Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Overview
NamePhospholysine phosphohistidine inorganic pyrophosphate phosphatase
Smed IDSMED30027357
Length (bp)1108
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (SMED30027357) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (SMED30027357) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (SMED30027357) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (SMED30027357) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027357

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027357h1SMcG0011103 SmedASXL_070147SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30027357h1SMcG0011103 dd_Smed_v4_8083_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027357h1SMcG0011103 dd_Smed_v4_8083_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027357h1SMcG0011103 dd_Smed_v6_8083_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Human
Match: LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:HGNC Symbol;Acc:HGNC:30042])

HSP 1 Score: 188.348 bits (477), Expect = 5.320e-57
Identity = 100/269 (37.17%), Postives = 164/269 (60.97%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSD 984
            + +L+DI GVL++S + G  ++   S++A+ +L+  +      TNESQ     L+  L  +GF +  + + +P  A  +I+++  L+P+ +I D +++     D    + VV+ DA  +FSY+ MN AFQ L++  K   ++ GKG+YY+++  GL+LD+GP+ +ALE+A   KAE++GKP   FF++AL        Q IG+   ++  M+GDDI+ DVGGAQ  GM  + VR+GK+RP DEHHP VK    V+ + + V+ L   +D
Sbjct:   12 RGVLLDISGVLYDSGAGGGTAIAG-SVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETS-GLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSAL--------QAIGVE-AHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHAD 269          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Human
Match: HDHD2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25364])

HSP 1 Score: 144.05 bits (362), Expect = 3.668e-40
Identity = 83/256 (32.42%), Postives = 137/256 (53.52%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNC 945
            KA+L+D+ G L     + E + + G+ +A+K+L+        +TN ++     LLE L  + F +  + I++ L A + ++E+  ++P  ++ D            + ++VV+  A  +F Y+ +N+AF+ L+    +  +   K +YY+  K GL L  GPF  ALE+ATD KA ++GKP   FF  AL      P++ +         M+GDD  +DVGGAQ VGM G+LV++GKYR  DE    + P   + C
Sbjct:    8 KAVLVDLSGTL-----HIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDG--APLIAIHKARYYK-RKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAV---------MIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEK--INPPPYLTC 244          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Human
Match: LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:HGNC Symbol;Acc:HGNC:30042])

HSP 1 Score: 134.035 bits (336), Expect = 6.605e-37
Identity = 68/203 (33.50%), Postives = 123/203 (60.59%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGM 786
            + +L+DI GVL++S + G  ++   S++A+ +L+  +      TNESQ     L+  L  +GF +  + + +P  A  +I+++  L+P+ +I D +++     D    + VV+ DA  +FSY+ MN AFQ L++  K   ++ GKG+YY+++  GL+LD+GP+ +ALE+A   KAE++GKP   FF++AL  +     Q++ +
Sbjct:   12 RGVLLDISGVLYDSGAGGGTAIAG-SVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETS-GLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQLLSV 212          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Human
Match: LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:HGNC Symbol;Acc:HGNC:30042])

HSP 1 Score: 133.265 bits (334), Expect = 1.436e-36
Identity = 68/200 (34.00%), Postives = 120/200 (60.00%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQV 777
            + +L+DI GVL++S + G  ++   S++A+ +L+  +      TNESQ     L+  L  +GF +  + + +P  A  +I+++  L+P+ +I D +++     D    + VV+ DA  +FSY+ MN AFQ L++  K   ++ GKG+YY+++  GL+LD+GP+ +ALE+A   KAE++GKP   FF++AL  +     Q 
Sbjct:   12 RGVLLDISGVLYDSGAGGGTAIAG-SVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETS-GLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQA 209          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Human
Match: HDHD2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25364])

HSP 1 Score: 102.064 bits (253), Expect = 6.540e-25
Identity = 62/214 (28.97%), Postives = 110/214 (51.40%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGD 819
            KA+L+D+ G L     + E + + G+ +A+K+L+        +TN ++     LLE L  + F +  + I++ L A + ++E+  ++P  ++ D            + ++VV+  A  +F Y+ +N+AF+ L+    +  +   K +YY+  K GL L  GPF  ALE+ATD KA ++GKP   FF  AL      P++ +         M+GD
Sbjct:    8 KAVLVDLSGTL-----HIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDG--APLIAIHKARYYK-RKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAV---------MIGD 204          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Celegans
Match: C13C4.4 (pep chromosome:WBcel235:V:12109168:12110978:-1 gene:WBGene00007548.1 transcript:C13C4.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C13C4.4)

HSP 1 Score: 146.747 bits (369), Expect = 1.914e-41
Identity = 87/266 (32.71%), Postives = 144/266 (54.14%), Query Frame = 1
Query:  181 ALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKL-QNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFA 975
              L+DI GVL+NS    +   +  S +A+  L Q+ K  F  L+N        +   L  +G  ++ E++ +P   + +   ++ L+P   + D++  Y    D    + VV+ +    FS++ +N+AF+ LI  PK   +T G GK+++    G  +D+G F  AL+F+T+ +   IGKP   +F   +N L   P++++         MVGDD+++DVGGAQ+ GM GV VR+GK+RP+ E  P V P +  +C+ D V KL A
Sbjct:    9 GFLLDITGVLYNSIYKSDGVAVPKSAEAVNFLYQHSKVKF--LSNAKGNSNRNVARRLQRLGINVREEDVITPAPVVAQYCRENKLRPHLFVRDDVLEYFDGIDTSSPNCVVMGEVEEGFSFDRINRAFRILIDMPKPLLITMGNGKFFQRVD-GPCIDVGAFAAALKFSTNCEVLNIGKPSRFYFEQGMNALGMKPEEIV---------MVGDDLMSDVGGAQACGMRGVQVRTGKWRPDFEKMP-VTPDLTADCLYDAV-KLIA 260          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Celegans
Match: K08B12.3 (pep chromosome:WBcel235:V:6235176:6237807:1 gene:WBGene00019522.1 transcript:K08B12.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08B12.3)

HSP 1 Score: 119.013 bits (297), Expect = 3.815e-31
Identity = 83/268 (30.97%), Postives = 143/268 (53.36%), Query Frame = 1
Query:  169 SKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKL-QNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKL 969
            SK  ++LID+ G +     + E   I G+  A++ L Q+ K  F  +TN ++    +L + L + GF+++ E I++ L A +++I K+  +PF I+ D           D+ ++VV+  A   F+  T+  AF+ LI+  K+  +   KG+Y++ +  GL L  G +   LE++   +A I+GKP  LFF +AL  L+ N D        +   M+GDD+ +D  GA  +GM  +LV++GK+R  DE       + + N  N FV+ +
Sbjct:    2 SKISSVLIDLSGTI-----HIEEFAIPGAQTALELLRQHAKVKF--VTNTTKESKRLLHQRLINCGFKVEKEEIFTSLTAARDLIVKNQYRPFFIVDDRAMEDFEGISTDDPNAVVIGLAPEKFNDTTLTHAFR-LIKEKKASLIAINKGRYHQ-TNAGLCLGPGTYVAGLEYSAGVEATIVGKPNKLFFESALQSLNENVD-------FSSAVMIGDDVNDDALGAIKIGMRAILVKTGKFRDGDE-------LKVKNVANSFVDAV 246          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Fly
Match: CG17294 (gene:FBgn0032032 transcript:FBtr0079651)

HSP 1 Score: 139.813 bits (351), Expect = 8.039e-39
Identity = 87/247 (35.22%), Postives = 130/247 (52.63%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDEC-DSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHP 915
            K  LID+ G L     + E      +++A+K+L++       +TN ++     L E L  +GFQL    IYS L A    +E   L P+ I+S++ +   P  D     DSVV+  A   F+YE +N+AF  L++N   + +   +GKYY+ ++ GL L  G F + LEFAT R A++IGKP   FF  AL             R      M+GDD  +D+ GA S+GM G+LV++GKY P+ +  P
Sbjct:    4 KGALIDLSGTL-----HVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAE-GLALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGAL-----------AGRDPASCVMIGDDANDDIVGAMSMGMQGILVKTGKYLPDVKPSP 233          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Fly
Match: CG5577 (gene:FBgn0036759 transcript:FBtr0075162)

