Sorbitol dehydrogenase-like protein

Overview
NameSorbitol dehydrogenase-like protein
Smed IDSMED30027355
Length (bp)1359
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorbitol dehydrogenase-like protein (SMED30027355) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorbitol dehydrogenase-like protein (SMED30027355) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorbitol dehydrogenase-like protein (SMED30027355) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorbitol dehydrogenase-like protein (SMED30027355) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027355

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30027355SMESG000042474.1 dd_Smed_v4_1002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027355SMESG000042474.1 dd_Smed_v4_1002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Human
Match: SORD (sorbitol dehydrogenase [Source:HGNC Symbol;Acc:HGNC:11184])

HSP 1 Score: 343.199 bits (879), Expect = 5.714e-115
Identity = 176/343 (51.31%), Postives = 234/343 (68.22%), Query Frame = 1
Query:   67 NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            NLS V+        E   IP     N+VLL++ +VGICGSDVHYW  GRIG+F+V+KP++LGHE S  V K G +V +LK GDRVAIEPG P    + C  GRYNL   + F ATPP DG LC++  H   FC+KL DN++ EEGALIEPLSV +HACRRG VTLG KVL+ GAG IG+V LLVAK++GA  +VV D++  RL  AKE+GA  V+ I  +   +EI  K++  +    + TIEC+GA   +   I AT SGG +V+VG+G+ +   PLL+A IREVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+KIM++
Sbjct:    9 NLSLVVHGPGDLRLENYPIPE-PGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKE-SPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLK 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Human
Match: SORD (sorbitol dehydrogenase [Source:HGNC Symbol;Acc:HGNC:11184])

HSP 1 Score: 336.265 bits (861), Expect = 1.385e-112
Identity = 169/318 (53.14%), Postives = 226/318 (71.07%), Query Frame = 1
Query:  142 NDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            N+VLL++ +VGICGSDVHYW  GRIG+F+V+KP++LGHE S  V K G +V +LK GDRVAIEPG P    + C  GRYNL   + F ATPP DG LC++  H   FC+KL DN++ EEGALIEPLSV +HACRRG VTLG KVL+ GAG IG+V LLVAK++GA  +VV D++  RL  AKE+GA  V+ I  +   +EI  K++  +    + TIEC+GA   +   I AT SGG +V+VG+G+ +   PLL+A IREVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+KIM++
Sbjct:   12 NEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKE-SPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLK 328          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Human
Match: ADH1A (alcohol dehydrogenase 1A (class I), alpha polypeptide [Source:HGNC Symbol;Acc:HGNC:249])

HSP 1 Score: 105.916 bits (263), Expect = 1.930e-24
Identity = 102/365 (27.95%), Postives = 164/365 (44.93%), Query Frame = 1
Query:   91 QNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLCSK--------VIFHATPPFD------------GTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAV-HACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKI-KEHINGLVDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALI------REVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMI 1092
            +  F  EE ++      ++V +K++ VGICG+D H       G  V   P+ILGHE + +V   G+ VT +K GD+V I   +P C +C++C N   N C K         +   T  F              T  QY    E+   K+      E+  LI    S     A     VT GS   + G G +GL  ++  K+ GA  I+ VD+N+ +   AKELGA   I   N  D ++ + ++ KE  +G VD + E        +   +    + G  VIVG+  P  Q   +N ++       +  I G F+   C P  ++    K+ ++  LIT + PF +  + F L+ SG+ ++ ++
Sbjct:   19 KKPFSIEEVEVAP-PKAHEVRIKMVAVGICGTDDHV----VSGTMVTPLPVILGHEAAGIVESVGEGVTTVKPGDKV-IPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATECI---NPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGV-PPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTIL 373          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Human
Match: ADH1C (alcohol dehydrogenase 1C (class I), gamma polypeptide [Source:HGNC Symbol;Acc:HGNC:251])

