNTYDTVLRDLDPPIIARFVRFMPVTDHSMNVCMRVELYGCKWLDGLVSYNAPAG-------EQMKLPAFPVFFNDSVYDGAITH--MMTEGLGQLSDGVMGLDDFTQSHVYQAWPGYDYVGWNNESFPSGFVEIMFEFDRPRNFTTMKVHCNNMFSQHIKIFRQVVCYFRSDSDWESTVLSFSPVVDENDPS--ARFITVELTNRMANAIKCQFYFKDAWMLFSEITFQSD 365          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ntrk2a (neurotrophic receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101172248])

HSP 1 Score: 118.627 bits (296), Expect = 7.941e-27
Identity = 79/268 (29.48%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 1960 DTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESL---SILQSNNDL---ISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIH 2745
            + IL   K  +++  N +++FH+E + L  + H++++TF  V  + D    +V EY    D+   L +    ++L +       + + QSQ L+IA Q++  + YL     VHRD+A RN LV   +L +K+ D  ++++ + + Y+ V    +L                PIRWMP E I  + F+T+SDV+  GV +WE+F Y +Q P+  LSN ++          I   + L+ P++  +E  D++  C   E   R   KEIH
Sbjct:  486 EKILVAVKTLKEASENARKDFHREAELLTNLQHEHIVTFYGVCVESD-PLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGQTTRPVELTQSQMLHIAQQIASGMVYLASQHFVHRDLATRNCLVGE-NLLVKIGDFGMSRDVYSTDYYRVGGHTML----------------PIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQ-PWYQLSNNEVI-------ECITQGRVLQRPRTCPKEVYDLMLGCWQREPHMRLNIKEIH 727          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 1761.5 bits (4561), Expect = 0.000e+0
Identity = 920/950 (96.84%), Postives = 920/950 (96.84%), Query Frame = 1
Query:   10 MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 2859
            MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRNVSEFKK                              ISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD
Sbjct:    1 MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRNVSEFKK------------------------------ISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 920          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 1753.03 bits (4539), Expect = 0.000e+0
Identity = 916/946 (96.83%), Postives = 916/946 (96.83%), Query Frame = 1
Query:   22 MNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 2859
            MNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRNVSEFKK                              ISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD
Sbjct:    1 MNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRNVSEFKK------------------------------ISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 916          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 1749.18 bits (4529), Expect = 0.000e+0
Identity = 915/950 (96.32%), Postives = 915/950 (96.32%), Query Frame = 1
Query:   10 MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 2859
            MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRN                                   KISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD
Sbjct:    1 MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRN-----------------------------------KISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 915          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000021250.1 (SMESG000021250.1)

HSP 1 Score: 1740.32 bits (4506), Expect = 0.000e+0
Identity = 911/946 (96.30%), Postives = 911/946 (96.30%), Query Frame = 1