HSP 1 Score: 58.151 bits (139), Expect = 3.292e-9
Identity = 63/281 (22.42%), Postives = 107/281 (38.08%), Query Frame = 1
Query:  163 WHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNK-KFPFMLLTNESQVPPNVLLELLNSMGFQLQIE-NIYSPLMAIKEII------EKSSLKPFSIISDNLKTYLPHHDIDECDS------------------------------VVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKY 891
            W      +L D  G ++   +      I G+ D +  LQ++      L+TN        L E    +GF L  + +I SP  AI + +      +++  K + + +  +   L    ID   +                               VV      FSY  M +A   L  NP + FL   +   ++      +   G F   +E  ++R+A  +GKP  L     +        +  G+R + +T M+GD +  DVG A + GM  +LV +G+Y
Sbjct:   20 WLQSFDTVLCDGDGTIWQDDT-----AIAGAPDVVNALQDRFDKKVYLITNNGLKTRQELFERSQRLGFHLPSDRHIISPTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQRGIDSYGAGGTDELPPGDKWPDFVTREFGNPEAAKDVGAVVVGWDEYFSYCKMARACHILCSNPDAAFLVTNRDAVHKYPSF-CIPGTGAFVAGIEACSEREALEMGKPNPLVLEPFI--------KAEGLRTE-RTLMIGDCLKIDVGFASNCGMLSLLVGTGRY 285          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Fly
Match: CG5577 (gene:FBgn0036759 transcript:FBtr0347063)

HSP 1 Score: 58.151 bits (139), Expect = 3.292e-9
Identity = 63/281 (22.42%), Postives = 107/281 (38.08%), Query Frame = 1
Query:  163 WHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNK-KFPFMLLTNESQVPPNVLLELLNSMGFQLQIE-NIYSPLMAIKEII------EKSSLKPFSIISDNLKTYLPHHDIDECDS------------------------------VVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKY 891
            W      +L D  G ++   +      I G+ D +  LQ++      L+TN        L E    +GF L  + +I SP  AI + +      +++  K + + +  +   L    ID   +                               VV      FSY  M +A   L  NP + FL   +   ++      +   G F   +E  ++R+A  +GKP  L     +        +  G+R + +T M+GD +  DVG A + GM  +LV +G+Y
Sbjct:   20 WLQSFDTVLCDGDGTIWQDDT-----AIAGAPDVVNALQDRFDKKVYLITNNGLKTRQELFERSQRLGFHLPSDRHIISPTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQRGIDSYGAGGTDELPPGDKWPDFVTREFGNPEAAKDVGAVVVGWDEYFSYCKMARACHILCSNPDAAFLVTNRDAVHKYPSF-CIPGTGAFVAGIEACSEREALEMGKPNPLVLEPFI--------KAEGLRTE-RTLMIGDCLKIDVGFASNCGMLSLLVGTGRY 285          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Zebrafish
Match: lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:NCBI gene;Acc:100073345])

HSP 1 Score: 189.889 bits (481), Expect = 8.763e-58
Identity = 98/265 (36.98%), Postives = 161/265 (60.75%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLF 972
            K +++D+ GVL++S   G  + I GS++A+K+L +        TNE+Q      ++ L  MGF + + +++SP  A+ +I++K  L+P  ++ D+L       D    + VV+ DA   FSY+ +N+AF+ LI   K    + G+G+YY+++  GL LD+G + +ALE+A D +AE++GKP + FF+  LN ++  P +V+         MVGDD++NDVGGAQS GM G+ VR+GKYRP DE  P V+    V+ ++  V+ + 
Sbjct:   14 KGVILDMCGVLYDSGEGGGRA-IHGSVEAVKRLMDSGLMLRFCTNETQNTRERFVQKLRVMGFDISVSHVFSPAPAVVQILQKRHLRPHLLVHDDLIPEFDGVDTSSPNCVVIGDAAEKFSYQNLNEAFRVLIGLEKPVLFSLGRGRYYKETD-GLKLDVGVYMKALEYACDVQAEVVGKPSSEFFKTVLNDMNLQPHEVV---------MVGDDLVNDVGGAQSCGMKGLQVRTGKYRPSDECDPSVRADAYVDDLSAAVDAIL 267          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Zebrafish
Match: hdhd2 (haloacid dehalogenase-like hydrolase domain containing 2 [Source:NCBI gene;Acc:541346])

HSP 1 Score: 156.762 bits (395), Expect = 4.229e-45
Identity = 85/249 (34.14%), Postives = 141/249 (56.63%), Query Frame = 1
Query:  160 MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDE 906
            M     KA+LID+ G L     + E + + G+ +A+ +L+        +TN ++     L E L  + F LQ + I++ L A + ++E+ +++P  ++ D+        +  + ++VV+  A  +F+Y+T+NKAFQ ++    +  +   K +YY+  K GL L  GPF   LE+ATD KA ++GKP   FF  AL  L+ +P++ +         M+GDD  +DVGGAQ+ GM G+LV++GKYRP DE
Sbjct:    2 MARRTLKAVLIDLSGTL-----HIEDTAVPGAQEALARLRQAPVAVKFVTNTTKECKRTLFERLRGLNFDLQEQEIFTSLTAARNLVEQKAVRPLLMVEDSALEDFTGLETSDPNAVVIGLAPDHFNYQTLNKAFQLILDG--APLIAIHKARYYK-KKDGLALGPGPFVTGLEYATDTKATVVGKPEKGFFLEALRDLNCSPEEAV---------MIGDDARDDVGGAQNAGMLGILVKTGKYRPADE 233          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Zebrafish
Match: hdhd2 (haloacid dehalogenase-like hydrolase domain containing 2 [Source:NCBI gene;Acc:541346])

HSP 1 Score: 156.762 bits (395), Expect = 4.229e-45
Identity = 85/249 (34.14%), Postives = 141/249 (56.63%), Query Frame = 1
Query:  160 MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDE 906
            M     KA+LID+ G L     + E + + G+ +A+ +L+        +TN ++     L E L  + F LQ + I++ L A + ++E+ +++P  ++ D+        +  + ++VV+  A  +F+Y+T+NKAFQ ++    +  +   K +YY+  K GL L  GPF   LE+ATD KA ++GKP   FF  AL  L+ +P++ +         M+GDD  +DVGGAQ+ GM G+LV++GKYRP DE
Sbjct:    2 MARRTLKAVLIDLSGTL-----HIEDTAVPGAQEALARLRQAPVAVKFVTNTTKECKRTLFERLRGLNFDLQEQEIFTSLTAARNLVEQKAVRPLLMVEDSALEDFTGLETSDPNAVVIGLAPDHFNYQTLNKAFQLILDG--APLIAIHKARYYK-KKDGLALGPGPFVTGLEYATDTKATVVGKPEKGFFLEALRDLNCSPEEAV---------MIGDDARDDVGGAQNAGMLGILVKTGKYRPADE 233          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Zebrafish
Match: pgp (phosphoglycolate phosphatase [Source:ZFIN;Acc:ZDB-GENE-030131-6240])

HSP 1 Score: 52.7582 bits (125), Expect = 2.367e-7
Identity = 51/260 (19.62%), Postives = 98/260 (37.69%), Query Frame = 1
Query:  181 ALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLM----------------------AIKEIIEKSSLKPFSIISD---NLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSG 885
             +L D  GV++          I G+ + I  L+        +TN S     +  + L  +GF    + ++                          A+K+ +E+  ++P  +  D    ++    +  +D+    V+     +FSY  +N+A Q+L  +P  +F+               V   G    A+E A  R+A+++GKP N  F    +  +  P          +  MVGD +  D+    + G+  +L  +G
Sbjct:   23 CVLFDCDGVIWRGDQ-----AIPGAPEVINSLKKHGKQVFFVTNNSTKTRQMYADKLGKLGFDAAADEVFGTAYCSAQYLKNVCKLDGKVYLIGSKAMKQELEEVGIQPVGVGPDLISGVQIDWANVPLDQEVQAVLVGFDEHFSYMKLNRALQYLC-DPDCQFVGTNTDTRLPLEGGKAVPGTGCLLRAVETAAQRQAQVVGKPSNFMFECVASQFNLKP---------QRCLMVGDRLDTDIMLGSNCGLKTLLTLTG 267          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Zebrafish
Match: pgp (phosphoglycolate phosphatase [Source:ZFIN;Acc:ZDB-GENE-030131-6240])