HSP 1 Score: 100.523 bits (249), Expect = 1.232e-22
Identity = 100/364 (27.47%), Postives = 161/364 (44.23%), Query Frame = 1
Query:   91 QNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--------VIFHATPPFD------------GTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAV-HACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKI-KEHINGLVDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALI------REVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMI 1092
            +  F  EE ++      ++V +K++  GIC SD H       G+ V   P+ILGHE + +V   G+ VT +K GD+V       C +C++C N   N C K         +   T  F              T  QY    E+   K+      E+  LI    S     A +   VT GS   + G G +GL  ++  K+ GA  I+ VD+N+ +   AKELGA   I   N  D ++ + ++ KE  +G VD + E        +   +    + G  VIVG+  P  Q   +N ++       +  I G F+     P  ++    K+ ++  LIT I PF +  + F L+RSG+ ++ ++
Sbjct:   19 KKPFSIEEVEVAP-PKAHEVRIKMVAAGICRSDEHVVS----GNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECI---NPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGV-PPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGFDLLRSGKSIRTVL 373          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Human
Match: ADH1B (alcohol dehydrogenase 1B (class I), beta polypeptide [Source:HGNC Symbol;Acc:HGNC:250])

HSP 1 Score: 98.2117 bits (243), Expect = 7.826e-22
Identity = 101/375 (26.93%), Postives = 165/375 (44.00%), Query Frame = 1
Query:   79 VLKQQNQFDFEERKIPTIED-------ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--------VIFHATPPFD------------GTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAV-HACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKI-KEHINGLVDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALI------REVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMI 1092
            V+K +    +E +K  +IED         +V +K++ VGIC +D H       G+ V   P+ILGHE + +V   G+ VT +K GD+V       C +C++C N   N C K         +   T  F              T  QY    E+   K+      E+  LI    S     A     VT GS   + G G +GL  ++  K+ GA  I+ VD+N+ +   AKELGA   I   N  D ++ + ++ KE  +G VD + E        +   +    + G  VIVG+  P  Q   +N ++       +  + G F+     P  ++    K+ ++  LIT + PF +  + F L+ SG+ ++ ++
Sbjct:    7 VIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHV----VSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECI---NPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGV-PPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVL 373          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Celegans
Match: R04B5.5 (pep chromosome:WBcel235:V:10087480:10088998:1 gene:WBGene00011003.1 transcript:R04B5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R04B5.5)

HSP 1 Score: 338.961 bits (868), Expect = 5.333e-114
Identity = 171/350 (48.86%), Postives = 241/350 (68.86%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKN---DLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            MS  NLS VL   +    E+  IP     N VL+K+ TVGICGSDVHYW +G IG FVV++P+I+GHETS +V + G  V +LK GDR+A+EPG+PC+ C+ C  GRYNLC ++ F ATPP  GTL +++ H  DFCFKL DNLS E+GALIEPLSVA+HACRRGNV +G +VL++GAG IG++NL+ AK++GA  +V+ D+++ RL +AK+LGA   I++K    D    EI++ + +      D  IEC+GA   +  AI  T SGG +V+VG+GA  V+ P++ +  REVD+RG+FRY NCYP A+ LIS  ++N++ L    +   E ++AFK  +  + +K+ I+
Sbjct:    1 MSQDNLSAVLYGVDDLRLEQVPIPK-PGPNQVLVKVHTVGICGSDVHYWTHGAIGPFVVKEPMIVGHETSGIVSEVGNEVKHLKVGDRIAMEPGLPCKLCEHCKTGRYNLCPEMRFFATPPVHGTLSRFVVHDADFCFKLPDNLSFEDGALIEPLSVAIHACRRGNVQMGHRVLVLGAGPIGVLNLITAKAVGAGKVVITDLDDGRLALAKKLGADATINVKGKSLDAVKSEIITALGDQ---QPDVCIECTGAQPSIETAITTTKSGGVIVLVGLGADRVEIPIIESATREVDMRGIFRYVNCYPTAIELISSGKLNLSGLTRAHYKLEETQEAFKRTQKADVIKVFIQ 346          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Celegans
Match: R04B5.6 (pep chromosome:WBcel235:V:10085281:10087313:1 gene:WBGene00011004.1 transcript:R04B5.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R04B5.6)