Query:   22 MNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 2859
            MNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRN                                   KISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD
Sbjct:    1 MNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGYKSASYYYIKYKIEEKQEWIRYRN-----------------------------------KISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQPSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIKWKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLNTKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYFSMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQLNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFSDTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLDSNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD 911          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000066441.1 (SMESG000066441.1)

HSP 1 Score: 239.195 bits (609), Expect = 2.474e-65
Identity = 152/400 (38.00%), Postives = 219/400 (54.75%), Query Frame = 1
Query:   22 MNFITILSIK---NALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYEAKYARDS-SLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHGXXXXXXXXXXXXXXXXQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLPRYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNLQLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLKSGLGKLT-DHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRKFVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENFDTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTT 1206
            MNF+ ++S++    A   +  SC  KLL N+  VPD AF  SS++ +++ K+AR+S S  E AWCP  K+H+  ++F+ IDLG IY+LKMIMTKGLSRHG+ SAS Y I+YK E    W  YR+  + KK                              I GNKDHLTEK+    P+I+ RW++IYP ++  E ICL LQ+YGC+Y + ++EY+M DGS Y N          TD +YDG       L  GLGKL  + D    D  PFN  ++  VGW +   K + + I FRF   + F  + + A+ + + +V L   I+I FS DG  ++  + +  +I E R   +   + +DLK   G+FV I+L F S WI+++ I F S+    +  V  T
Sbjct:    1 MNFLILISLELLFTATITNTKSCSDKLLENKNKVPDSAFTESSYKEEFKGKWARESTSPTEMAWCPNNKIHDKRRDFLMIDLGDIYILKMIMTKGLSRHGFISASSYIIEYKREANSSWFEYRSRGKQKK------------------------------IKGNKDHLTEKYESLDPAIIARWVKIYPYANIEETICLVLQIYGCKYMSQIMEYRMDDGS-YLN---------LTDFNYDGD-KSDSYLSGGLGKLVLNSDTLSKD--PFNTKNDQLVGWDKQ--KTNQVQITFRFAQFQNFSKLLIEASIFPSKNVKLFSHIQIQFSYDGVTYDEKRVLQQSIDETRVINNFHSVPVDLKNNVGKFVKISLTFNSIWIILKHIEFQSDPTNDIRIVEPT 355          

HSP 2 Score: 171.4 bits (433), Expect = 2.754e-43
Identity = 124/404 (30.69%), Postives = 198/404 (49.01%), Query Frame = 1
Query: 1696 LDVRGPLGNSQMYRMNLINFISTTNYPEFS-SFHEFVKQLNFSE-----LKTIENISNNSYGRIDVA---RP------------SIGYSPYEMEPYKDMDNSNIEGKFSDT-ILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLASYVVNEYTSLMDIFTLLES-----LSILQSNNDLISIEQSQFLYIAVQLSDALSYLEYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQL------------LDSN---NKQNEV-IKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYCQQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVDEALQRPTFKEIHIFFSKKNSGYK 2778