HSP 1 Score: 52.7582 bits (125), Expect = 2.367e-7
Identity = 51/260 (19.62%), Postives = 98/260 (37.69%), Query Frame = 1
Query:  181 ALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLM----------------------AIKEIIEKSSLKPFSIISD---NLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSG 885
             +L D  GV++          I G+ + I  L+        +TN S     +  + L  +GF    + ++                          A+K+ +E+  ++P  +  D    ++    +  +D+    V+     +FSY  +N+A Q+L  +P  +F+               V   G    A+E A  R+A+++GKP N  F    +  +  P          +  MVGD +  D+    + G+  +L  +G
Sbjct:   23 CVLFDCDGVIWRGDQ-----AIPGAPEVINSLKKHGKQVFFVTNNSTKTRQMYADKLGKLGFDAAADEVFGTAYCSAQYLKNVCKLDGKVYLIGSKAMKQELEEVGIQPVGVGPDLISGVQIDWANVPLDQEVQAVLVGFDEHFSYMKLNRALQYLC-DPDCQFVGTNTDTRLPLEGGKAVPGTGCLLRAVETAAQRQAQVVGKPSNFMFECVASQFNLKP---------QRCLMVGDRLDTDIMLGSNCGLKTLLTLTG 267          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Xenopus
Match: zbtb10 (zinc finger and BTB domain containing 10 [Source:Xenbase;Acc:XB-GENE-1021753])

HSP 1 Score: 165.622 bits (418), Expect = 1.662e-48
Identity = 89/256 (34.77%), Postives = 150/256 (58.59%), Query Frame = 1
Query:  163 WHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPI 930
            W +  +A+L+D+ GVL++S  +G  S I+GS+DA+ +++         TNESQ   +   + L   GF +  E + +P  A   ++++  L+P  ++ D+L       +  + + V++ DA  NFSY+ +N+AFQ LI   K   ++ GKG+YY+++  GL LD+G + +ALE+A D KAE++GKP   FF +AL  + + P++ +         M+GDDI+ND+GGAQS G     +RSG    ++   P++K I
Sbjct:    4 WANNVRAVLLDVSGVLYDSGGSGGGSAIQGSVDAVNRIRQAGLKLRFCTNESQATRSHFAQKLQRFGFSISKEEVTAPGPAAARLMKEQGLRPHLLVHDDLLPEFESIETSDPNCVLIGDAAENFSYQNVNRAFQVLINLQKPVLISLGKGRYYKETD-GLKLDVGAYMKALEYACDIKAEVVGKPSPNFFLSALEEMGAKPEEAV---------MIGDDIVNDIGGAQSCG-----IRSG----QENTDPVMKSI 240          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Xenopus
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:100145104])

HSP 1 Score: 145.591 bits (366), Expect = 9.781e-41
Identity = 85/258 (32.95%), Postives = 144/258 (55.81%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDN-LKTYLP-HHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNC 945
            KA+L+D+ G L     + E + I G+ +A+++L+        +TN ++     LLE L+ + F +Q + I++ L A + ++E+ +++P  ++ D+ L+ +          +++V+  A  +F+YETMN+AF+  +    +  +   K +YY+  K GL L  GPF  ALE+ATD +A ++GKP   FF  AL     +P + +         M+GDD  +DVGGAQ+ GM G+LV++GKYR  DE    + P   V C
Sbjct:    8 KAVLVDLSGTL-----HVEDTAIPGAQEALRRLREAPVALRFVTNTTKECKQTLLERLHQLNFDIQEDEIFTSLTAARNLLEQKNVRPMLLVDDSALRDFEGIRQSTHSPNALVIGLAPQHFNYETMNEAFRLALDG--APIIAIHKARYYK-KKDGLALGPGPFVTALEYATDTRATVVGKPEKTFFLEALRSTGCSPAEAV---------MIGDDCRDDVGGAQNAGMLGILVKTGKYRAGDEGK--IDPAPYVVC 246          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Xenopus
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:100145104])

HSP 1 Score: 110.923 bits (276), Expect = 8.962e-28
Identity = 74/256 (28.91%), Postives = 129/256 (50.39%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNC 945
            KA+L+D+ G L     + E + I G+ +A+++L+        +TN ++     LLE L+ + F +Q + I++ L A + ++E+ +++P  ++ D+             +++V+  A  +F+YETMN+AF+  +    +  +   K +YY+  K GL L  GPF  ALE+ATD +A ++GKP   FF  AL     +P + +         M+GD          SV    +  ++GKYR  DE    + P   V C
Sbjct:    8 KAVLVDLSGTL-----HVEDTAIPGAQEALRRLREAPVALRFVTNTTKECKQTLLERLHQLNFDIQEDEIFTSLTAARNLLEQKNVRPMLLVDDSALRDFEGVATHSPNALVIGLAPQHFNYETMNEAFRLALDG--APIIAIHKARYYK-KKDGLALGPGPFVTALEYATDTRATVVGKPEKTFFLEALRSTGCSPAEAV---------MIGD---------VSVNYIFLGFQTGKYRAGDEGK--IDPAPYVVC 235          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Mouse
Match: Lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:MGI Symbol;Acc:MGI:1923679])

HSP 1 Score: 190.274 bits (482), Expect = 7.004e-58
Identity = 100/269 (37.17%), Postives = 164/269 (60.97%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSD 984
            + +L+DI GVL +SS++G  + I GS++A+ +L+         TNESQ     L+ +L  +GF +  E + +P  A  +I+++  L+P  +I + +++     D+   + VV+ DA   FSY+ MN+AFQ L++      ++ GKG+YY+++  GL+LD+G + +ALE+A   KAE++GKP   FF++AL        Q IG+   ++  M+GDDI+ DVGGAQ  GM  + VR+GK+RP DEHHP V+    V+ + + V+ L   +D
Sbjct:   12 RGVLLDISGVLCDSSASGA-TAIAGSVEAVARLKQSPLKVRFCTNESQKSLRELVGVLQQLGFDISEEEVTAPAPATCQILKERGLRPHLLIHEGVRSEFDDIDMSNPNCVVIADAGEAFSYQNMNRAFQVLMELENPVLISLGKGRYYKETS-GLMLDVGGYMKALEYACGIKAEVVGKPSPEFFKSAL--------QAIGVE-AHQAIMIGDDIVGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLKYTD 269          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Mouse
Match: Lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:MGI Symbol;Acc:MGI:1923679])

HSP 1 Score: 174.866 bits (442), Expect = 2.290e-52
Identity = 90/240 (37.50%), Postives = 148/240 (61.67%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRP 897
            + +L+DI GVL +SS++G  + I GS++A+ +L+         TNESQ     L+ +L  +GF +  E + +P  A  +I+++  L+P  +I + +++     D+   + VV+ DA   FSY+ MN+AFQ L++      ++ GKG+YY+++  GL+LD+G + +ALE+A   KAE++GKP   FF++AL        Q IG+   ++  M+GDDI+ DVGGAQ  GM  + VR+GK+RP
Sbjct:   12 RGVLLDISGVLCDSSASGA-TAIAGSVEAVARLKQSPLKVRFCTNESQKSLRELVGVLQQLGFDISEEEVTAPAPATCQILKERGLRPHLLIHEGVRSEFDDIDMSNPNCVVIADAGEAFSYQNMNRAFQVLMELENPVLISLGKGRYYKETS-GLMLDVGGYMKALEYACGIKAEVVGKPSPEFFKSAL--------QAIGVE-AHQAIMIGDDIVGDVGGAQQCGMRALQVRTGKFRP 240          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Mouse
Match: Hdhd2 (haloacid dehalogenase-like hydrolase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924237])

HSP 1 Score: 140.584 bits (353), Expect = 6.448e-39
Identity = 81/256 (31.64%), Postives = 139/256 (54.30%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNC 945
            KA+L+D++G L     + E + + G+ +A+K+L+        +TN ++     LLE L  + F++  + I++ L A + +IE+  ++P  ++ D            + ++VV+  A  +F Y+ +N+AF+ L+    +  +   K +YY+  K GL L  GPF  ALE+ATD KA ++GKP   FF  AL      P++ +         M+GDD  +DV GAQ++GM G+LV++GKY+  DE    + P   + C
Sbjct:    8 KAVLVDLNGTL-----HIEDAAVPGAQEALKRLRATSVMVRFVTNTTKESKKDLLERLKKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLVDDRALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFRLLLDG--APLIAIHKARYYK-RKDGLALGPGPFVTALEYATDTKAMVVGKPEKTFFLEALRDADCAPEEAV---------MIGDDCRDDVDGAQNIGMLGILVKTGKYKAADEEK--INPPPYLTC 244          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Mouse
Match: Hdhd2 (haloacid dehalogenase-like hydrolase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924237])