HSP 1 Score: 293.123 bits (749), Expect = 4.558e-96
Identity = 163/347 (46.97%), Postives = 227/347 (65.42%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            MS  NLS VL   N    E+  I +      VL+KI TVGICGSDVH+  +G IG FVV++P++LGHE+S VV + G  V   K GDR+A+EPG+PC+ C+ C  GRYNLC  + F ATPP +G L +++ H  DFCFKL DNLS E+GAL+EPLSVA+ ACRRG V +G K+L++GAG IG++NLL AK++GA  +V+ D+N+ RL +A+ LGA   I++      E     IK   +     +IEC+G    +  AI  T SGG VV+VG+GA  V+ PL+ +  REVD+RG FR ANCY  A+ LIS  +++++ L    +   E+ +AFK  ++G+ +K+ I 
Sbjct:    1 MSQDNLSAVLYGINDLRLEQAPI-SKPGPRQVLVKINTVGICGSDVHFLTHGAIGSFVVKEPMVLGHESSGVVSEIGSEVKGFKVGDRIAMEPGLPCKLCEHCKIGRYNLCPDMRFFATPPVNGALSRFVVHDADFCFKLPDNLSFEDGALLEPLSVAIQACRRGTVQMGQKILVLGAGPIGVLNLLTAKAIGASKVVITDLNDERLALARLLGADATINVMGKRSDEVRSEIIKAFGDQQPHVSIECTGVQPCVETAIMTTRSGGVVVLVGLGAERVEIPLIQSPTREVDLRGTFRSANCYSTAIELISSGKLDLSGLTRAHYKLEESLEAFKRTQNGDVIKVFIH 346          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Celegans
Match: D2063.1 (pep chromosome:WBcel235:V:4327121:4328736:1 gene:WBGene00017060.1 transcript:D2063.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2063.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.430e-15
Identity = 81/280 (28.93%), Postives = 129/280 (46.07%), Query Frame = 1
Query:   73 SFVLKQQNQFDFEE-------RKIPTIE-DENDVLLKILTVGICGSDVHYWINGRIGDF--VVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIE-PGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSV-AVHACRRGNVTLGSKVLIIGA-GTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGM 873
            S V K Q    FE        +++P  + +E+++L+K+   GIC SDVH W+    GDF  V + P+I GHE +  VI  G  V N + GD+V I+     C  C+ C  G   LC  V       + GT  +Y T  +    K+  +++    A +    V A  A +   V  G  V + GA G +G   +  A+++G   +V +D   +     K LGA + +   +   TE+IV+ I+E  +G     +  + A   +  A+      G VV VG+
Sbjct:    4 SDVPKTQRALIFESYGGPLEIKQLPIPQPNEDELLVKMEYSGICHSDVHTWL----GDFHYVSKCPMIGGHEGAGSVISVGSKVKNWQIGDKVGIKLVQGNCLNCEYCQTGHEPLCPHVWNIGVQKY-GTFQEYATIRDVDAIKIPKSMNMAAAAPVLCGGVTAYKALKESEVKSGQIVAVTGAGGGLGSFAIQYARAMGM-RVVAIDHPSKEAH-CKSLGAEWFV---DAFGTEDIVAHIREITDGGAHGVVNFAAAKVPMEKALEYVRKRGTVVFVGL 273          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Celegans
Match: H24K24.3 (Alcohol dehydrogenase class-3 [Source:UniProtKB/Swiss-Prot;Acc:Q17335])

HSP 1 Score: 74.3294 bits (181), Expect = 2.739e-14
Identity = 70/244 (28.69%), Postives = 109/244 (44.67%), Query Frame = 1
Query:  142 NDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPF--DGTLCQYITHPEDFCFKLSDNLS-------------NEEGALIEPLSVAVHACRRG--------NVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKN-DL-DTEEIVSKIKEHINGLVDKTIEC 798
            ++V +KIL   +C +D  Y ++G   + +   P++LGHE S +V   G+ VT    GD V       C+ C+ C N + NLC K+       F  DG+        + F F      S             N E A +E +S+       G         V  GS V + G G +GL  ++ AK+ GA  IV +D+ E + + AK  GA   I+ K+ +L + +   + + E  +G  D T EC
Sbjct:   36 HEVRVKILYTAVCHTDA-YTLDGHDPEGLF--PVVLGHEGSGIVESVGEGVTGFAPGDHVVPLYVPQCKECEYCKNPKTNLCQKIRISQGNGFMPDGSSRFTCNGKQLFHFMGCSTFSEYTVVADISLCKVNPE-APLEKVSLLGCGISTGYGAVLNTCKVEEGSTVAVWGLGAVGLAVIMGAKAAGAKKIVGIDLIESKFESAKFFGATECINPKSVELPEGKSFQAWLVEQFDGGFDYTFEC 275          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Celegans
Match: H24K24.3 (Alcohol dehydrogenase class-3 [Source:UniProtKB/Swiss-Prot;Acc:Q17335])