            + ++GPL NS++        I+T N PE   S       L+++      LK I+ IS   +G I +    RP               Y+         ++  NI  +F +  I  ++ + +++   +K  F +E+  +  +NHK     +  ++     S VV+E+T+L D ++ L++     LS L        I QS  +Y+A Q++  + +LEYL LVHRD++CRN+L+ +  L IK+SDLAIA  +F S Y     P              L SN   + QN + I S  ++PIRWMPW+ + + +FS KSDVY FGV  WEL   C++ PY  L+N Q+ +N +      +  + L  P + ++E  D I  C+      RP+F EI +F   K+ G K
Sbjct:  587 VSIQGPLRNSKLQS------ITTVNDPEIMFSLGSLFNDLSYANVALENLKYIKTISRCHFGSIHIGEWLRPHDQIMETNKKFQCHEYNTLRQSLTTGIETENIFQQFPEKQISSIKVLSKNTTQKLKNEFFKEIKRILSLNHKCFPMILKFEETPLGDSVVVSEHTALDDAYSYLQNFTLKELSDLHYETGAKVISQSNLIYMASQIACGMKHLEYLKLVHRDLSCRNVLIMNDDLLIKISDLAIANEKFSSDYVIFTDPTANHIHKSTSSLIQLQSNPIHSCQNPIEINSVIVLPIRWMPWQALLQGNFSNKSDVYSFGVTFWELLTLCRKQPYHELTNEQVIINSNLQALGDERARILPVPNNYSKEFSDFITHCMHFNESTRPSFVEIDMFLQHKSIGIK 984          
The following BLAST results are available for this feature:
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR27.357e-2924.05discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR27.357e-2924.05discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR27.357e-2924.05discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR13.297e-2726.28discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
DDR13.297e-2726.28discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr-23.505e-2829.58Discoidin domain-containing receptor tyrosine kina... [more]
ddr-23.505e-2829.58Discoidin domain-containing receptor tyrosine kina... [more]
ddr-24.065e-2829.58Discoidin domain-containing receptor tyrosine kina... [more]
cam-13.197e-2428.63Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-13.309e-2429.01Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr1.159e-2926.98gene:FBgn0053531 transcript:FBtr0344771[more]
Ddr1.159e-2926.98gene:FBgn0053531 transcript:FBtr0344770[more]
Ror1.204e-2829.77gene:FBgn0010407 transcript:FBtr0079978[more]
Btk29A9.925e-2427.00gene:FBgn0003502 transcript:FBtr0330693[more]
Btk29A2.024e-2326.89gene:FBgn0003502 transcript:FBtr0330692[more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FP015875.12.384e-3227.69discoidin domain receptor family, member 2, like [... [more]
BX088694.12.692e-3227.69discoidin domain receptor family, member 2, like [... [more]
ddr2l3.091e-3227.69discoidin domain receptor family, member 2, like [... [more]
ddr2l3.382e-3227.69discoidin domain receptor family, member 2, like [... [more]
ddr2a2.972e-2725.54discoidin domain receptor tyrosine kinase 2a [Sour... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2l5.300e-2925.47discoidin domain receptor tyrosine kinase 2 like [... [more]
ddr2l6.117e-2925.47discoidin domain receptor tyrosine kinase 2 like [... [more]
ddr2l7.172e-2925.47discoidin domain receptor tyrosine kinase 2 like [... [more]
ntrk23.485e-2830.08neurotrophic receptor tyrosine kinase 2 [Source:NC... [more]
ntrk29.326e-2830.08neurotrophic receptor tyrosine kinase 2 [Source:NC... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr23.190e-3026.83discoidin domain receptor family, member 2 [Source... [more]
Ddr23.190e-3026.83discoidin domain receptor family, member 2 [Source... [more]
Ddr23.190e-3026.83discoidin domain receptor family, member 2 [Source... [more]
Ddr14.383e-2824.62discoidin domain receptor family, member 1 [Source... [more]