HSP 1 Score: 140.584 bits (353), Expect = 6.448e-39
Identity = 81/256 (31.64%), Postives = 139/256 (54.30%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNC 945
            KA+L+D++G L     + E + + G+ +A+K+L+        +TN ++     LLE L  + F++  + I++ L A + +IE+  ++P  ++ D            + ++VV+  A  +F Y+ +N+AF+ L+    +  +   K +YY+  K GL L  GPF  ALE+ATD KA ++GKP   FF  AL      P++ +         M+GDD  +DV GAQ++GM G+LV++GKY+  DE    + P   + C
Sbjct:    8 KAVLVDLNGTL-----HIEDAAVPGAQEALKRLRATSVMVRFVTNTTKESKKDLLERLKKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLVDDRALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFRLLLDG--APLIAIHKARYYK-RKDGLALGPGPFVTALEYATDTKAMVVGKPEKTFFLEALRDADCAPEEAV---------MIGDDCRDDVDGAQNIGMLGILVKTGKYKAADEEK--INPPPYLTC 244          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Mouse
Match: Hdhd2 (haloacid dehalogenase-like hydrolase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924237])

HSP 1 Score: 140.584 bits (353), Expect = 6.448e-39
Identity = 81/256 (31.64%), Postives = 139/256 (54.30%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNC 945
            KA+L+D++G L     + E + + G+ +A+K+L+        +TN ++     LLE L  + F++  + I++ L A + +IE+  ++P  ++ D            + ++VV+  A  +F Y+ +N+AF+ L+    +  +   K +YY+  K GL L  GPF  ALE+ATD KA ++GKP   FF  AL      P++ +         M+GDD  +DV GAQ++GM G+LV++GKY+  DE    + P   + C
Sbjct:    8 KAVLVDLNGTL-----HIEDAAVPGAQEALKRLRATSVMVRFVTNTTKESKKDLLERLKKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLVDDRALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFRLLLDG--APLIAIHKARYYK-RKDGLALGPGPFVTALEYATDTKAMVVGKPEKTFFLEALRDADCAPEEAV---------MIGDDCRDDVDGAQNIGMLGILVKTGKYKAADEEK--INPPPYLTC 244          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. UniProt/SwissProt
Match: sp|Q9D7I5|LHPP_MOUSE (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Mus musculus OX=10090 GN=Lhpp PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 4.899e-57
Identity = 100/269 (37.17%), Postives = 164/269 (60.97%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSD 984
            + +L+DI GVL +SS++G  + I GS++A+ +L+         TNESQ     L+ +L  +GF +  E + +P  A  +I+++  L+P  +I + +++     D+   + VV+ DA   FSY+ MN+AFQ L++      ++ GKG+YY+++  GL+LD+G + +ALE+A   KAE++GKP   FF++AL        Q IG+   ++  M+GDDI+ DVGGAQ  GM  + VR+GK+RP DEHHP V+    V+ + + V+ L   +D
Sbjct:   12 RGVLLDISGVLCDSSASGA-TAIAGSVEAVARLKQSPLKVRFCTNESQKSLRELVGVLQQLGFDISEEEVTAPAPATCQILKERGLRPHLLIHEGVRSEFDDIDMSNPNCVVIADAGEAFSYQNMNRAFQVLMELENPVLISLGKGRYYKETS-GLMLDVGGYMKALEYACGIKAEVVGKPSPEFFKSAL--------QAIGVE-AHQAIMIGDDIVGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLKYTD 269          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. UniProt/SwissProt
Match: sp|A5PLK2|LHPP_DANRE (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Danio rerio OX=7955 GN=lhpp PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 6.615e-57
Identity = 98/265 (36.98%), Postives = 161/265 (60.75%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLF 972
            K +++D+ GVL++S   G  + I GS++A+K+L +        TNE+Q      ++ L  MGF + + +++SP  A+ +I++K  L+P  ++ D+L       D    + VV+ DA   FSY+ +N+AF+ LI   K    + G+G+YY+++  GL LD+G + +ALE+A D +AE++GKP + FF+  LN ++  P +V+         MVGDD++NDVGGAQS GM G+ VR+GKYRP DE  P V+    V+ ++  V+ + 
Sbjct:   14 KGVILDMCGVLYDSGEGGGRA-IHGSVEAVKRLMDSGLMLRFCTNETQNTRERFVQKLRVMGFDISVSHVFSPAPAVVQILQKRHLRPHLLVHDDLIPEFDGVDTSSPNCVVIGDAAEKFSYQNLNEAFRVLIGLEKPVLFSLGRGRYYKETD-GLKLDVGVYMKALEYACDVQAEVVGKPSSEFFKTVLNDMNLQPHEVV---------MVGDDLVNDVGGAQSCGMKGLQVRTGKYRPSDECDPSVRADAYVDDLSAAVDAIL 267          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. UniProt/SwissProt
Match: sp|Q3B8E3|LHPP_XENLA (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Xenopus laevis OX=8355 GN=lhpp PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.219e-56
Identity = 100/274 (36.50%), Postives = 163/274 (59.49%), Query Frame = 1
Query:  163 WHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSD 984
            W +  +A+L+D+ GVL++S   G  S I+GS+DA+ ++++        TNESQ   +   + L   GF +  E + +P  A   ++++  L+P  ++ ++L       +  + + V++ DA  NFSY+ +N+AFQ LI   K   ++ GKG+YY+++  GL LD+G + +ALE+A D KAE++GKP   FF +AL  + + P++ +         M+GDDI++D+GGA+S G+  VLVR+GKYRP DE HP V     VN +   V+ L A  D
Sbjct:    4 WANGVRAVLLDVSGVLYDSGGAGGGSAIQGSVDAVNRIRHAGLKLRFCTNESQATRSHFAQKLKRFGFSISEEEVTAPGPAATRLMKERGLRPHLLVHNDLLPEFESVEKSDPNCVLIGDAAENFSYKNVNRAFQVLINLQKPVLISLGKGRYYKETD-GLKLDVGAYMKALEYACDIKAEVVGKPSPNFFLSALEEMGAKPEEAL---------MIGDDIVHDIGGAKSCGLRAVLVRTGKYRPSDEKHPEVTADGYVNNLAHAVDILLASQD 267          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. UniProt/SwissProt
Match: sp|Q9H008|LHPP_HUMAN (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Homo sapiens OX=9606 GN=LHPP PE=1 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 2.555e-56
Identity = 100/269 (37.17%), Postives = 164/269 (60.97%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSD 984
            + +L+DI GVL++S + G  ++   S++A+ +L+  +      TNESQ     L+  L  +GF +  + + +P  A  +I+++  L+P+ +I D +++     D    + VV+ DA  +FSY+ MN AFQ L++  K   ++ GKG+YY+++  GL+LD+GP+ +ALE+A   KAE++GKP   FF++AL        Q IG+   ++  M+GDDI+ DVGGAQ  GM  + VR+GK+RP DEHHP VK    V+ + + V+ L   +D
Sbjct:   12 RGVLLDISGVLYDSGAGGGTAIAG-SVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETS-GLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSAL--------QAIGVE-AHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHAD 269          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. UniProt/SwissProt
Match: sp|Q5I0D5|LHPP_RAT (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Rattus norvegicus OX=10116 GN=Lhpp PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 4.677e-52
Identity = 97/272 (35.66%), Postives = 161/272 (59.19%), Query Frame = 1
Query:  169 SKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSD 984
            S  + +L+DI GVL++S + G  ++   S++A+ +L+         TNESQ     L+ +L  +GF +    + +P  A  +I+++  L+P  +I + +++     D+   + VV+ DA   FSY+ MN+AFQ L++      ++ GKG+YY+++  GL+LD+G + +ALE+A   +AE++GKP   FFR+AL        Q IG+   ++  M+GDDI+ DVGGAQ  GM  + VR+GK+RP DEHHP V+    V+ + + V+ L    D
