Adenylate kinase

Overview
NameAdenylate kinase
Smed IDSMED30027361
Length (bp)1084
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate kinase (SMED30027361) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate kinase (SMED30027361) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylate kinase (SMED30027361) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylate kinase (SMED30027361) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027361

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30027361SMESG000039607.1 SMESG000006671.1 dd_Smed_v4_9001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30027361SMESG000039607.1 SMESG000006671.1 dd_Smed_v4_9001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027361SMESG000039607.1 SMESG000006671.1 dd_Smed_v6_9001_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate kinase vs. Ensembl Human
Match: CMPK1 (cytidine/uridine monophosphate kinase 1 [Source:HGNC Symbol;Acc:HGNC:18170])

HSP 1 Score: 66.2402 bits (160), Expect = 5.540e-12
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKL-ATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++       HL  G+++R+   + +N  SQ  E +   ++ G +V  +I   LL +E+   +A+      F++DGFPR    L         K  V+F+L  +  + I  +RC  R   + R DD +  +E RI  + Q
Sbjct:   37 VVFVLGGPGAGKGTQCARIVEKY--GYTHLSAGELLRD---ERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQ 189          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK3 (adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17376])

HSP 1 Score: 64.3142 bits (155), Expect = 2.581e-11
Identity = 43/139 (30.94%), Postives = 69/139 (49.64%), Query Frame = 3
Query:   33 MQMSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            M  S      +I+G PGSGK TVS+ I    +   HL +G ++R+ +++   I    K    + +  G L+ DD+++ L   E+ N+        ++LDGFPRT  Q  AL     Y+I     LN P  ++++R   R
Sbjct:    1 MGASARLLRAVIMGAPGSGKGTVSSRITTHFELK-HLSSGDLLRDNMLRGTEIGVLAK----AFIDQGKLIPDDVMTRLALHELKNLTQYS----WLLDGFPRTLPQAEAL--DRAYQIDTVINLNVPFEVIKQRLTAR 128          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK4 (adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:363])

HSP 1 Score: 56.9954 bits (136), Expect = 6.715e-9
Identity = 49/164 (29.88%), Postives = 75/164 (45.73%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTV-SNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLR--TDRVD--DRKGPVEHRISDFT 515
            M+      +I+G PGSGK TV   I QN      HL +G  +R  +     +    K+ +  ++    LV D +++ L+  E+ N    +    ++LDGFPRT  Q  AL    +  +V++  LN P   L+ R   R +   + RV   D   P  H I D T
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCQRIAQNF--GLQHLSSGHFLRENIKASTEVGEMAKQYIEKSL----LVPDHVITRLMMSELEN----RRGQHWLLDGFPRTLGQAEALDKICEVDLVIS--LNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVT 152          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK4 (adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:363])

HSP 1 Score: 56.9954 bits (136), Expect = 6.715e-9
Identity = 49/164 (29.88%), Postives = 75/164 (45.73%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTV-SNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLR--TDRVD--DRKGPVEHRISDFT 515
            M+      +I+G PGSGK TV   I QN      HL +G  +R  +     +    K+ +  ++    LV D +++ L+  E+ N    +    ++LDGFPRT  Q  AL    +  +V++  LN P   L+ R   R +   + RV   D   P  H I D T
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCQRIAQNF--GLQHLSSGHFLRENIKASTEVGEMAKQYIEKSL----LVPDHVITRLMMSELEN----RRGQHWLLDGFPRTLGQAEALDKICEVDLVIS--LNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVT 152          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK4 (adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:363])

HSP 1 Score: 56.9954 bits (136), Expect = 6.715e-9
Identity = 49/164 (29.88%), Postives = 75/164 (45.73%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTV-SNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLR--TDRVD--DRKGPVEHRISDFT 515
            M+      +I+G PGSGK TV   I QN      HL +G  +R  +     +    K+ +  ++    LV D +++ L+  E+ N    +    ++LDGFPRT  Q  AL    +  +V++  LN P   L+ R   R +   + RV   D   P  H I D T
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCQRIAQNF--GLQHLSSGHFLRENIKASTEVGEMAKQYIEKSL----LVPDHVITRLMMSELEN----RRGQHWLLDGFPRTLGQAEALDKICEVDLVIS--LNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVT 152          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 61.2326 bits (147), Expect = 7.537e-11
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFI--LNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQH 521
            +V ++G PGSGK T+   IQ ++ N +HL  G ++R    + +   S+    + S +++G +V  +I   LL   +    A   A  F++DGFPR    L     +   K +V F+  L+ P +I  +RC  R     R DD +  ++ R+  + Q 
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLR---AERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMK---ACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRG--QGRTDDNEESLKKRVETYNQQ 151          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 61.2326 bits (147), Expect = 7.537e-11
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFI--LNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQH 521
            +V ++G PGSGK T+   IQ ++ N +HL  G ++R    + +   S+    + S +++G +V  +I   LL   +    A   A  F++DGFPR    L     +   K +V F+  L+ P +I  +RC  R     R DD +  ++ R+  + Q 
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLR---AERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMK---ACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRG--QGRTDDNEESLKKRVETYNQQ 151          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 61.2326 bits (147), Expect = 7.537e-11
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFI--LNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQH 521
            +V ++G PGSGK T+   IQ ++ N +HL  G ++R    + +   S+    + S +++G +V  +I   LL   +    A   A  F++DGFPR    L     +   K +V F+  L+ P +I  +RC  R     R DD +  ++ R+  + Q 
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLR---AERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMK---ACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRG--QGRTDDNEESLKKRVETYNQQ 151          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 61.2326 bits (147), Expect = 7.537e-11
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFI--LNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQH 521
            +V ++G PGSGK T+   IQ ++ N +HL  G ++R    + +   S+    + S +++G +V  +I   LL   +    A   A  F++DGFPR    L     +   K +V F+  L+ P +I  +RC  R     R DD +  ++ R+  + Q 
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLR---AERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMK---ACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRG--QGRTDDNEESLKKRVETYNQQ 151          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 60.4622 bits (145), Expect = 1.824e-10
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFI--LNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQH 521
            +V ++G PGSGK T+   IQ ++ N +HL  G ++R    + +   S+    + S +++G +V  +I   LL   +    A   A  F++DGFPR    L     +   K +V F+  L+ P +I  +RC  R     R DD +  ++ R+  + Q 
Sbjct:   41 VVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLR---AERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMK---ACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRG--QGRTDDNEESLKKRVETYNQQ 188          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 71.2478 bits (173), Expect = 3.962e-14
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +I+G PGSGK T+S +I  +    +H+ TG I+R  ++K   +  + K+ +      G LV D IV++ +   I+ +        +ILDGFPR  AQ  AL A+ Q   V+T  L+ PH+++  R K R
Sbjct:    9 VIIGAPGSGKGTISELICKN-HGCVHISTGDILRQNIIKNTELGKKAKQYIAE----GKLVPDAIVTKTMLARITEVGNRS----YILDGFPRNIAQAEALAAREQIDAVIT--LDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339379)