Ddr15.211e-2824.62discoidin domain receptor family, member 1 [Source... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62371|DDR2_MOUSE2.231e-2926.83Discoidin domain-containing receptor 2 OS=Mus musc... [more]
sp|Q16832|DDR2_HUMAN3.533e-2824.05Discoidin domain-containing receptor 2 OS=Homo sap... [more]
sp|Q24488|ROR1_DROME1.206e-2729.77Tyrosine-protein kinase transmembrane receptor Ror... [more]
sp|Q03146|DDR1_MOUSE3.645e-2724.62Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q95ZV7|DDRB_CAEEL5.170e-2729.58Discoidin domain-containing receptor tyrosine kina... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7FA641.057e-4822.23Uncharacterized protein OS=Pelodiscus sinensis OX=... [more]
A0A4S2LYV31.309e-3927.52F5/8 type C domain-containing protein OS=Opisthorc... [more]
G4V7C23.848e-3927.70Putative discoidin domain receptor OS=Schistosoma ... [more]
A0A5J4NMD04.107e-3926.54Discoidin domain receptor family member 2 OS=Parag... [more]
A0A183QKB04.821e-3927.70F5/8 type C domain-containing protein OS=Schistoso... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2l2.483e-2926.62discoidin domain receptor family, member 2, like [... [more]
ddr2a6.503e-2826.15discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr11.002e-2723.30discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ENSAMXT00000019857.21.243e-2725.80discoidin domain-containing receptor 2-like [Sourc... [more]
ddr11.282e-2723.30discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009339.19.704e-2427.96pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gen... [more]
ENSPMAT00000001705.11.198e-2225.19pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
NTRK24.259e-2126.94neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
ENSPMAT00000009485.13.950e-1923.00pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000006545.15.532e-1925.90pep scaffold:Pmarinus_7.0:GL476470:1226125:1235807... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SKM11.841e-921.22Member of the PAK family of serine/threonine prote... [more]
CLA42.566e-922.18Cdc42p-activated signal transducing kinase; member... [more]
SGV13.116e-723.63Cyclin (Bur2p)-dependent protein kinase; part of t... [more]
CDC154.972e-721.48Protein kinase of the Mitotic Exit Network; locali... [more]
PKH25.015e-724.02Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO442699.189e-2325.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417961.060e-2226.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454908.904e-2225.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439931.173e-2129.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412361.605e-2124.76Tyrosine-protein kinase receptor [Source:UniProtK... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021512.22.222e-3027.69discoidin domain-containing receptor 2 [Source:NCB... [more]
ddr2b9.932e-2924.78discoidin domain-containing receptor 2 [Source:NCB... [more]
ddr2a5.510e-2828.36discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr2a5.510e-2828.36discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ntrk2a7.941e-2729.48neurotrophic receptor tyrosine kinase 2 [Source:NC... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021250.10.000e+096.84SMESG000021250.1[more]