Sbjct:    9 SGVRGVLLDISGVLYDSGTGGGAAIAG-SVEAVARLKRSPLKVRFCTNESQKSRRELVGVLQRLGFDISEGEVTAPAPATCQILKERGLRPHLLIHEGVRSEFDDIDMSNPNCVVIADAGEGFSYQNMNRAFQVLMELENPVLISLGKGRYYKETS-GLMLDVGGYMKALEYACGIEAEVVGKPSPEFFRSAL--------QAIGVE-AHQAIMIGDDIVGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVRADGYVDNLAEAVDLLLQHMD 269          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. TrEMBL
Match: A0A224Z538 (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.435e-68
Identity = 119/272 (43.75%), Postives = 170/272 (62.50%), Query Frame = 1
Query:  163 WHSK-CKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFA 975
            W  K  + +L+DI GVL+ S   GE   IEGS+DAI+ L+    PF  +TNE+Q     L   L+ +GF +  + I+    A K+ I   + +PF ++  N++      D +E + VVV DA +NFSYE MN+AF  L+ N  S  +T GKGKYY++    L +D+GPFT ALE+ATDR+A +IGKPG  FFR AL  +   P+ V+         M+GDD++ DVGGAQS GM GVLVR+GK+RPEDE+HP ++P  IV  + + +E++ +
Sbjct:    6 WLRKPIRGILMDITGVLYES---GERKAIEGSVDAIRMLRTADIPFRFITNETQKTKEQLDSALHRLGFDIYEKEIFMCAPAAKKFIHDLNYRPFLLVHPNVEAEFAECDQNEPNCVVVGDAASNFSYENMNRAFHVLVDNDDSVLITLGKGKYYKEEG-KLTMDVGPFTAALEYATDRQAIVIGKPGEEFFRLALEDMKLRPEDVV---------MIGDDVVCDVGGAQSAGMRGVLVRTGKFRPEDENHPSIRPDAIVTNLMEAIERVLS 264          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. TrEMBL
Match: A0A131YYT1 (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.595e-66
Identity = 116/272 (42.65%), Postives = 169/272 (62.13%), Query Frame = 1
Query:  163 WHSK-CKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFA 975
            W  K  + +L+DI GVL+ S   GE   IEGS+DA++ L+    PF  +TNE+Q     L   L+ +GF +  + I+    A K+ I   + +PF ++  N++      D +  + VVV DA +NFSYE MN+AF  L+ N  S  +T GKGKYY++    L +D+GPFT ALE+ATDR+A +IGKPG  FFR AL  +   P+ V+         M+GDD++ D+GGAQS GM GVLVR+GK+RPEDE+HP ++P  IV  + + +E++ +
Sbjct:    3 WLRKPIRGVLMDITGVLYES---GERKAIEGSVDALRMLRTADIPFRFITNETQKTKEQLDSALHRLGFDIYEKEIFMCAPAAKKFIHDLNYRPFLLVHPNVEAEFAECDQNLPNCVVVGDAASNFSYENMNRAFHVLVDNDDSVLITLGKGKYYKEEG-KLTMDVGPFTAALEYATDRQAIVIGKPGEEFFRLALEDMKLRPEDVV---------MIGDDVVCDIGGAQSAGMRGVLVRTGKFRPEDENHPSIRPDAIVKNLMEAIERVLS 261          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. TrEMBL
Match: G3MK03 (Uncharacterized protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.033e-65
Identity = 122/272 (44.85%), Postives = 167/272 (61.40%), Query Frame = 1
Query:  163 WHSK-CKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFA 975
            W  K  + +L+DI GVL+ S   GE   IEGS +AIK L+    PF  +TNE+Q     L  LL+ +GF +  + I+  + A    I   + +PF ++  N+++     D  + + V++ DA +NF+YE +N+AF  LI+N  S  +  GKGKYYR+    LV+D+GPF  ALEFA DR+A +IGKPG  FFR AL  L    D+V+         MVGDDI+ DVGGAQSVGM GVLVR+GKYR  DE HP+VKP  IV  + + VE++ A
Sbjct:    3 WLRKPIRGILMDITGVLYES---GERKAIEGSTEAIKMLRAADIPFRFITNETQRTKEQLDTLLHRLGFDICEKEIFMCVPAAXXFIHDLNYRPFLLVHPNVESEFYECDQSQPNCVIMGDAASNFTYENLNQAFHVLIENNDSVLICLGKGKYYREHG-ELVMDVGPFAAALEFAADRQAIVIGKPGEEFFRLALEDLKMQADEVV---------MVGDDIVGDVGGAQSVGMRGVLVRTGKYRSSDESHPVVKPDGIVRNLKEAVEQIVA 261          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. TrEMBL
Match: A0A131XLM5 (Uncharacterized protein OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 7.522e-65
Identity = 113/272 (41.54%), Postives = 170/272 (62.50%), Query Frame = 1
Query:  163 WHSK-CKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFA 975
            W  K  + +L+DI GVL+ S   GE   IEGS+DA+K L+    PF  +TNE+Q   + L   L+ +GF +  + I+    A K+ I   + +PF ++  N++      D ++ + V+V DA +NF+YE MN+AF  L+ N  S  +T GKGKYY++    L +D+GPFT ALE+A +R+A +IGKPG  FFR AL  +   PD+V+         M+GDD++ DVGGAQS GM GVLVR+GK+RP DE+H  +KP  IV+ + + ++++ +
Sbjct:    3 WLRKPVRGILMDITGVLYES---GERKAIEGSVDALKMLRTADVPFRFVTNETQKTKDQLGSALHRLGFDIYEKEIFMCAPAAKKFIHDLNYRPFLLVHPNVEAEFAECDQNQPNCVIVADAGSNFTYENMNRAFHVLVDNDDSVLITLGKGKYYKEHD-KLTMDVGPFTAALEYAAERQAIVIGKPGEEFFRMALEDMKLRPDEVV---------MIGDDLVCDVGGAQSAGMRGVLVRTGKFRPTDENHASIKPDAIVHNLMEAIQRILS 261          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. TrEMBL
Match: A0A369SGI5 (Phospholysine phosphohistidine inorganic pyrophosphate phosphatase OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_003555 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.641e-62
Identity = 110/276 (39.86%), Postives = 178/276 (64.49%), Query Frame = 1
Query:  154 FEMWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSII-SDNLKTYLPHHDIDEC--DSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLF 972
             +  +++ + LL+DI GVL+NS  +G  + I+GS++A+ +L+   FP  L TNESQ   + L++ L  +GF +Q E+IYSP+ A+K  + ++SL+P  ++  D L  ++   DID+   + VV+ DA   FSY  +N+AF  L+   + + ++ GKG+YY+++  GL LD+GPF++ LE+A   +AE++GKP   FF  AL   + NP+  +         M+GDD+++DVGGAQ+ G+ GVLVR+GKYRP DE+HP V+P  +VN +   V+ + 
Sbjct:    7 LQRGNNRLQGLLLDISGVLYNSGVSGGQA-IDGSVEALARLKKAHFPLRLCTNESQCSIDTLVKKLQRLGFNVQEEDIYSPIKAVKSFLIENSLRPHLLVHPDVLDEFV---DIDQSNPNCVVIGDATDAFSYAALNEAFTILMNMKQPKLISLGKGRYYQETD-GLKLDVGPFSKVLEYACQIEAEVVGKPSKTFFMAALAGFNINPEHFL---------MIGDDVVSDVGGAQACGLRGVLVRTGKYRPSDENHPQVQPDAVVNNLAQAVDSIL 268          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Cavefish
Match: lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:NCBI gene;Acc:103042653])

HSP 1 Score: 192.586 bits (488), Expect = 7.240e-59
Identity = 96/248 (38.71%), Postives = 150/248 (60.48%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIV 921
            K +++D+ GVL++S   G    IEGS++A+K+L+         TNE+Q      +  L  MGF++ +  ++ P  A+  ++++ +L+P  ++ D++       D    + VV+ DA  NFSYE MN AF+ LI   K    + G+G+YY+++  GL LD+G + +ALE+A D +AE++GKP  +FF+  LN +   P +V         FM+GDD++NDVGGAQ  GM G+ VR+GKYRP DE HP V
Sbjct:   12 KGVILDMCGVLYDSGEGGGVP-IEGSVEAVKRLKASDLQLRFCTNETQATREKFVAKLCRMGFEINVSEVFPPAPAVVSVLKQRNLRPHLLVHDDVVPEFDGVDKSNPNCVVIGDAADNFSYENMNAAFRVLIGLEKPVLFSMGRGRYYKETD-GLKLDVGVYMKALEYACDVEAEVVGKPAPMFFQTVLNDMGLQPHEV---------FMIGDDLVNDVGGAQQCGMKGLQVRTGKYRPSDERHPTV 248          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Cavefish
Match: lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:NCBI gene;Acc:103042653])