HSP 1 Score: 71.2478 bits (173), Expect = 3.962e-14
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +I+G PGSGK T+S +I  +    +H+ TG I+R  ++K   +  + K+ +      G LV D IV++ +   I+ +        +ILDGFPR  AQ  AL A+ Q   V+T  L+ PH+++  R K R
Sbjct:    9 VIIGAPGSGKGTISELICKN-HGCVHISTGDILRQNIIKNTELGKKAKQYIAE----GKLVPDAIVTKTMLARITEVGNRS----YILDGFPRNIAQAEALAAREQIDAVIT--LDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082330)

HSP 1 Score: 71.2478 bits (173), Expect = 3.962e-14
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +I+G PGSGK T+S +I  +    +H+ TG I+R  ++K   +  + K+ +      G LV D IV++ +   I+ +        +ILDGFPR  AQ  AL A+ Q   V+T  L+ PH+++  R K R
Sbjct:    9 VIIGAPGSGKGTISELICKN-HGCVHISTGDILRQNIIKNTELGKKAKQYIAE----GKLVPDAIVTKTMLARITEVGNRS----YILDGFPRNIAQAEALAAREQIDAVIT--LDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339378)

HSP 1 Score: 71.2478 bits (173), Expect = 3.962e-14
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +I+G PGSGK T+S +I  +    +H+ TG I+R  ++K   +  + K+ +      G LV D IV++ +   I+ +        +ILDGFPR  AQ  AL A+ Q   V+T  L+ PH+++  R K R
Sbjct:    9 VIIGAPGSGKGTISELICKN-HGCVHISTGDILRQNIIKNTELGKKAKQYIAE----GKLVPDAIVTKTMLARITEVGNRS----YILDGFPRNIAQAEALAAREQIDAVIT--LDVPHSVIIDRVKNR 126          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076017)

HSP 1 Score: 53.9138 bits (128), Expect = 2.747e-8
Identity = 44/162 (27.16%), Postives = 74/162 (45.68%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDK-EEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAK-SQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEI 533
            ++ I+GGPG GK T  + I++       HL +G ++RN     E  +  DK  ++ + M  GGLV +D V  LLN  I+    S     F++DG+PR   Q     A+ +   + + F  +    +     +       R DD +  +  R+  F Q+ + I
Sbjct:    6 IIWILGGPGCGKGTQCAKIVEKY--GFTHLSSGDLLRN-----EVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKG--FLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAI 158          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 60.8474 bits (146), Expect = 2.416e-10
Identity = 44/158 (27.85%), Postives = 76/158 (48.10%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNII-ASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++N   +  HL  G ++R    + +   S+  + + S ++ G +V   I   LL K +   + A +    F++DGFPR    L     +   K  V F+L  +  + +   RC  R   + R DD +  +E RI  + Q
Sbjct:   30 VVFVLGGPGAGKGTQCARIVENY--SYTHLSAGDLLREERSRTD---SEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQ 182          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 60.8474 bits (146), Expect = 2.466e-10
Identity = 44/158 (27.85%), Postives = 76/158 (48.10%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNII-ASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++N   +  HL  G ++R    + +   S+  + + S ++ G +V   I   LL K +   + A +    F++DGFPR    L     +   K  V F+L  +  + +   RC  R   + R DD +  +E RI  + Q
Sbjct:   28 VVFVLGGPGAGKGTQCARIVENY--SYTHLSAGDLLREERSRTD---SEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQ 180          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 60.4622 bits (145), Expect = 2.932e-10
Identity = 44/158 (27.85%), Postives = 76/158 (48.10%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNII-ASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++N   +  HL  G ++R    + +   S+  + + S ++ G +V   I   LL K +   + A +    F++DGFPR    L     +   K  V F+L  +  + +   RC  R   + R DD +  +E RI  + Q
Sbjct:   34 VVFVLGGPGAGKGTQCARIVENY--SYTHLSAGDLLREERSRTD---SEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQ 186          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 55.8398 bits (133), Expect = 1.151e-8
Identity = 42/132 (31.82%), Postives = 66/132 (50.00%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEV--TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
             +I+G PGSGK T+S  I ++     HL +G  +R      ENI+S+    V   + +  G LV D +++ LL   +  +        ++LDGFPRT AQ  AL +     + +   LN P   L++R + R
Sbjct:    7 AVIMGPPGSGKGTISERIAHNFGLK-HLSSGDFVR------ENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEMTKYS----WLLDGFPRTLAQAEALNSSCDLDVAIN--LNIPLETLKERLRHR 125          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 55.8398 bits (133), Expect = 1.151e-8
Identity = 42/132 (31.82%), Postives = 66/132 (50.00%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEV--TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
             +I+G PGSGK T+S  I ++     HL +G  +R      ENI+S+    V   + +  G LV D +++ LL   +  +        ++LDGFPRT AQ  AL +     + +   LN P   L++R + R
Sbjct:    7 AVIMGPPGSGKGTISERIAHNFGLK-HLSSGDFVR------ENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEMTKYS----WLLDGFPRTLAQAEALNSSCDLDVAIN--LNIPLETLKERLRHR 125          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ncan (neurocan [Source:Xenbase;Acc:XB-GENE-961217])