SMESG000021250.10.000e+096.83SMESG000021250.1[more]
SMESG000021250.10.000e+096.32SMESG000021250.1[more]
SMESG000021250.10.000e+096.30SMESG000021250.1[more]
SMESG000066441.12.474e-6538.00SMESG000066441.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027372 ID=SMED30027372|Name=Discoidin domain-containing receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3067bp
GATTGAACAATGCATTTCATCATGAATTTTATAACGATACTCTCAATTAA
AAATGCATTAACAGAAGATAAAGATAGTTGCTACCAGAAGCTTTTAACTA
ACCGTACAAACGTTCCAGATGACGCTTTCATCGTTTCAAGCTTTGAAATA
GATTATGAAGCAAAATACGCAAGAGATTCGTCTTTAATAGAGAAAGCATG
GTGTCCTAGATACAAGGTTCACAATTCTACCAAAGAATTCATAACAATCG
ACTTGGGATCAATCTATGTTTTAAAGATGATCATGACAAAAGGTCTAAGT
CGGCATGGCTATAAGTCAGCATCATATTATTATATCAAGTATAAGATTGA
AGAAAAGCAGGAATGGATACGTTATAGAAACGTTAGTGAATTCAAGAAAT
GGCTTCATACAGATAAAACCTTTCTCACAATCGGCGCTGTCTTTAAGGTT
CTGCTACCGAGATACTGCTACTTTGGATTAATTTTAAAAATTTCCGGGAA
TAAAGATCATTTAACAGAAAAATTCAACTTATTCACGCCAAGTATTGTTA
CGAGATGGATTAGGATCTATCCAATATCAAGCCATCCAGAAATGATTTGT
TTAAATTTACAGCTCTACGGATGTCGTTATACTAATAACGTCATAGAATA
TCAGATGGTTGATGGAAGTCTTTACTATAACCAAGAAAAAAAAATTAAAG
AACCATATTTCACAGATCAATCATATGACGGTGTTCTCCTTCATACGGGA
ATGCTGAAATCTGGCCTAGGAAAACTTACCGACCATGACTACGAAAAAAA
CGACAATAATCCTTTTAACATGTCTTCAAATCCATTTGTCGGATGGAGTC
GTTCCGATTTCAAATTTGACCATATTCATATTGTGTTTCGATTCATTAAT
AATAGAAAGTTTGTAAATGTCAGTCTGAGAGCTGCTAATTATTGGACTGC
ATCAGTAGCACTTCCTAAAAGAATAGAGATCGCATTTAGTTCTGACGGAC
GAAGATTTGAGAGAGGAAAATCTATCAATCATGCGATAAAGGAAGACAGG
GAGAATTTCGACACAAGATGGATAGTGATAGATCTTAAGAAACGTACAGG
CCGTTTTGTGTCAATTAATTTACATTTTCAGTCTCAATGGATTATGGTCA
GAGAAATTCTATTTTCAAGCGAATCACTAGAATCAGTTTCCAACGTTGGC
ACCACTCAACCAAGTGAATTTACTTCGAAAAGTTATTCAACTTTAACAAA
AATAATAGTAAAATCAAATGCAATTACTATAACTGACATTTTTCTCAGTT
CTTCTATTTCGCTGGGAATTCTTTTTTTGCTGGCAATTTGTTTAATTTGT
ATAATTAAGTGGAAACGTAAATCAAGAATAAGAAAATACAAAAAGGCCAT
GCATCTTCAAAGTCAGGATGAGGAGTACAATCGCATATTGACATTGCAAC
ATCAGAATATGAAAAACCAAACTCTGTATTATCCGGTTGCTAATTTGTCA
ACTCTCAATACAAAGTTTCATACTGAAGAGAGGCCAAACAAATTTCGCCA
AATGATAATACCGGAGGCTTACAATTATTGGTTTTATAATGACTTCTGCC
TTGATTCCAGATCCAATATGGACACTCACTCCCTGTACAATGATGCGACA
AAATATTTTTCTATGGAAAAGAATATTCAAACAGATCTAAGTTATTTAGA
TGTTAGAGGACCCCTTGGCAATAGTCAAATGTACAGAATGAATCTTATTA
ATTTCATATCAACCACAAACTATCCCGAATTTTCCTCATTCCACGAATTT
GTCAAGCAGCTCAATTTTAGTGAACTGAAAACTATAGAAAACATATCCAA
TAATTCATATGGTCGGATTGACGTGGCGCGTCCTTCTATCGGCTATAGTC
CATACGAAATGGAACCATATAAAGACATGGACAACTCAAATATAGAAGGA
AAATTTAGCGATACTATTCTGTGTGTAAGAAAAATTAAACAAGACAGTCC
AGTAAACGTTAAGGAGAATTTTCATCAAGAGCTTGACAATCTCAATCAAA
TTAATCACAAAAATTTGATCACATTTGTTGTTGTCCAGGATAAATGCGAT
TTGGCATCATATGTCGTGAATGAATATACATCTTTAATGGACATATTCAC
TCTCCTAGAATCGCTAAGTATTCTCCAGTCAAATAACGACTTGATTTCAA
TTGAACAATCTCAGTTTTTGTATATTGCTGTTCAATTGTCAGATGCTCTC
AGTTACCTGGAGTACCTAGGTTTGGTCCATCGTGATATTGCTTGTAGAAA
TATCCTTGTCACTAGTCCGCATTTATATATCAAATTAAGTGATCTCGCCA
TTGCTCAAAACCGTTTCCGATCTCAGTACTGGGAAGTTAATAAGCCTCAG
TTGCTGGACAGTAATAACAAACAAAATGAAGTCATAAAATCATCGCATCT
GATCCCAATCAGATGGATGCCATGGGAAGTTATATCCAAGAAGGATTTTT
CTACGAAATCCGATGTGTATGGTTTTGGAGTTTGTATGTGGGAACTGTTC
AACTACTGTCAACAATTACCATATGAGAGCTTGTCCAATTATCAGATCTT
CGTCAACAAATCTTCACTGAATTCAAATATCCAACCACATCAAAGTCTCA
AATTTCCCCAGTCAACTGCCCGTGAAACTATTGACATCATTGAACAATGT
CTTGTAGATGAGGCACTGCAAAGACCGACATTCAAGGAGATTCATATATT
TTTCTCAAAGAAAAACTCTGGTTACAAGTCAAACGATGCATTAATTAAAC