HSP 1 Score: 73.559 bits (179), Expect = 4.992e-14
Identity = 71/250 (28.40%), Postives = 108/250 (43.20%), Query Frame = 1
Query:  124 PTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPF--DGTLCQYITHPEDFCFKLSDNLS-------------NEEGALIEPLSVAVHACRRG--------NVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKN-DL-DTEEIVSKIKEHINGLVDKTIEC 798
            P    E  V  +IL   +C +D  Y ++G   + +   P++LGHE S +V   G+ VT    GD V       C+ C+ C N + NLC K+       F  DG+        + F F      S             N E A +E +S+       G         V  GS V + G G +GL  ++ AK+ GA  IV +D+ E + + AK  GA   I+ K+ +L + +   + + E  +G  D T EC
Sbjct:   32 PPKAHEVRVKFQILYTAVCHTDA-YTLDGHDPEGLF--PVVLGHEGSGIVESVGEGVTGFAPGDHVVPLYVPQCKECEYCKNPKTNLCQKIRISQGNGFMPDGSSRFTCNGKQLFHFMGCSTFSEYTVVADISLCKVNPE-APLEKVSLLGCGISTGYGAVLNTCKVEEGSTVAVWGLGAVGLAVIMGAKAAGAKKIVGIDLIESKFESAKFFGATECINPKSVELPEGKSFQAWLVEQFDGGFDYTFEC 277          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Fly
Match: Sodh-2 (gene:FBgn0022359 transcript:FBtr0082324)

HSP 1 Score: 362.073 bits (928), Expect = 1.195e-122
Identity = 194/350 (55.43%), Postives = 250/350 (71.43%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIEV 1098
            M++ NL+ VL        E+R IP I D ++VLL + +VGICGSDVHY  +GRIGDFV+ KP+I+GHE + VV K GK VT LK GDRVAIEPGVPCR C  C  GRYNLC+ ++F ATPP+DG L +Y  H  DFCFKL D++S EEGAL+EPLSV VHACRR  V LGSKVLI+GAG IGLV LL A+++GA  I++ D+ ++RL VAKELGA   + ++ D   EE V  + + ++ + DK+I+C GA +   LAI AT SGG VV+VGMGAP V+ PL+NAL RE+DIRGVFRY N Y AAL+L++  ++NV  L+T  +   E  +AF+  R G G  +K+MI V
Sbjct:    1 MATDNLTAVLHGIEDLRLEQRPIPEIAD-DEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHEAAGVVAKLGKKVTTLKVGDRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSKVLILGAGPIGLVTLLAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVHQTMSEVPDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEVKLPLINALAREIDIRGVFRYCNDYSAALALVASGKVNVKRLVTHHYDITETAEAFETSRRGTGGAIKVMIHV 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Fly
Match: Sodh-1 (gene:FBgn0024289 transcript:FBtr0081627)

HSP 1 Score: 351.673 bits (901), Expect = 1.399e-118
Identity = 192/350 (54.86%), Postives = 248/350 (70.86%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIEV 1098
            M+  NL+ VL        E+R IP I D ++VLL + +VGICGSDVHY  +GRIGDFV+ KP+I+GHE++ VV K GK VT LK GDRVAIEPGVPCR+C  C  G+YNLC  ++F ATPP+DG L +Y  H  DFCFKL D+++ EEGAL+EPLSV VHAC+R  VTLGSKVLI+GAG IGLV L+ A+++GA  I++ D+ ++RL VAKELGA   + +K D   EE    +++ + G  DK+I+C GA +   LAI AT SGG VV+VGMGA  ++ PL+NAL REVDIRGVFRY N Y AAL+L++  ++NV  L+T  F   E   AF+  R G G  +K+MI V
Sbjct:    1 MAKDNLTAVLHGIEDMRLEQRPIPEIAD-DEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHESAGVVAKLGKKVTTLKVGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATPPYDGNLTRYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAEVTLGSKVLILGAGPIGLVTLMAAQAMGASEILITDLVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKTMGGQPDKSIDCCGAESSARLAIFATRSGGIVVVVGMGAAEIKLPLINALAREVDIRGVFRYCNDYAAALALVASGKVNVKRLVTHHFDIKETAKAFETSRKGLGGAIKVMIHV 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Fly
Match: Sodh-1 (gene:FBgn0024289 transcript:FBtr0339932)