HSP 1 Score: 59.6918 bits (143), Expect = 7.282e-10
Identity = 46/158 (29.11%), Postives = 74/158 (46.84%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIA-SKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T    I+Q       HL  G ++R+   K +   SQ  E + S ++ G +V  +I   LL + +   +A       F++DGFPR    L         K  V+F+L  +  +    +RC  R   + R DD +  +E RI  + Q
Sbjct:   28 VVFVLGGPGAGKGTQCERIVQKY--GYTHLSAGDLLRDERKKPD---SQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQ 180          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 59.3066 bits (142), Expect = 7.902e-10
Identity = 48/135 (35.56%), Postives = 69/135 (51.11%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSL--HLKTGQIMRNVLMKCENITSQDKEEV----TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +I+G PGSGK TVS+ I   VKN    HL +G ++R       N+  Q+K E+     S +  G LV DD+++ L+ +E+  I      T ++LDGFPRT  Q  AL     + I     LN P   ++ R   R
Sbjct:   10 VIMGPPGSGKGTVSDRI---VKNFALKHLSSGDLLRT------NV--QNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINE----TNWLLDGFPRTVPQAVAL--DKAFHINSVIDLNVPFQTIKDRLTAR 127          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 59.3066 bits (142), Expect = 1.011e-9
Identity = 48/135 (35.56%), Postives = 69/135 (51.11%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSL--HLKTGQIMRNVLMKCENITSQDKEEV----TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +I+G PGSGK TVS+ I   VKN    HL +G ++R       N+  Q+K E+     S +  G LV DD+++ L+ +E+  I      T ++LDGFPRT  Q  AL     + I     LN P   ++ R   R
Sbjct:   10 VIMGPPGSGKGTVSDRI---VKNFALKHLSSGDLLRT------NV--QNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINE----TNWLLDGFPRTVPQAVAL--DKAFHINSVIDLNVPFQTIKDRLTAR 127          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 53.1434 bits (126), Expect = 1.033e-7
Identity = 39/159 (24.53%), Postives = 77/159 (48.43%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEI 533
            ++ +VGGPGSGK T    I +      HL TG ++R  +    +  S+  + +++ M+ G LV  D V ++L + +  I  +  +  +++DG+PR   Q      K     ++ +I +A    + KR   R   + R DD +  ++ R+  + +  + +
Sbjct:   28 IIFVVGGPGSGKGTQCEKIVHQY-GYTHLSTGDLLRAEV----SSGSERGKHLSAIMEKGELVPLDTVLDMLKEAM--IAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYI-DAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPV 178          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 53.1434 bits (126), Expect = 1.097e-7
Identity = 39/159 (24.53%), Postives = 78/159 (49.06%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEI 533
            ++ +VGGPGSGK T    I +    + HL TG ++R  +    +  S+  + +++ M+ G LV  D V ++L + +  I  +  +  +++DG+PR   Q      K     ++ +I +A    + KR   R   + R DD +  ++ R+  + +  + +
Sbjct:   10 IIFVVGGPGSGKGTQCEKIVHQYGYT-HLSTGDLLRAEV----SSGSERGKHLSAIMEKGELVPLDTVLDMLKEAM--IAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYI-DAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPV 160          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Cmpk1 (cytidine monophosphate (UMP-CMP) kinase 1 [Source:MGI Symbol;Acc:MGI:1913838])

HSP 1 Score: 64.6994 bits (156), Expect = 1.370e-11
Identity = 45/158 (28.48%), Postives = 79/158 (50.00%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKL-ATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++       HL  G+++R+   + +N  SQ  E +   ++ G +V  +I   LL +E+   +A+      F++DGFPR    L         K  V+F+L  +  + I  +RC  R   + R DD +  +E RI  + +
Sbjct:   36 VVFVLGGPGAGKGTQCARIVEKY--GYTHLSAGELLRD---ERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLE 188          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak3 (adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860835])

HSP 1 Score: 61.6178 bits (148), Expect = 1.413e-10
Identity = 43/139 (30.94%), Postives = 68/139 (48.92%), Query Frame = 3
Query:   33 MQMSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            M  SG     +I+G PGSGK TVS+ I    +   HL +G ++R  +++   I    K    + +  G L+ DD+++ L   E+  +        ++LDGFPRT  Q  AL     Y+I     LN P  ++++R   R
Sbjct:    1 MGASGRLLRAVIMGAPGSGKGTVSSRITKHFELK-HLSSGDLLRQNMLQGTEIGVLAK----TFIDQGKLIPDDVMTRLALHELKTLTQCS----WLLDGFPRTLPQAEAL--DKVYQIDTVINLNVPFEVIKQRLTAR 128          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 55.0694 bits (131), Expect = 2.379e-8
Identity = 43/138 (31.16%), Postives = 66/138 (47.83%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTV-SNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            M+      +I+G PGSGK TV   I QN      HL +G ++R  L     +    K+     ++ G LV D +++ L+  E+     ++ A  ++LDGFPRT  Q  AL       +V++  LN P   L+ R   R
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCERIAQNF--GLQHLSSGHLLRENLKTGTEVGDVAKQ----YLEKGLLVPDHVITRLMMSELE----TRSAQHWLLDGFPRTLVQAEALDGICDVDLVIS--LNIPFETLKDRLSRR 126          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 55.0694 bits (131), Expect = 2.379e-8
Identity = 43/138 (31.16%), Postives = 66/138 (47.83%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTV-SNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            M+      +I+G PGSGK TV   I QN      HL +G ++R  L     +    K+     ++ G LV D +++ L+  E+     ++ A  ++LDGFPRT  Q  AL       +V++  LN P   L+ R   R
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCERIAQNF--GLQHLSSGHLLRENLKTGTEVGDVAKQ----YLEKGLLVPDHVITRLMMSELE----TRSAQHWLLDGFPRTLVQAEALDGICDVDLVIS--LNIPFETLKDRLSRR 126          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 55.0694 bits (131), Expect = 2.379e-8
Identity = 43/138 (31.16%), Postives = 66/138 (47.83%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTV-SNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            M+      +I+G PGSGK TV   I QN      HL +G ++R  L     +    K+     ++ G LV D +++ L+  E+     ++ A  ++LDGFPRT  Q  AL       +V++  LN P   L+ R   R
Sbjct:    1 MASKLLRAVILGPPGSGKGTVCERIAQNF--GLQHLSSGHLLRENLKTGTEVGDVAKQ----YLEKGLLVPDHVITRLMMSELE----TRSAQHWLLDGFPRTLVQAEALDGICDVDLVIS--LNIPFETLKDRLSRR 126          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|O96907|KAD_ENTHI (Adenylate kinase OS=Entamoeba histolytica OX=5759 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.739e-14
Identity = 49/175 (28.00%), Postives = 86/175 (49.14%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFI-LNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEI--RIALTNLKVSIID 572
             ++++GGPG+GK T    I+  + +S H+ TG ++R  +     I  +    V   +++G LV D+I+  ++N    N IA     + + DG+PR  +QL AL+ ++  +  +  I L  P  IL +R   R   + R DD       R++ +    DE+   I   NL   ++D
Sbjct:    5 FLIMLGGPGAGKGTQCANIEKHLNSSAHISTGDLLRAEIKNKTEIGLK----VEDIIRNGQLVSDEIICNMVN----NFIAKNEKEVIVFDGYPRAVSQLEALLKEATAETKICVINLEIPDEILIQRIVSRGKTSGRADDNTEAAAKRLAVYHAQHDEMIKAIKAKNLPYFVVD 171          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|P30085|KCY_HUMAN (UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3)