HSP 1 Score: 192.586 bits (488), Expect = 1.850e-58
Identity = 96/248 (38.71%), Postives = 150/248 (60.48%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIV 921
            K +++D+ GVL++S   G    IEGS++A+K+L+         TNE+Q      +  L  MGF++ +  ++ P  A+  ++++ +L+P  ++ D++       D    + VV+ DA  NFSYE MN AF+ LI   K    + G+G+YY+++  GL LD+G + +ALE+A D +AE++GKP  +FF+  LN +   P +V         FM+GDD++NDVGGAQ  GM G+ VR+GKYRP DE HP V
Sbjct:   52 KGVILDMCGVLYDSGEGGGVP-IEGSVEAVKRLKASDLQLRFCTNETQATREKFVAKLCRMGFEINVSEVFPPAPAVVSVLKQRNLRPHLLVHDDVVPEFDGVDKSNPNCVVIGDAADNFSYENMNAAFRVLIGLEKPVLFSMGRGRYYKETD-GLKLDVGVYMKALEYACDVEAEVVGKPAPMFFQTVLNDMGLQPHEV---------FMIGDDLVNDVGGAQQCGMKGLQVRTGKYRPSDERHPTV 288          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Cavefish
Match: lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:NCBI gene;Acc:103042653])

HSP 1 Score: 178.718 bits (452), Expect = 2.507e-53
Identity = 90/241 (37.34%), Postives = 145/241 (60.17%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPE 900
            K +++D+ GVL++S   G    IEGS++A+K+L+         TNE+Q      +  L  MGF++ +  ++ P  A+  ++++ +L+P  ++ D++       D    + VV+ DA  NFSYE MN AF+ LI   K    + G+G+YY+++  GL LD+G + +ALE+A D +AE++GKP  +FF+  LN +   P +V         FM+GDD++NDVGGAQ  GM G+ VR+GKY P+
Sbjct:   14 KGVILDMCGVLYDSGEGGGVP-IEGSVEAVKRLKASDLQLRFCTNETQATREKFVAKLCRMGFEINVSEVFPPAPAVVSVLKQRNLRPHLLVHDDVVPEFDGVDKSNPNCVVIGDAADNFSYENMNAAFRVLIGLEKPVLFSMGRGRYYKETD-GLKLDVGVYMKALEYACDVEAEVVGKPAPMFFQTVLNDMGLQPHEV---------FMIGDDLVNDVGGAQQCGMKGLQVRTGKYSPD 243          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Cavefish
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:103024817])

HSP 1 Score: 137.117 bits (344), Expect = 9.925e-38
Identity = 76/243 (31.28%), Postives = 137/243 (56.38%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDE 906
            KA+LID+ G L     + E + + G+ +A+ +L+        +TN ++     L E L  + F ++ + I++ L A + ++ + +++P  ++ D+        +  + ++VV+  A  +F+Y+ +NKAF+ ++    +  +   K ++Y+  K GL L  GPF   LE+ATD +A ++GKP   FF  AL  L+ +P++ +         M+GDD  +DVGGAQ+ GM G+LV++GKYR  DE
Sbjct:    8 KAVLIDLSGTL-----HIEDAAVPGAQEALARLRQASVAVKFVTNTTKECKRTLHERLLRLKFDIEEQEIFTSLTAARNLLVQKAVRPLLLVEDSALEDFAGIETSDPNAVVIGLAPDHFNYQMLNKAFRLILDG--APLIAIHKARFYK-RKDGLALGPGPFVTGLEYATDTQAAVVGKPEKTFFLEALRDLNCSPEEAV---------MIGDDARDDVGGAQNTGMLGILVKTGKYRAGDE 233          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Cavefish
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:103024817])

HSP 1 Score: 122.865 bits (307), Expect = 1.458e-32
Identity = 65/201 (32.34%), Postives = 116/201 (57.71%), Query Frame = 1
Query:  304 LTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDE 906
            +TN ++     L E L  + F ++ + I++ L A + ++ + +++P  ++ D+        +  + ++VV+  A  +F+Y+ +NKAF+ ++    +  +   K ++Y+  K GL L  GPF   LE+ATD +A ++GKP   FF  AL  L+ +P++ +         M+GDD  +DVGGAQ+ GM G+LV++GKYR  DE
Sbjct:   21 VTNTTKECKRTLHERLLRLKFDIEEQEIFTSLTAARNLLVQKAVRPLLLVEDSALEDFAGIETSDPNAVVIGLAPDHFNYQMLNKAFRLILDG--APLIAIHKARFYK-RKDGLALGPGPFVTGLEYATDTQAAVVGKPEKTFFLEALRDLNCSPEEAV---------MIGDDARDDVGGAQNTGMLGILVKTGKYRAGDE 209          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Sea Lamprey
Match: lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:NCBI gene;Acc:100073345])

HSP 1 Score: 127.872 bits (320), Expect = 4.207e-36
Identity = 67/164 (40.85%), Postives = 106/164 (64.63%), Query Frame = 1
Query:  487 DIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALN-MLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFA 975
            D+ + + VV+ DA   F+Y+++N+AF+ L+       L+ G+G+YY+++  GL LD+G + +ALE+A D +AE++GKP   FF  A+N M+   P QV+         M+GDDI+NDVGGAQ  G+  + VR+GK+ P DEHHP VK   +V+ + + V+ L +
Sbjct:    9 DVSDPNCVVLGDAAEFFTYDSLNEAFRVLLGLETPVLLSLGRGRYYKETD-GLKLDVGAYMKALEYACDVEAEVVGKPSKAFFMAAVNDMVLRAPVQVL---------MIGDDIVNDVGGAQLCGISALQVRTGKFMPSDEHHPSVKADGVVDNLANAVDLLLS 162          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Sea Lamprey
Match: hdhd2 (haloacid dehalogenase-like hydrolase domain containing 2 [Source:NCBI gene;Acc:541346])

HSP 1 Score: 123.25 bits (308), Expect = 1.112e-33
Identity = 75/228 (32.89%), Postives = 117/228 (51.32%), Query Frame = 1
Query:  283 KKFPFML--LTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFV 960
            +K P  +  +TN ++     L   L  +GF L+ + I++ L A + ++E   L+P  ++ D+        +  E ++V+V  A   F YE MN+AF+ +++   ++ +   K +YYR +  GL L  GPF  ALE+A   +A  +GKP   FF  AL  L   P Q +         M+GDD  +DV GAQ  GM G+LV++GKYR  DE      P +     +D V
Sbjct:    3 RKLPLSIRFVTNTTKECRRDLHARLTRLGFALEPDEIFTSLSAARSLLEVRGLRPLLMLEDSALEDFQGVNTAEPNAVLVGLAPERFHYEAMNEAFRLVLEG--AQLVAVHKARYYRRAD-GLALGPGPFVAALEYAAGVQALAVGKPEGPFFLEALRGLDCEPQQAV---------MIGDDARDDVAGAQRAGMRGILVKTGKYRDGDESRVDPGPHLTCPSFSDAV 218          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Nematostella
Match: EDO35915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK19])

HSP 1 Score: 199.519 bits (506), Expect = 4.488e-62
Identity = 106/249 (42.57%), Postives = 156/249 (62.65%), Query Frame = 1
Query:  181 ALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKP 927
             +L+DI GVL+NS   G   VI GS++A+++L+   F   L TNE+Q     L++ L   G++L +  +++P  A++ +++K  L+P  +I    +      + D  + VV+ DA  +F+YE+MN AF+ L++N      + G GKYYR +   LVLD+GPF +ALE+A D KAEI+GKP  LFF  AL        + +G+  Q+   M+GDDI NDVGGAQ+ G+ GV VR+GK+RPEDE HP VKP
Sbjct:   15 GVLLDISGVLYNSGKEGG-EVIPGSVEALERLKAAGFKVRLCTNETQCTREDLVKKLGRFGYKLSVSEMFAPAPAMRAVLQKRDLRPHFLIHAGGRPDFEGLNCDNPNCVVIGDAAESFTYESMNTAFRVLLEN--HTLFSMGYGKYYR-TDGQLVLDVGPFAKALEYACDTKAEIVGKPSALFFTTAL--------EDMGVAVQD-AIMIGDDIQNDVGGAQAAGIRGVQVRTGKFRPEDEKHPTVKP 250          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Nematostella
Match: EDO49390 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGA7])