HSP 1 Score: 351.673 bits (901), Expect = 1.399e-118
Identity = 192/350 (54.86%), Postives = 248/350 (70.86%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIEV 1098
            M+  NL+ VL        E+R IP I D ++VLL + +VGICGSDVHY  +GRIGDFV+ KP+I+GHE++ VV K GK VT LK GDRVAIEPGVPCR+C  C  G+YNLC  ++F ATPP+DG L +Y  H  DFCFKL D+++ EEGAL+EPLSV VHAC+R  VTLGSKVLI+GAG IGLV L+ A+++GA  I++ D+ ++RL VAKELGA   + +K D   EE    +++ + G  DK+I+C GA +   LAI AT SGG VV+VGMGA  ++ PL+NAL REVDIRGVFRY N Y AAL+L++  ++NV  L+T  F   E   AF+  R G G  +K+MI V
Sbjct:    1 MAKDNLTAVLHGIEDMRLEQRPIPEIAD-DEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHESAGVVAKLGKKVTTLKVGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATPPYDGNLTRYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAEVTLGSKVLILGAGPIGLVTLMAAQAMGASEILITDLVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKTMGGQPDKSIDCCGAESSARLAIFATRSGGIVVVVGMGAAEIKLPLINALAREVDIRGVFRYCNDYAAALALVASGKVNVKRLVTHHFDIKETAKAFETSRKGLGGAIKVMIHV 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Fly
Match: CG4836 (gene:FBgn0270925 transcript:FBtr0083828)

HSP 1 Score: 147.902 bits (372), Expect = 6.618e-38
Identity = 98/308 (31.82%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  145 DVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQ-VAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVR 1065
            DVL++  +V +  SD+H + NG        + + LGH+ + +V + G+ V +L  GDRV +E  + C  C LC  G YN+CS +++      +G L  Y THP D C +L +++S E GAL + L++   AC + NVT  S VLI+GA    +   + AK++GA  + +       L  VA++ G   V    N L   E++  I        D  I CS +A  +NLA+ A    G  V+    +       L+ L++ + +   FR AN YP AL L+   R ++   IT  +P ++A++AF+  +
Sbjct:  901 DVLIRTGSVAVSNSDIHVYENGNRD----MEAMSLGHDATGIVEELGRCVQHLHVGDRVVMESALSCGICDLCKKGLYNMCSGLVY------NGFLSTYQTHPADLCHRLPESISMEAGALTQTLALGCQACFKANVTPTSNVLILGACPTAVAAGICAKAIGAKRVAIAGCMAPALDVVARDFGFQAVEFDSNAL-FGEVLEAIYSKFRDWPDCVINCSISAMTMNLAVMALQPCGVCVLAECDSECASFNALDVLMKNIRLVPSFRSANMYPTALQLMQSGRAHMQKFITATYPLSKADEAFRAAQ 1197          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Fly
Match: CG4836 (gene:FBgn0270925 transcript:FBtr0083827)

HSP 1 Score: 147.902 bits (372), Expect = 7.605e-38
Identity = 98/308 (31.82%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  145 DVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQ-VAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVR 1065
            DVL++  +V +  SD+H + NG        + + LGH+ + +V + G+ V +L  GDRV +E  + C  C LC  G YN+CS +++      +G L  Y THP D C +L +++S E GAL + L++   AC + NVT  S VLI+GA    +   + AK++GA  + +       L  VA++ G   V    N L   E++  I        D  I CS +A  +NLA+ A    G  V+    +       L+ L++ + +   FR AN YP AL L+   R ++   IT  +P ++A++AF+  +
Sbjct:  898 DVLIRTGSVAVSNSDIHVYENGNRD----MEAMSLGHDATGIVEELGRCVQHLHVGDRVVMESALSCGICDLCKKGLYNMCSGLVY------NGFLSTYQTHPADLCHRLPESISMEAGALTQTLALGCQACFKANVTPTSNVLILGACPTAVAAGICAKAIGAKRVAIAGCMAPALDVVARDFGFQAVEFDSNAL-FGEVLEAIYSKFRDWPDCVINCSISAMTMNLAVMALQPCGVCVLAECDSECASFNALDVLMKNIRLVPSFRSANMYPTALQLMQSGRAHMQKFITATYPLSKADEAFRAAQ 1194          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Zebrafish
Match: sord (sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-1231])