HSP 1 Score: 66.2402 bits (160), Expect = 1.754e-11
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKL-ATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++       HL  G+++R+   + +N  SQ  E +   ++ G +V  +I   LL +E+   +A+      F++DGFPR    L         K  V+F+L  +  + I  +RC  R   + R DD +  +E RI  + Q
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKY--GYTHLSAGELLRD---ERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQ 157          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|Q29561|KCY_PIG (UMP-CMP kinase OS=Sus scrofa OX=9823 GN=CMPK1 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.895e-11
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLA-TIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++       HL  G+++R+   + +N  SQ  E +   ++ G +V  +I   LL +E+   +A+      F++DGFPR    L         K  V+F+L  +  + I  +RC  R   + R DD +  +E RI  + Q
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKY--GYTHLSAGELLRD---ERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQ 157          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|Q2KIW9|KCY_BOVIN (UMP-CMP kinase OS=Bos taurus OX=9913 GN=CMPK1 PE=2 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 2.027e-11
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLA-TIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I++       HL  G+++R+   + +N  SQ  E +   ++ G +V  +I   LL +E+   +A+      F++DGFPR    L         K  V+F+L  +  + I  +RC  R   + R DD +  +E RI  + Q
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKY--GYTHLSAGELLRD---ERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQ 157          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|A6GZB9|KAD_FLAPJ (Adenylate kinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) OX=402612 GN=adk PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.693e-11
Identity = 53/160 (33.12%), Postives = 75/160 (46.88%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTAL---MAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDE 530
            +++ G PG+GK T +  ++    N  HL TG I R      +N T   K   T  M  G LV D +  ++L  E+     SK    F+ DGFPRT AQ  AL   +A    ++  T  L A   IL +R   R   + RVDD+    E +I +  Q  +E
Sbjct:    4 IVLFGKPGAGKGTQAEFLKEKY-NLTHLSTGDIFR---FNIKNETELGKLAKT-FMDKGDLVPDAVTIKMLESEVDKNQHSK---GFLFDGFPRTLAQAAALDTFLASKDQEVTATIALEADDEILVQRLLERGKTSGRVDDQD---EEKIRNRYQEYNE 152          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A535WUJ3 (Adenylate kinase OS=Chloroflexi bacterium OX=2026724 GN=adk PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.414e-13
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTAL---MAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDT 581
            +I G PGSGK T + ++ +   N +HL TG+I+R+ + +   +      EV   MQ G LV DD+V  ++ + +  +    L     LDGFPRT  Q  AL   +A +  ++     L AP  +L +R   R     R DD +  +E R+ ++     E+     +  V + ++D 
Sbjct:    4 VIFGPPGSGKGTQAALLHDRF-NLVHLSTGEILRHEVARGSELGR----EVGRIMQAGQLVPDDLVDRVVQEHLRQVEGDVL-----LDGFPRTVEQAKALDEMLADADRRVDFVIALEAPEKLLVERLLHRAQVEGRADDTRQAIEERMHEYRTRTAEVLDHYRSTGVPVFEVDA 169          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A4E0RVR6 (UMP-CMP kinase OS=Fasciola hepatica OX=6192 GN=D915_003386 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.084e-13
Identity = 56/195 (28.72%), Postives = 89/195 (45.64%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVV--TFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENM----TKKIEEY 623
            +  I+GGPG+GK TV   I +     +HL  G+++R     CE   S  +EE+   M++G +V   +   LL++ + +       T +++DGFPR     T    +   K  V    +L+ P  I  KRC  R L   R+DD +  ++ R+  F +    + I     K  +  ID     E M     K +EEY
Sbjct:    5 VCFILGGPGAGKGTVCQKIVDD-HGFVHLSAGELLRKA---CEGSDSPYREEIQQHMKNGSIVPAKVTCGLLHQAMVDGFKQSGCTNYLIDGFPRNDDNRTCWEEEMNSKAAVRRVIVLDCPDDICVKRCMGRGL--GRIDDNQETLQRRLRQFKEQCVPV-IQFYEAKGLVSRIDASTSMEEMFVQLKKIVEEY 192          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A5Q4E7S8 (Adenylate kinase OS=Bacteroidetes bacterium OX=1898104 GN=EA361_14800 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.657e-13
Identity = 50/154 (32.47%), Postives = 81/154 (52.60%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQ---LTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDF 512
            +++ G PG+GK T S  + +   N  ++ TG+++R  + +  +I  + KE     ++ GGL  D+ + +L+NK I N   S+    F+ DGFPRT  Q   L  L  + Q KI   FIL  P    ++R   R    DR DDR+  +E R+ ++
Sbjct:    4 IIMFGPPGAGKGTQSQKLMSEY-NLTYISTGELLRKEIKEGTDIGKKVKE----GIEGGGLADDETIVKLINKAIRNHEGSEG---FLFDGFPRTYVQAYILDGLFIRLQNKITRIFILELPDEECKRRLLQRATEQDRKDDREAVIEKRLQEY 149          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A2V8U5M3 (Adenylate kinase (Fragment) OS=Acidobacteria bacterium OX=1978231 GN=DMG59_02560 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.976e-13
Identity = 49/119 (41.18%), Postives = 68/119 (57.14%), Query Frame = 3
Query:   54 CLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDK--EEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQ---LTALMAKSQYKIVV 395
            CL+L  G PGSGK T + ++Q S+  + H+ TG ++R      E +TS D   +EV + MQ GGLV D +V+ ++ K I        AT FILDGFPRT +Q   L  L+A  +   VV
Sbjct:    5 CLILF-GPPGSGKGTQAKLLQQSLGVA-HISTGDMLR------ERMTSADPLGQEVVAVMQSGGLVPDKLVNRMVEKRIEE---PDCATGFILDGFPRTVSQARLLVGLLAARKISPVV 112          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A169Q425 (Adenylate kinase OS=Ichthyobacterium seriolicida OX=242600 GN=adk PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.154e-13
Identity = 55/156 (35.26%), Postives = 81/156 (51.92%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEV--TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQ---LTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDF 512
            ++++G PGSGK T S  I N + +  H+ TG + R      ENI  Q +  V   S +  G LV DDI   +L KE+ + + SK    FI DGFPRT  Q   L + M+K+   I     L+    IL++R   R   ++R DD    ++ RI+D+
Sbjct:    4 IILLGAPGSGKGTQSQEIIN-LYDLCHISTGNMFR------ENIKEQTELGVLAKSYLDRGELVPDDITISMLEKEVKSNLNSKG---FIFDGFPRTKQQAISLDSFMSKNSMSINYAISLDVSDDILKERLLRRGKDSNRSDDNPDIIDSRIADY 149          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:103033473])