AGCTATTGGTGAAATACTGCTACACAGTGAATGAAAATGTTCCAACGATT
TATTTTGATTAGATAATAGAATTTATTAATCAGTTCCATGTAAAGATTAA
AGTCTATAACAGATTTACTATTCGTTTCTGTGTGTGTGTGTGTGTGTGTA
TCAGAATAGTTATGTAAAACTGCGTTCCATCTTTGAAACAGAACAATAAA
ATCCGATAGTTATATATTATCAAGATATTTTCAAGTATTTATTATTTATA
TGTCATCCAGATCGGAA
back to top

protein sequence of SMED30027372-orf-1

>SMED30027372-orf-1 ID=SMED30027372-orf-1|Name=SMED30027372-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=951bp
MHFIMNFITILSIKNALTEDKDSCYQKLLTNRTNVPDDAFIVSSFEIDYE
AKYARDSSLIEKAWCPRYKVHNSTKEFITIDLGSIYVLKMIMTKGLSRHG
YKSASYYYIKYKIEEKQEWIRYRNVSEFKKWLHTDKTFLTIGAVFKVLLP
RYCYFGLILKISGNKDHLTEKFNLFTPSIVTRWIRIYPISSHPEMICLNL
QLYGCRYTNNVIEYQMVDGSLYYNQEKKIKEPYFTDQSYDGVLLHTGMLK
SGLGKLTDHDYEKNDNNPFNMSSNPFVGWSRSDFKFDHIHIVFRFINNRK
FVNVSLRAANYWTASVALPKRIEIAFSSDGRRFERGKSINHAIKEDRENF
DTRWIVIDLKKRTGRFVSINLHFQSQWIMVREILFSSESLESVSNVGTTQ
PSEFTSKSYSTLTKIIVKSNAITITDIFLSSSISLGILFLLAICLICIIK
WKRKSRIRKYKKAMHLQSQDEEYNRILTLQHQNMKNQTLYYPVANLSTLN
TKFHTEERPNKFRQMIIPEAYNYWFYNDFCLDSRSNMDTHSLYNDATKYF
SMEKNIQTDLSYLDVRGPLGNSQMYRMNLINFISTTNYPEFSSFHEFVKQ
LNFSELKTIENISNNSYGRIDVARPSIGYSPYEMEPYKDMDNSNIEGKFS
DTILCVRKIKQDSPVNVKENFHQELDNLNQINHKNLITFVVVQDKCDLAS
YVVNEYTSLMDIFTLLESLSILQSNNDLISIEQSQFLYIAVQLSDALSYL
EYLGLVHRDIACRNILVTSPHLYIKLSDLAIAQNRFRSQYWEVNKPQLLD
SNNKQNEVIKSSHLIPIRWMPWEVISKKDFSTKSDVYGFGVCMWELFNYC
QQLPYESLSNYQIFVNKSSLNSNIQPHQSLKFPQSTARETIDIIEQCLVD
EALQRPTFKEIHIFFSKKNSGYKSNDALIKQLLVKYCYTVNENVPTIYFD
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0018108peptidyl-tyrosine phosphorylation
GO:0006468protein phosphorylation
GO:0038063collagen-activated tyrosine kinase receptor signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR020635Tyr_kinase_cat_dom
IPR008979Galactose-bd-like_sf
IPR000421FA58C
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004713protein tyrosine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0038062protein tyrosine kinase collagen receptor activity
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 606..915
e-value: 8.9E-24
score: 95.0
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 10..209
e-value: 3.7E-28
score: 100.3
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 23..208
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 637..937
e-value: 3.6E-40
score: 139.7
NoneNo IPR availableGENE3DG3DSA:2.60.120.1190coord: 210..395
e-value: 5.6E-39
score: 135.6
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 648..923
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 161..391
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 161..391
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 648..923
NoneNo IPR availableTMHMMTMhelixcoord: 427..449
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 651..912
e-value: 8.8E-40
score: 136.6
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 51..194
e-value: 5.3E-8
score: 33.0
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 63..95
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 24..205
score: 13.636
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 755..767
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 606..915
score: 26.648
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 584..912