HSP 1 Score: 340.887 bits (873), Expect = 2.675e-114
Identity = 180/350 (51.43%), Postives = 239/350 (68.29%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
            M   NLS VL  +     E+R IP     NDVLL++ +VGICGSDVHYW NGRIGDFVV++P+ILGHE S  V+K G  VT+LK GDRVA+EPGVP    +   +G YNL   + F ATPP DG LC+Y  H   FC+KL DN++ EEGALIEPLSV +HACRR  VTLGS V + GAG IGLV+LL AK++GA  +++ D++  RL  AKE+GA F++ +K +   +++  +++  +  +    IEC+G  + +  AI AT SGG VV VG+GA +   PLLNA +REVDIRGVFRY N +P A+S+++ K++NV PL+T  FP   A  AF+  R G GVK+M++  K
Sbjct:    1 MDKDNLSVVLHAKGDLRLEQRPIPE-PGPNDVLLQMHSVGICGSDVHYWQNGRIGDFVVKQPMILGHEASGRVVKVGSAVTHLKPGDRVAVEPGVPREVDEFVKSGHYNLSPSIFFCATPPDDGNLCRYYKHSASFCYKLPDNVTYEEGALIEPLSVGIHACRRAGVTLGSSVFVCGAGPIGLVSLLAAKAMGASQVIISDLSSDRLAKAKEIGADFLLPVKKEDSPQDLAKRVEGMLGCMPQICIECTGVQSSIQTAIYATRSGGVVVSVGLGAEMTTVPLLNAAVREVDIRGVFRYCNTWPVAISMLASKKVNVKPLVTHRFPLEHAVQAFETTRQGLGVKVMLKCDK 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Zebrafish
Match: sord (sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-1231])

HSP 1 Score: 241.506 bits (615), Expect = 1.492e-77
Identity = 113/212 (53.30%), Postives = 151/212 (71.23%), Query Frame = 1
Query:  166 TVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECS 801
            +VGICGSDVHYW NGRIGDFVV++P+ILGHE S  V+K G  VT+LK GDRVA+EPGVP    +   +G YNL   + F ATPP DG LC+Y  H   FC+KL DN++ EEGALIEPLSV +HACRR  VTLGS V + GAG IGLV+LL AK++GA  +++ D++  RL  AKE+GA F++ +K +   +++  +++  +  +    IEC+
Sbjct:    3 SVGICGSDVHYWQNGRIGDFVVKQPMILGHEASGRVVKVGSAVTHLKPGDRVAVEPGVPREVDEFVKSGHYNLSPSIFFCATPPDDGNLCRYYKHSASFCYKLPDNVTYEEGALIEPLSVGIHACRRAGVTLGSSVFVCGAGPIGLVSLLAAKAMGASQVIISDLSSDRLAKAKEIGADFLLPVKKEDSPQDLAKRVEGMLGCMPQICIECT 214          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Zebrafish
Match: adh8b (alcohol dehydrogenase 8b [Source:ZFIN;Acc:ZDB-GENE-030529-2])

HSP 1 Score: 98.5969 bits (244), Expect = 3.190e-22
Identity = 91/349 (26.07%), Postives = 152/349 (43.55%), Query Frame = 1
Query:  136 DENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK------VIFHATPPFD--------------GTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVH--ACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGMGAPVVQAP---LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
             E +V +KIL   +C +D+ + +           P ILGHE + VV   G  VT  K GD+V    G  CR C+ C + R NLC +      + + + P                 GTL +YI   + +  K+ D+   +   L+       +  A     VT GS   + G G +GL  ++  K+ GA  I  VD+NE++ + AK  GA   ++ K     + I   + E  NG VD ++EC G      LA+ +   G G  V+VG       +    L+     +  + G F+  +  P  +      +I +   IT+     +  D  KL+++GE ++ ++++ K
Sbjct:   33 QEGEVRIKILYTSLCHTDLFHLLESTDNKGF---PTILGHEAAGVVESVGPGVTEFKPGDKVIPNSGCQCRECKFCKSPRTNLCERSWVNDHIEYMSYPKTSFTCRGKPILQFTNTGTLAEYIVIRQIYVVKIDDDAPLDRVCLLGCGVTTGYGAAVNSAGVTPGSVCAVFGLGAVGLAAVMGCKNAGASRIFAVDINEKKFEKAKVFGATDFLNPK--AYNKPISEVLIEMTNGGVDFSLECVGNTEVSRLALESCAKGWGLSVLVGYTNTDFSSKPIQLIYGKTWKGTLLGGFKIKDGVPKLVLDYMSGKIMLDEFITQRMKLEQVNDVVKLMKNGECIRCILDMSK 376          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Zebrafish
Match: adh8b (alcohol dehydrogenase 8b [Source:ZFIN;Acc:ZDB-GENE-030529-2])