HSP 1 Score: 61.6178 bits (148), Expect = 1.113e-10
Identity = 47/132 (35.61%), Postives = 69/132 (52.27%), Query Frame = 3
Query:   63 LIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMR-NVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNL 455
            +I+G PGSGK TVSN I +S     HL +G I+R N+  K E         + S +  G LV DD++S L+   + N+  S     ++LDGFPRT AQ  +L +      V+   L+ P   +++R   R L
Sbjct:   10 VIMGPPGSGKGTVSNRITDSFGLK-HLSSGDILRANIKAKTEL-----GLLMKSCIDQGQLVPDDVISRLILSNLRNMDHSS----WLLDGFPRTVAQAESLDSMCTVDTVIN--LDVPFQTIKERLTSRWL 129          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: cmpk (cytidine/uridine monophosphate kinase 1 [Source:NCBI gene;Acc:103043729])

HSP 1 Score: 60.8474 bits (146), Expect = 1.746e-10
Identity = 45/158 (28.48%), Postives = 75/158 (47.47%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNII-ASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            +V ++GGPG+GK T  + I+QN   +  HL  G ++R    +     S+  + + S ++ G +V  +I   LL K +   + A +    F++DGFPR    L         K  V F+L  +  + +   RC  R   + R DD +  +E RI  + Q
Sbjct:   28 VVFVLGGPGAGKGTQCARIVQNY--SYTHLSAGDLLREERSR---TGSEFGQLIDSYIKEGKIVPVEITINLLRKAMEETMKADENKFRFLIDGFPRNQDNLQGWTTVMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQ 180          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 58.9214 bits (141), Expect = 1.035e-9
Identity = 43/132 (32.58%), Postives = 66/132 (50.00%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEV--TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
             +I+G PGSGK T+S  I        HL +G  +R      ENI S  +  V   + ++ G LV D +++ LL   +  +        ++LDGFPRT AQ  AL +  +  +V++  LN P   L++R   R
Sbjct:    7 AVIMGPPGSGKGTISERIARGFGLQ-HLSSGDFLR------ENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTCHS----WLLDGFPRTLAQAEALNSSCELDLVIS--LNIPLETLKERLSHR 125          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 58.9214 bits (141), Expect = 1.189e-9
Identity = 43/132 (32.58%), Postives = 66/132 (50.00%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEV--TSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
             +I+G PGSGK T+S  I        HL +G  +R      ENI S  +  V   + ++ G LV D +++ LL   +  +        ++LDGFPRT AQ  AL +  +  +V++  LN P   L++R   R
Sbjct:   14 AVIMGPPGSGKGTISERIARGFGLQ-HLSSGDFLR------ENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTCHS----WLLDGFPRTLAQAEALNSSCELDLVIS--LNIPLETLKERLSHR 132          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 51.2174 bits (121), Expect = 2.609e-7
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRI 503
            ++ +VGGPGSGK T    +      + HL +G ++R  +       S+  +++ + MQ G LV  D V +++   +  I  + ++  F++DG+PR   Q      K     ++ ++ +A    + KR   R   + R DD +  ++ R+
Sbjct:   10 IIFVVGGPGSGKGTQCEKVVAKYGYT-HLSSGDLLRAEVASG----SERGKQLQAIMQKGELVPLDTVLDMIKDAM--IAKADVSKGFLIDGYPREVKQGEEFEKKIGAPALLLYV-DAKSETMVKRLMKRGETSGRADDNEETIKKRL 150          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 46.2098 bits (108), Expect = 3.067e-6
Identity = 39/150 (26.00%), Postives = 66/150 (44.00%), Query Frame = 3
Query:   72 GGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQH 521
            GGPGSGK T S  +  S    + +  G+++R  +++    +++    +   +  G L   +     L +   + + +  A  F++DGFPR  +Q  A   +      V  +  A    L +R   R  R  R DD    VE R++ F QH
Sbjct:    1 GGPGSGKGTQSRKLSESY-GLVCVSLGEVLRQHVLQ-RAPSNRKWRLIAQIISKGELAPQETAIWELKQ---HFLQNPDAPGFVIDGFPREISQALAFEEQVGAPDAVILLACASER-LRQRLGERADRHGRPDDNPRAVERRLATFRQH 144          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 62.3882 bits (150), Expect = 6.671e-12
Identity = 42/115 (36.52%), Postives = 62/115 (53.91%), Query Frame = 3
Query:   42 SGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTAL--MAKSQ 380
            S  +  ++++G PG+GK T +  +Q    ++ HL TG ++R+ + K     +Q   E    M  GGLV DDI+  ++  E++N  A K    FILDGFPRT  Q   L  M K Q
Sbjct:    3 SSESIRMVLIGPPGAGKGTQAPNLQERF-HAAHLATGDMLRSQIAKG----TQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNG--FILDGFPRTIPQAEKLDQMLKEQ 110          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 59.3066 bits (142), Expect = 9.084e-11
Identity = 32/98 (32.65%), Postives = 56/98 (57.14%), Query Frame = 3
Query:   72 GGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTAL 365
            G PGSGK T ++ +   +     + +G I+R  + K E+   +   E T+ +  G L+ DD+++ L+   +S +   K + +++LDGFPRT AQ +AL
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEI-KSESTLGR---EATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASAL 114          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 51.2174 bits (121), Expect = 3.652e-8
Identity = 42/157 (26.75%), Postives = 78/157 (49.68%), Query Frame = 3
Query:   57 LVLIVGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEIS-NIIASKLATIFILDGFPRTAAQLTALMAK-SQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
            ++ ++GGPG+GK T    ++++   + +HL  G ++R    +     SQ  E + + ++ G +V  +I   LL   IS N+ A+K    F++DGFPR   Q  +      + K ++ F  + P  I+ +R   R   + R DD    ++ R + F +
Sbjct:   18 VIFVLGGPGAGKGTQCEKLVKDY--SFVHLSAGDLLRAEQGRA---GSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHK--FLIDGFPRKMDQAISFERDIVESKFILFF--DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKE 165          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 55.0694 bits (131), Expect = 6.050e-9
Identity = 39/127 (30.71%), Postives = 64/127 (50.39%), Query Frame = 3
Query:   69 VGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
            +G PGSGK TVS  I        HL +G+++R+ +    ++     EE  + +  G LV D+++ +L+  E+     +     ++LDGFPRT  Q   L  K +  +VV   ++ P A +  R K R
Sbjct:    1 MGPPGSGKGTVSERIVRDF-GVEHLSSGELLRHHVQNHTDLG----EEAQAYILKGELVPDELMVDLILHELDAKKGN-----WLLDGFPRTVGQAETLSEKHKIDVVVN--MDVPFATIVDRIKQR 115          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO36160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH0])