HSP 1 Score: 158.688 bits (400), Expect = 2.592e-46
Identity = 90/243 (37.04%), Postives = 140/243 (57.61%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDE 906
            + +L+D+ G +     + E SVI  SI+A+KKL+    P   +TN ++     LL+ L  +GF ++ + I+S L A   ++    L+P  ++  + KT       D  ++VVV  A   F+YET+NKAF+ L+     + +   K +YY+ S  GLVL  GPF  ALE+ATD +AE++GKP  LFF+  L  +  +P+  +         M+GDD+ NDV GAQ+ G+ G+LV++GKYR  DE
Sbjct:    6 RGVLVDLSGTI-----HIENSVIPRSIEALKKLRQTGLPLRFVTNTTKESKLSLLQRLTKIGFDIKADEIFSSLTAAVRLVRTRELRPLLLLQPDAKTDFAGISTDNPNAVVVGLAPDCFNYETLNKAFRLLLDG--GQLIAIHKVQYYKRSD-GLVLGPGPFVSALEYATDVQAEVVGKPQALFFKQVLTEIKCDPECAV---------MIGDDVRNDVEGAQAAGIKGILVKTGKYRHGDE 231          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Medaka
Match: lhpp (phospholysine phosphohistidine inorganic pyrophosphate phosphatase [Source:NCBI gene;Acc:101174869])

HSP 1 Score: 180.259 bits (456), Expect = 4.562e-54
Identity = 97/253 (38.34%), Postives = 148/253 (58.50%), Query Frame = 1
Query:  169 SKC-KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVK 924
            +KC K +++D+ GVL++S   G+   I GS  A+KKL+         TNE+Q      +  L  +GF + +  ++ P  A   ++++  L+P  ++ D L       D    + V++ DA  NFSY+ +N+AF  LI   K    + G+G+YY+++  GL LD+G + +ALE+A D KAE+IGKP   FF++ LN +   P++V+         M+GDD++NDVGGAQ   M GV VR+GKYRP DE HP VK
Sbjct:   17 AKCLKGVILDLCGVLYDSGE-GDGVAIPGSAAAVKKLKESDLQLRFCTNETQATREKFVAKLQRLGFDISVSEVFPPAPAAIAVLKERGLRPHLLVHDGLLNEFVGVDQTNPNCVIIGDAAENFSYKNINEAFTVLIGLEKPVLFSLGQGRYYKETD-GLKLDVGVYMKALEYACDLKAEVIGKPSPTFFQSVLNDMGLQPNEVL---------MIGDDLVNDVGGAQHCVMKGVQVRTGKYRPSDEKHPTVK 258          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Medaka
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:101168225])

HSP 1 Score: 161.384 bits (407), Expect = 5.259e-47
Identity = 93/265 (35.09%), Postives = 149/265 (56.23%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLF 972
            KA+LID+ G L     + + + + G+ +A+KKL+N       +TN ++     LLE L+ + F +Q   I++ L A + +IE+ + +P  ++ D+        D  E ++VV+  A  +F+Y+T+NKAF+ ++    +  +   K +YY+  K GL L  GPF   LE+ATDRKA ++GKP   FF  AL+ L  +P + +         M+GDD  +D+GGAQ+ GM G+LVRSGKYR  DE+     P +  +   D VE + 
Sbjct:   11 KAVLIDLSGTL-----HIDDTAVPGAQEALKKLRNASVTVKFVTNTTKESKRNLLERLHRLNFDVQENEIFTSLSAARSLIEQKNHRPLLLVEDSALEDFNGIDTSEPNAVVIGLAPEHFNYQTLNKAFRMILDG--APLIAIHKARYYK-RKDGLALGPGPFVTGLEYATDRKASVVGKPEKTFFMQALSDLGCSPSEAV---------MIGDDARDDIGGAQNAGMLGILVRSGKYREGDENKISPPPHLTCDSFPDAVEHIL 258          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Medaka
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:101168225])

HSP 1 Score: 147.902 bits (372), Expect = 6.366e-42
Identity = 84/237 (35.44%), Postives = 137/237 (57.81%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGK 888
            KA+LID+ G L     + + + + G+ +A+KKL+N       +TN ++     LLE L+ + F +Q   I++ L A + +IE+ + +P  ++ D+        D  E ++VV+  A  +F+Y+T+NKAF+ ++    +  +   K +YY+  K GL L  GPF   LE+ATDRKA ++GKP   FF  AL+ L  +P + +         M+GDD  +D+GGAQ+ GM G+LVRSG+
Sbjct:   19 KAVLIDLSGTL-----HIDDTAVPGAQEALKKLRNASVTVKFVTNTTKESKRNLLERLHRLNFDVQENEIFTSLSAARSLIEQKNHRPLLLVEDSALEDFNGIDTSEPNAVVIGLAPEHFNYQTLNKAFRMILDG--APLIAIHKARYYK-RKDGLALGPGPFVTGLEYATDRKASVVGKPEKTFFMQALSDLGCSPSEAV---------MIGDDARDDIGGAQNAGMLGILVRSGE 238          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Medaka
Match: hdhd2 (haloacid dehalogenase like hydrolase domain containing 2 [Source:NCBI gene;Acc:101168225])