HSP 1 Score: 98.5969 bits (244), Expect = 3.190e-22
Identity = 91/349 (26.07%), Postives = 152/349 (43.55%), Query Frame = 1
Query:  136 DENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK------VIFHATPPFD--------------GTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVH--ACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGMGAPVVQAP---LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
             E +V +KIL   +C +D+ + +           P ILGHE + VV   G  VT  K GD+V    G  CR C+ C + R NLC +      + + + P                 GTL +YI   + +  K+ D+   +   L+       +  A     VT GS   + G G +GL  ++  K+ GA  I  VD+NE++ + AK  GA   ++ K     + I   + E  NG VD ++EC G      LA+ +   G G  V+VG       +    L+     +  + G F+  +  P  +      +I +   IT+     +  D  KL+++GE ++ ++++ K
Sbjct:   33 QEGEVRIKILYTSLCHTDLFHLLESTDNKGF---PTILGHEAAGVVESVGPGVTEFKPGDKVIPNSGCQCRECKFCKSPRTNLCERSWVNDHIEYMSYPKTSFTCRGKPILQFTNTGTLAEYIVIRQIYVVKIDDDAPLDRVCLLGCGVTTGYGAAVNSAGVTPGSVCAVFGLGAVGLAAVMGCKNAGASRIFAVDINEKKFEKAKVFGATDFLNPK--AYNKPISEVLIEMTNGGVDFSLECVGNTEVSRLALESCAKGWGLSVLVGYTNTDFSSKPIQLIYGKTWKGTLLGGFKIKDGVPKLVLDYMSGKIMLDEFITQRMKLEQVNDVVKLMKNGECIRCILDMSK 376          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Zebrafish
Match: adh8b (alcohol dehydrogenase 8b [Source:ZFIN;Acc:ZDB-GENE-030529-2])

HSP 1 Score: 98.5969 bits (244), Expect = 3.190e-22
Identity = 91/349 (26.07%), Postives = 152/349 (43.55%), Query Frame = 1
Query:  136 DENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK------VIFHATPPFD--------------GTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVH--ACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGMGAPVVQAP---LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
             E +V +KIL   +C +D+ + +           P ILGHE + VV   G  VT  K GD+V    G  CR C+ C + R NLC +      + + + P                 GTL +YI   + +  K+ D+   +   L+       +  A     VT GS   + G G +GL  ++  K+ GA  I  VD+NE++ + AK  GA   ++ K     + I   + E  NG VD ++EC G      LA+ +   G G  V+VG       +    L+     +  + G F+  +  P  +      +I +   IT+     +  D  KL+++GE ++ ++++ K
Sbjct:   33 QEGEVRIKILYTSLCHTDLFHLLESTDNKGF---PTILGHEAAGVVESVGPGVTEFKPGDKVIPNSGCQCRECKFCKSPRTNLCERSWVNDHIEYMSYPKTSFTCRGKPILQFTNTGTLAEYIVIRQIYVVKIDDDAPLDRVCLLGCGVTTGYGAAVNSAGVTPGSVCAVFGLGAVGLAAVMGCKNAGASRIFAVDINEKKFEKAKVFGATDFLNPK--AYNKPISEVLIEMTNGGVDFSLECVGNTEVSRLALESCAKGWGLSVLVGYTNTDFSSKPIQLIYGKTWKGTLLGGFKIKDGVPKLVLDYMSGKIMLDEFITQRMKLEQVNDVVKLMKNGECIRCILDMSK 376          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Xenopus
Match: gata1 (GATA binding protein 1 [Source:Xenbase;Acc:XB-GENE-484636])