HSP 1 Score: 51.2174 bits (121), Expect = 8.793e-8
Identity = 40/150 (26.67%), Postives = 64/150 (42.67%), Query Frame = 3
Query:   33 MQMSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFIL--NAPHAILEKRCKMRNLRTDRVDD 476
            M  +    ++ ++GGPG+GK T    I       +HL  G+++R          S+D + + + M  G +V   I   LL K ++     K    F++DGFPR    L    ++   K+ V  +L    P  I   R   R   + R DD
Sbjct:    1 MSSASKPVVIFVLGGPGAGKGTQCERIVKEY-GYVHLSAGELLREE----RRSGSKDGDLIENCMTEGKIVPVAITVSLLQKAMAKSDVQK----FLIDGFPRNEDNLQGWESRMNDKVDVKAVLFFECPEDICIGRIMSRGQSSGRPDD 141          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO38864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK9])

HSP 1 Score: 50.447 bits (119), Expect = 1.566e-7
Identity = 40/149 (26.85%), Postives = 69/149 (46.31%), Query Frame = 3
Query:   69 VGGPGSGKST-VSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDF 512
            +GGPGSGK T  + I++       H  TG ++R  +    N  S+  + + + M+ G LV + I+ ELL      ++     T F++DGFPR   Q      +     ++ +   +P   ++ R   R   + RVDD +  +  R+  F
Sbjct:    1 LGGPGSGKGTQCARIVEKF--GYTHFSTGDLLREEV----NSGSERGKNIVAMMEKGELVPNGIILELLR---LAMVKQPNTTGFLIDGFPRELEQGLEFEKELALCELLLYFECSPDT-MKARLLKRGETSGRVDDNEETILSRLETF 139          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO30550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G9])

HSP 1 Score: 48.9062 bits (115), Expect = 7.753e-7
Identity = 40/135 (29.63%), Postives = 65/135 (48.15%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQ---LTALMAKSQYKIVVTFILNAPHAILEKRCKMRNL 455
             +++G PGSGK T   + +  +   + L    ++R V+     +     ++V S M  G LV DD+V EL++    N+   +    ++LDGFPRT AQ   L  L+ K   ++      N   ++L KR   R L
Sbjct:   17 AILLGPPGSGKGT--QVKRRRISIVVCLLFCDMLRAVVASGSALG----KKVKSVMDAGQLVSDDLVVELID---DNLTKPECQNGWLLDGFPRTVAQAEKLDGLLEKRNAQLDAVVEFNIADSLLVKRITGRLL 142          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 46.2098 bits (108), Expect = 4.896e-6
Identity = 37/154 (24.03%), Postives = 67/154 (43.51%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQ 518
             ++ +GGPG+GK T+ + +     N  HL  G ++R  + +     ++  + +T  M+ G LV  +I   LL   +      K    F++DGFPR   Q      +      V + L     ++++R   R   + R DD    ++ R   F +
Sbjct:    3 YIITLGGPGAGKGTICDSVVKKY-NYCHLSAGDLLREEVTR----GNERGQMITEMMREGKLVPKEITIGLLQDAMRE---HKDMPGFLIDGFPRDIDQGITFEEQVTDSDFVLY-LECTEEVMQERLLKRAETSGRPDDNIETIKKRFVTFLE 147          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:101160331])

HSP 1 Score: 56.225 bits (134), Expect = 8.630e-9
Identity = 45/132 (34.09%), Postives = 65/132 (49.24%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEE--VTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
             +I+G PGSGK TVS  I  S     H+ +G I+R       NI  Q +    V S M  G LV D ++S L+ K++ ++        ++LDGFPRT +Q  AL     Y +     LN P   +++R   R
Sbjct:   10 AVIMGPPGSGKGTVSARIVKSF-GVKHISSGDILR------ANIKQQTELGLLVRSCMDQGQLVPDGLMSRLILKDLKSM----EHISWLLDGFPRTVSQAEAL--DQAYTLDTVINLNVPFQTIKERLTSR 128          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 51.2174 bits (121), Expect = 2.836e-7
Identity = 46/195 (23.59%), Postives = 91/195 (46.67%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDK-EEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFK 638
            ++ +VGGPGSGK T    I      + HL +G ++R      E  +  D+ +++ + MQ G LV  D V +++   +  I  + ++  F++DG+PR   Q      K     ++ ++ +A    + KR   R   + R DD +  ++ R+ D      E  IA    +  +  +D+  P + +  ++ + + + K
Sbjct:   10 IIFVVGGPGSGKGTQCERIVAKYGYT-HLSSGDLLR-----AEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAM--IAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYV-DAKSETMIKRLLKRGETSGRSDDNEETIKKRL-DLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 194          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 50.8322 bits (120), Expect = 3.105e-7
Identity = 46/195 (23.59%), Postives = 91/195 (46.67%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDK-EEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFK 638
            ++ +VGGPGSGK T    I      + HL +G ++R      E  +  D+ +++ + MQ G LV  D V +++   +  I  + ++  F++DG+PR   Q      K     ++ ++ +A    + KR   R   + R DD +  ++ R+ D      E  IA    +  +  +D+  P + +  ++ + + + K
Sbjct:   10 IIFVVGGPGSGKGTQCERIVAKYGYT-HLSSGDLLR-----AEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAM--IAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYV-DAKSETMIKRLLKRGETSGRSDDNEETIKKRL-DLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 194          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 50.8322 bits (120), Expect = 3.387e-7
Identity = 46/195 (23.59%), Postives = 91/195 (46.67%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDK-EEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFK 638
            ++ +VGGPGSGK T    I      + HL +G ++R      E  +  D+ +++ + MQ G LV  D V +++   +  I  + ++  F++DG+PR   Q      K     ++ ++ +A    + KR   R   + R DD +  ++ R+ D      E  IA    +  +  +D+  P + +  ++ + + + K
Sbjct:   16 IIFVVGGPGSGKGTQCERIVAKYGYT-HLSSGDLLR-----AEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAM--IAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYV-DAKSETMIKRLLKRGETSGRSDDNEETIKKRL-DLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 200          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:101169712])