HSP 1 Score: 147.902 bits (372), Expect = 9.108e-42
Identity = 84/237 (35.44%), Postives = 137/237 (57.81%), Query Frame = 1
Query:  178 KALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGK 888
            KA+LID+ G L     + + + + G+ +A+KKL+N       +TN ++     LLE L+ + F +Q   I++ L A + +IE+ + +P  ++ D+        D  E ++VV+  A  +F+Y+T+NKAF+ ++    +  +   K +YY+  K GL L  GPF   LE+ATDRKA ++GKP   FF  AL+ L  +P + +         M+GDD  +D+GGAQ+ GM G+LVRSG+
Sbjct:   29 KAVLIDLSGTL-----HIDDTAVPGAQEALKKLRNASVTVKFVTNTTKESKRNLLERLHRLNFDVQENEIFTSLSAARSLIEQKNHRPLLLVEDSALEDFNGIDTSEPNAVVIGLAPEHFNYQTLNKAFRMILDG--APLIAIHKARYYK-RKDGLALGPGPFVTGLEYATDRKASVVGKPEKTFFMQALSDLGCSPSEAV---------MIGDDARDDIGGAQNAGMLGILVRSGE 248          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Planmine SMEST
Match: SMESG000068212.1 (SMESG000068212.1)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 275/276 (99.64%), Postives = 276/276 (100.00%), Query Frame = 1
Query:  160 MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSDL 987
            MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLL+LLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSDL
Sbjct:    1 MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLKLLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSDL 276          
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Planmine SMEST
Match: SMESG000068212.1 (SMESG000068212.1)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 266/276 (96.38%), Postives = 267/276 (96.74%), Query Frame = 1
Query:  160 MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSDL 987
            MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLL+LLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQ         TFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSDL
Sbjct:    1 MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLTNESQVPPNVLLKLLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISDNLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAGKGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLHSNPDQ---------TFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEHHPIVKPIMIVNCINDFVEKLFAPSDL 267          
The following BLAST results are available for this feature:
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHPP5.320e-5737.17phospholysine phosphohistidine inorganic pyrophosp... [more]
HDHD23.668e-4032.42haloacid dehalogenase like hydrolase domain contai... [more]
LHPP6.605e-3733.50phospholysine phosphohistidine inorganic pyrophosp... [more]
LHPP1.436e-3634.00phospholysine phosphohistidine inorganic pyrophosp... [more]
HDHD26.540e-2528.97haloacid dehalogenase like hydrolase domain contai... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C13C4.41.914e-4132.71pep chromosome:WBcel235:V:12109168:12110978:-1 gen... [more]
K08B12.33.815e-3130.97pep chromosome:WBcel235:V:6235176:6237807:1 gene:W... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG172948.039e-3935.22gene:FBgn0032032 transcript:FBtr0079651[more]
CG55773.292e-922.42gene:FBgn0036759 transcript:FBtr0075162[more]
CG55773.292e-922.42gene:FBgn0036759 transcript:FBtr0347063[more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhpp8.763e-5836.98phospholysine phosphohistidine inorganic pyrophosp... [more]
hdhd24.229e-4534.14haloacid dehalogenase-like hydrolase domain contai... [more]
hdhd24.229e-4534.14haloacid dehalogenase-like hydrolase domain contai... [more]
pgp2.367e-719.62phosphoglycolate phosphatase [Source:ZFIN;Acc:ZDB-... [more]
pgp2.367e-719.62phosphoglycolate phosphatase [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zbtb101.662e-4834.77zinc finger and BTB domain containing 10 [Source:X... [more]
hdhd29.781e-4132.95haloacid dehalogenase like hydrolase domain contai... [more]
hdhd28.962e-2828.91haloacid dehalogenase like hydrolase domain contai... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhpp7.004e-5837.17phospholysine phosphohistidine inorganic pyrophosp... [more]
Lhpp2.290e-5237.50phospholysine phosphohistidine inorganic pyrophosp... [more]
Hdhd26.448e-3931.64haloacid dehalogenase-like hydrolase domain contai... [more]
Hdhd26.448e-3931.64haloacid dehalogenase-like hydrolase domain contai... [more]
Hdhd26.448e-3931.64haloacid dehalogenase-like hydrolase domain contai... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D7I5|LHPP_MOUSE4.899e-5737.17Phospholysine phosphohistidine inorganic pyrophosp... [more]
sp|A5PLK2|LHPP_DANRE6.615e-5736.98Phospholysine phosphohistidine inorganic pyrophosp... [more]
sp|Q3B8E3|LHPP_XENLA1.219e-5636.50Phospholysine phosphohistidine inorganic pyrophosp... [more]
sp|Q9H008|LHPP_HUMAN2.555e-5637.17Phospholysine phosphohistidine inorganic pyrophosp... [more]
sp|Q5I0D5|LHPP_RAT4.677e-5235.66Phospholysine phosphohistidine inorganic pyrophosp... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A224Z5382.435e-6843.75Phospholysine phosphohistidine inorganic pyrophosp... [more]
A0A131YYT12.595e-6642.65Phospholysine phosphohistidine inorganic pyrophosp... [more]
G3MK031.033e-6544.85Uncharacterized protein OS=Amblyomma maculatum OX=... [more]
A0A131XLM57.522e-6541.54Uncharacterized protein OS=Hyalomma excavatum OX=2... [more]
A0A369SGI51.641e-6239.86Phospholysine phosphohistidine inorganic pyrophosp... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhpp7.240e-5938.71phospholysine phosphohistidine inorganic pyrophosp... [more]
lhpp1.850e-5838.71phospholysine phosphohistidine inorganic pyrophosp... [more]
lhpp2.507e-5337.34phospholysine phosphohistidine inorganic pyrophosp... [more]
hdhd29.925e-3831.28haloacid dehalogenase like hydrolase domain contai... [more]
hdhd21.458e-3232.34haloacid dehalogenase like hydrolase domain contai... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lhpp4.207e-3640.85phospholysine phosphohistidine inorganic pyrophosp... [more]
hdhd21.112e-3332.89haloacid dehalogenase-like hydrolase domain contai... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO359154.488e-6242.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493902.592e-4637.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lhpp4.562e-5438.34phospholysine phosphohistidine inorganic pyrophosp... [more]
hdhd25.259e-4735.09haloacid dehalogenase like hydrolase domain contai... [more]
hdhd26.366e-4235.44haloacid dehalogenase like hydrolase domain contai... [more]
hdhd29.108e-4235.44haloacid dehalogenase like hydrolase domain contai... [more]
back to top
BLAST of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000068212.10.000e+099.64SMESG000068212.1[more]
SMESG000068212.10.000e+096.38SMESG000068212.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027357 ID=SMED30027357|Name=Phospholysine phosphohistidine inorganic pyrophosphate phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1108bp
ATTTTAATAGAACTATTAAATATCATAAATAATTCTTATTAATTTAATAC
AATATTTTTGAACAATGTATTTATCCAACCTCAAATATTTAATATACTAT
TTTATTTACATAAACTTTGTTGATAAAATTAATTTAAATATTATAAAATC
TAATTTGAAATGTGGCATTCTAAATGTAAAGCTTTATTAATTGATATTCA
TGGAGTGCTATTTAATTCTTCATCTAACGGGGAATATTCAGTGATTGAAG
GATCTATTGATGCCATAAAAAAACTACAAAATAAGAAATTTCCTTTTATG
TTATTAACAAATGAAAGTCAAGTGCCTCCAAATGTTTTATTAGAATTACT
CAATTCAATGGGATTTCAACTGCAAATTGAAAATATTTACTCCCCATTAA
TGGCAATAAAAGAAATTATTGAAAAAAGTTCATTAAAACCGTTCTCCATT
ATTAGTGACAATTTAAAAACGTATCTTCCCCATCACGACATTGACGAGTG
TGATTCGGTTGTTGTTACAGATGCCCACACAAATTTTAGCTATGAAACAA
TGAATAAAGCATTTCAATTTTTAATTCAAAATCCGAAATCTCGCTTTCTA
ACAGCTGGAAAGGGGAAATATTATCGGGACTCAAAAGTGGGATTGGTACT
TGATTTGGGACCATTTACTGAAGCATTAGAATTCGCCACGGACAGAAAAG
CAGAAATTATTGGAAAACCTGGGAATTTATTCTTTAGAAATGCATTAAAT
ATGCTCCATTCAAATCCTGATCAAGTTATTGGAATGAGGTTCCAAAATAA
GACATTTATGGTTGGAGATGATATTCTGAATGATGTTGGAGGAGCTCAAT
CTGTTGGAATGTTCGGTGTACTTGTCAGATCAGGAAAGTATCGTCCTGAA
GATGAACATCATCCAATTGTTAAACCGATTATGATTGTCAACTGCATAAA
TGATTTTGTTGAAAAGTTATTTGCACCCAGTGACTTGTAAGATCAATCAA
TTTTTAACATTTCGACATTCACAATTGAAATATTATTTAAAAATCTTCGA
TCTGTCATTGATAAAAATTTAAAAATTTTGAGATGTATATCCCAAATAGT
CAAAATTG
back to top

protein sequence of SMED30027357-orf-1

>SMED30027357-orf-1 ID=SMED30027357-orf-1|Name=SMED30027357-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MWHSKCKALLIDIHGVLFNSSSNGEYSVIEGSIDAIKKLQNKKFPFMLLT
NESQVPPNVLLELLNSMGFQLQIENIYSPLMAIKEIIEKSSLKPFSIISD
NLKTYLPHHDIDECDSVVVTDAHTNFSYETMNKAFQFLIQNPKSRFLTAG
KGKYYRDSKVGLVLDLGPFTEALEFATDRKAEIIGKPGNLFFRNALNMLH
SNPDQVIGMRFQNKTFMVGDDILNDVGGAQSVGMFGVLVRSGKYRPEDEH
HPIVKPIMIVNCINDFVEKLFAPSDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
GO:0006470protein dephosphorylation
GO:0006796phosphate-containing compound metabolic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016791phosphatase activity
GO:0000287magnesium ion binding
GO:0004427inorganic diphosphatase activity
GO:0008969phosphohistidine phosphatase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006355LHPP/HDHD2
IPR036412HAD-like_sf
IPR023215NPhePase-like_dom
IPR006357HAD-SF_hydro_IIA
IPR023214HAD_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 83..188
e-value: 2.1E-65
score: 222.6
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 7..263
e-value: 2.1E-65
score: 222.6
IPR006357HAD-superfamily hydrolase, subfamily IIATIGRFAMTIGR01460TIGR01460coord: 10..242
e-value: 2.1E-34
score: 117.3
IPR006357HAD-superfamily hydrolase, subfamily IIAPFAMPF13344Hydrolase_6coord: 9..111
e-value: 1.3E-13
score: 50.9
IPR006355HAD hydrolase, LHPP/HDHD2TIGRFAMTIGR01458TIGR01458coord: 7..270
e-value: 1.1E-66
score: 222.8
NoneNo IPR availablePFAMPF13242Hydrolase_likecoord: 184..262
e-value: 4.7E-15
score: 55.4
NoneNo IPR availablePANTHERPTHR19288:SF44PHOSPHOLYSINE PHOSPHOHISTIDINE INORGANIC PYROPHOSPHATE PHOSPHATASEcoord: 5..263
NoneNo IPR availablePANTHERPTHR192884-NITROPHENYLPHOSPHATASE-RELATEDcoord: 5..263
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 6..267