HSP 1 Score: 51.2174 bits (121), Expect = 4.885e-7
Identity = 38/122 (31.15%), Postives = 62/122 (50.82%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQ---LTALMAKSQYKI--VVTFILN 410
             +++G PG+GK T +  +        HL TG ++R ++     +  + K+     M  G LV D++V EL+ K   N+  +     F+LDGFPRT  Q   L  L+ K Q K+  V+ F ++
Sbjct:   20 AILLGPPGAGKGTQAPRLAEKY-CVCHLATGDMLRAMVASGSELGKRLKQ----TMDSGKLVSDEMVVELIEK---NLDTAACKNGFLLDGFPRTVKQAEMLDDLLDKRQEKLDSVIEFSVD 133          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000006671.1 (SMESG000006671.1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.399e-147
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFKFK 644
            MSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFKFK
Sbjct:    1 MSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFKFK 202          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000039607.1 (SMESG000039607.1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.665e-146
Identity = 201/202 (99.50%), Postives = 201/202 (99.50%), Query Frame = 3
Query:   39 MSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFKFK 644
            MSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQL ALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFKFK
Sbjct:    1 MSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLNALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKTFKFK 202          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000043151.1 (SMESG000043151.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.366e-36
Identity = 71/181 (39.23%), Postives = 104/181 (57.46%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRKGPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKEN 599
            ++ I+GGPG+GK+T+S  + N + NS+ LK+G ++R+ L    +   ++ + V   M+ GGLV D +V +++  EI  II    A   I DG+PRT  QL          +    +L AP  ILEKRCK+RNLRTDR+DD + PV  R+ DF  H+ EI   L    +  + I TC P E+
Sbjct:    8 VICILGGPGAGKTTLSTALINKIPNSIVLKSGSLIRSSL---NSFDHKECKNVNFVMEQGGLVDDKVVCQIMKNEILKIIKKGSAHNIIFDGYPRTLEQLNNF-DHLPVNLCGIIVLEAPELILEKRCKIRNLRTDRIDDLQQPVAERVQDFRNHIGEILSELQEKSIKNLKISTCGPVED 184          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000053790.1 (SMESG000053790.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.666e-11
Identity = 46/177 (25.99%), Postives = 82/177 (46.33%), Query Frame = 3
Query:   57 LVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQLTAL--MAKSQYKIVVTFILNAPHAILEKRCKMRNLRTD--RVDDRKGPVEHRISDF-TQHLDEIRIALTNLKVSIID 572
            +V  +GGPG+GK T+ N ++ ++ N  HL  GQ++R V      +   +   +   M  G +V  +I   L+   +  +   K   I I+DGFPR  +   +   ++ S+  ++  F L      +  RC  RN      R+DD    ++ RIS +  + L  I++   N  +  +D
Sbjct:   12 IVFFLGGPGTGKGTICNFLEKNL-NIYHLSVGQLLREV-----KVCDPEYLVIKKHMGEGSIVSSEISCRLIEDALITLNKYK---IVIIDGFPRNFSNYYSWKKLSSSKMNLLKIFHLTCHENAMLNRCLSRNQLNSIKRLDDEANTIKSRISQYNNETLPLIQLFHENYHIETVD 179          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000037481.1 (SMESG000037481.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.966e-10
Identity = 44/133 (33.08%), Postives = 66/133 (49.62%), Query Frame = 3
Query:   60 VLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKCENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDGFPRTAAQ---LTALMAKSQYKIVVTFILNAPHAILEKRCKMR 449
             +++G  GSGK T +  +    K   HL TG ++R ++     +  Q    +   MQ GGL+ D+IV +L+++   N+        F+LDGFPRT  Q   L AL+ K    I     L+A   ILE+R   R
Sbjct:   15 AILLGPSGSGKGTQAPKLAEKFK-ICHLSTGDMLRAIVSSGSPLGRQ----INEIMQKGGLISDEIVCKLISE---NLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGR 139          
The following BLAST results are available for this feature:
BLAST of Adenylate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CMPK15.540e-1229.11cytidine/uridine monophosphate kinase 1 [Source:HG... [more]
AK32.581e-1130.94adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17... [more]
AK46.715e-929.88adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK46.715e-929.88adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK46.715e-929.88adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:36... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F40F8.17.537e-1128.66UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.17.537e-1128.66UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.17.537e-1128.66UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.17.537e-1128.66UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.11.824e-1028.66UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adk33.962e-1434.88gene:FBgn0042094 transcript:FBtr0082331[more]
Adk33.962e-1434.88gene:FBgn0042094 transcript:FBtr0339379[more]
Adk33.962e-1434.88gene:FBgn0042094 transcript:FBtr0082330[more]
Adk33.962e-1434.88gene:FBgn0042094 transcript:FBtr0339378[more]
Adk12.747e-827.16gene:FBgn0022709 transcript:FBtr0076017[more]
back to top
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmpk2.416e-1027.85cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk2.466e-1027.85cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk2.932e-1027.85cytidylate kinase [Source:NCBI gene;Acc:406383][more]
ak41.151e-831.82adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.151e-831.82adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncan7.282e-1029.11neurocan [Source:Xenbase;Acc:XB-GENE-961217][more]
ak37.902e-1035.56adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
ak31.011e-935.56adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
ak11.033e-724.53adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak11.097e-724.53adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
back to top
BLAST of Adenylate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cmpk11.370e-1128.48cytidine monophosphate (UMP-CMP) kinase 1 [Source:... [more]
Ak31.413e-1030.94adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860... [more]
Ak42.379e-831.16adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak42.379e-831.16adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak42.379e-831.16adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
back to top
BLAST of Adenylate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O96907|KAD_ENTHI8.739e-1428.00Adenylate kinase OS=Entamoeba histolytica OX=5759 ... [more]
sp|P30085|KCY_HUMAN1.754e-1129.11UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE... [more]
sp|Q29561|KCY_PIG1.895e-1129.11UMP-CMP kinase OS=Sus scrofa OX=9823 GN=CMPK1 PE=1... [more]
sp|Q2KIW9|KCY_BOVIN2.027e-1129.11UMP-CMP kinase OS=Bos taurus OX=9913 GN=CMPK1 PE=2... [more]
sp|A6GZB9|KAD_FLAPJ3.693e-1133.13Adenylate kinase OS=Flavobacterium psychrophilum (... [more]
back to top
BLAST of Adenylate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A535WUJ33.414e-1328.98Adenylate kinase OS=Chloroflexi bacterium OX=20267... [more]
A0A4E0RVR64.084e-1328.72UMP-CMP kinase OS=Fasciola hepatica OX=6192 GN=D91... [more]
A0A5Q4E7S84.657e-1332.47Adenylate kinase OS=Bacteroidetes bacterium OX=189... [more]
A0A2V8U5M36.976e-1341.18Adenylate kinase (Fragment) OS=Acidobacteria bacte... [more]
A0A169Q4257.154e-1335.26Adenylate kinase OS=Ichthyobacterium seriolicida O... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak31.113e-1035.61adenylate kinase 3 [Source:NCBI gene;Acc:103033473... [more]
cmpk1.746e-1028.48cytidine/uridine monophosphate kinase 1 [Source:NC... [more]
ak41.035e-932.58adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak41.189e-932.58adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak12.609e-724.83adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ak5l3.067e-626.00adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ADK16.671e-1236.52Adenylate kinase, required for purine metabolism; ... [more]
ADK29.084e-1132.65Mitochondrial adenylate kinase; catalyzes the reve... [more]
URA63.652e-826.75Uridylate kinase; catalyzes the seventh enzymatic ... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425836.050e-930.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361608.793e-826.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388641.566e-726.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305507.753e-729.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388634.896e-624.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak38.630e-934.09adenylate kinase 3 [Source:NCBI gene;Acc:101160331... [more]
ak12.836e-723.59adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak13.105e-723.59adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak13.387e-723.59adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak24.885e-731.15adenylate kinase 2 [Source:NCBI gene;Acc:101169712... [more]
back to top
BLAST of Adenylate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006671.12.399e-147100.00SMESG000006671.1[more]
SMESG000039607.11.665e-14699.50SMESG000039607.1[more]
SMESG000043151.11.366e-3639.23SMESG000043151.1[more]
SMESG000053790.11.666e-1125.99SMESG000053790.1[more]
SMESG000037481.11.966e-1033.08SMESG000037481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027361 ID=SMED30027361|Name=Adenylate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1084bp
CTTCCGATCTAAATTGAGTGCTAAGGTCATAGATGCAAATGTCTGGAACA
ACATGTCTCGTACTAATAGTTGGGGGGCCAGGCTCGGGTAAATCTACTGT
ATCAAATATTATTCAAAACAGTGTTAAAAATTCTTTGCATTTGAAAACTG
GGCAGATTATGCGTAATGTTCTTATGAAATGTGAAAATATAACTTCACAA
GATAAAGAAGAAGTGACTAGTGCAATGCAACATGGTGGACTTGTTAAAGA
TGATATCGTTTCAGAACTTTTAAACAAAGAAATTTCAAATATAATAGCTA
GTAAATTGGCTACAATATTTATTCTGGATGGATTTCCGCGAACAGCCGCT
CAACTTACTGCGTTGATGGCTAAAAGCCAATATAAAATCGTAGTAACTTT
TATTTTGAACGCACCACATGCGATTTTGGAAAAGCGTTGTAAAATGCGTA
ATCTTAGAACGGATCGTGTTGATGACCGTAAAGGACCTGTTGAACATAGA
ATAAGTGATTTTACCCAACACTTGGATGAAATTCGAATTGCTCTAACAAA
TCTTAAAGTTTCAATAATTGACATCGATACCTGTGATCCAAAGGAAAATA
TGACAAAAAAAATTGAAGAATATTTGAAAACTTTTAAATTTAAATAGAAA
ATACAATCGTATTTAAATAAATAAAAATGTTTTTTTCAGAAATTAGCATT
TTAAAACTTTTATTTGCCAGACTGTAAAATTCTTGCTTTTTAATGAGTAG
GTGTGGCTATATTTGCATGGAACAGAATTATTGGTTTTGAAAATTTAATT
TTCGATTTAGTTTTGAATATATAATTTGAATTTAGTTGTGGTTTTGTTTG
GAAAATATTGCCATTTTAAAAAATTTATCTGTTGAAATATTTGATGAGTT
TTTAAAATCTATTTCGTTGATTTATTTATATTTCTGGCTGAAAAGAAATT
TTTAATGGATTTGTGTCATGATATTTACCAGGGTTATTTGTAACTAATAG
CATCAATGTTAAAGTAGGTCAAGCGTATGAATGTTATTTTTAATGTTTTC
TTTTGAGGTCACAAAGCCAGCAAACTACTGCTTC
back to top

protein sequence of SMED30027361-orf-1

>SMED30027361-orf-1 ID=SMED30027361-orf-1|Name=SMED30027361-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=205bp
MQMSGTTCLVLIVGGPGSGKSTVSNIIQNSVKNSLHLKTGQIMRNVLMKC
ENITSQDKEEVTSAMQHGGLVKDDIVSELLNKEISNIIASKLATIFILDG
FPRTAAQLTALMAKSQYKIVVTFILNAPHAILEKRCKMRNLRTDRVDDRK
GPVEHRISDFTQHLDEIRIALTNLKVSIIDIDTCDPKENMTKKIEEYLKT
FKFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0044209AMP salvage
GO:0046940nucleoside monophosphate phosphorylation
GO:0006139nucleobase-containing compound metabolic process
GO:0009165nucleotide biosynthetic process
GO:0016310phosphorylation
GO:0046939nucleotide phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR033690Adenylat_kinase_CS
IPR000850Adenylat/UMP-CMP_kin
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0019205nucleobase-containing compound kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004017adenylate kinase activity
GO:0008270zinc ion binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0016776phosphotransferase activity, phosphate group as acceptor
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000850Adenylate kinase/UMP-CMP kinasePRINTSPR00094ADENYLTKNASEcoord: 11..24
score: 52.18
coord: 96..112
score: 53.84
coord: 145..160
score: 29.87
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 10..195
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 10..136
e-value: 1.56255E-23
score: 90.759
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 8..200
e-value: 8.8E-33
score: 115.8
NoneNo IPR availablePFAMPF00406ADKcoord: 12..164
e-value: 1.0E-21
score: 77.6
NoneNo IPR availablePANTHERPTHR23359:SF107UMP-CMP KINASEcoord: 10..195
IPR033690Adenylate kinase, conserved sitePROSITEPS00113ADENYLATE_KINASEcoord: 96..107
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 8..201