HSP 1 Score: 362.459 bits (929), Expect = 1.343e-122
Identity = 183/346 (52.89%), Postives = 246/346 (71.10%), Query Frame = 1
Query:   67 NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
            NLS V+        E R +P     N+VLLK+ +VGICGSDVHYW +GRIGDF+V+KP++LGHE S  V+K G +V++LK GDRVAIEPGVP    + C  GRYNL   + F ATPP DG LC+Y TH  +FC+KL DN++ EEGALIEPLSV +HACRR  VTLGS+V I GAG IGLV+LLVAK +GA  +V+ D++  RL+ AKELGA FV+ +  +   E I  K+++ +  + + TIEC+GA + +   I AT SGG +++VG+G  +V  P++NA +REVDIRG+FRY N +P A+S++S KR+NVAPL+T  FP   A +AF+  + G GVK+M++  K
Sbjct:   13 NLSVVVHGIGDLRLENRPVPE-PGPNEVLLKMHSVGICGSDVHYWQHGRIGDFIVKKPMVLGHEASGTVVKVGASVSHLKPGDRVAIEPGVPRETDEFCKMGRYNLSPTIFFCATPPDDGNLCRYYTHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSRVFICGAGPIGLVSLLVAKMMGASQVVISDLSLPRLEKAKELGADFVVQVTTEA-PEVIAQKVEKLLGIMPEITIECTGAESCIQAGIYATRSGGTLILVGLGPAMVNVPIVNAAVREVDIRGIFRYCNTWPMAISMLSSKRVNVAPLVTHRFPLENAAEAFETTKKGMGVKVMLKCDK 356          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Xenopus
Match: psmd12 (proteasome 26S subunit, non-ATPase 12 [Source:Xenbase;Acc:XB-GENE-970352])

HSP 1 Score: 107.457 bits (267), Expect = 4.119e-25
Identity = 109/371 (29.38%), Postives = 166/371 (44.74%), Query Frame = 1
Query:   79 VLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLC----------------------SKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAV-HACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAP---VVQAPLLNALIREV--DIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEV 1098
            + ++   F  EE ++      N+V +KI+  GIC SD H  I G++    V+ P+ILGHE   +V   G++V ++K GDRV I   VP C +C  C + R N+C                       K I+H       T  +Y    E    K+    S +   LI    S     A     V  GS   I G G IGL  ++  K  GA  I+ VD+N  +  +AKELGA   I+ K D D + +   I E   G VD   EC       L    ++  + G  VIVG+ AP   +   P++    R +   + G ++  N  P  +S    K+ ++  L+T   P N+  + F L+RSG+ ++ ++ V
Sbjct:   15 IWEKSAPFSIEEVEVAP-PKANEVRIKIVATGICRSDDHA-IEGKLS--TVKFPVILGHEGVGIVESTGESVKHIKPGDRV-IPLFVPQCGQCICCKDPRSNMCIAGKMKKAVGLMSDGTSRFTCKGKQIYHFMN--TSTFTEYTVAEEMSVAKIDSGASLDNTCLIGCGFSTGYGSALNSAKVHPGSTCAIFGLGGIGLAVIMGCKIAGAARIIGVDINPDKFNIAKELGATECINPK-DYD-KPVPQVILEQTGGGVDYAFECVGHIETMLAALNSSHFAYGTTVIVGVSAPDSTISFDPMILLTGRTIKGSVFGGWKSKNSVPQLVSDSLAKKFDLEKLVTHRLPLNKINEGFDLLRSGKSIRTILLV 376          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Xenopus
Match: psmd12 (proteasome 26S subunit, non-ATPase 12 [Source:Xenbase;Acc:XB-GENE-970352])

HSP 1 Score: 104.76 bits (260), Expect = 3.570e-24
Identity = 108/363 (29.75%), Postives = 161/363 (44.35%), Query Frame = 1
Query:   79 VLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLC----------------------SKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAV-HACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAP---VVQAPLLNALIREV--DIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGE 1074
            + ++   F  EE ++      N+V +KI+  GIC SD H  I G++    V+ P+ILGHE   +V   G++V ++K GDRV I   VP C +C  C + R N+C                       K I+H       T  +Y    E    K+    S +   LI    S     A     V  GS   I G G IGL  ++  K  GA  I+ VD+N  +  +AKELGA   I+ K D D + +   I E   G VD   EC       L    ++  + G  VIVG+ AP   +   P++    R +   + G ++  N  P  +S    K+ ++  L+T   P N+  + F L+RSG+
Sbjct:   21 IWEKSAPFSIEEVEVAP-PKANEVRIKIVATGICRSDDHA-IEGKLS--TVKFPVILGHEGVGIVESTGESVKHIKPGDRV-IPLFVPQCGQCICCKDPRSNMCIAGKMKKAVGLMSDGTSRFTCKGKQIYHFMN--TSTFTEYTVAEEMSVAKIDSGASLDNTCLIGCGFSTGYGSALNSAKVHPGSTCAIFGLGGIGLAVIMGCKIAGAARIIGVDINPDKFNIAKELGATECINPK-DYD-KPVPQVILEQTGGGVDYAFECVGHIETMLAALNSSHFAYGTTVIVGVSAPDSTISFDPMILLTGRTIKGSVFGGWKSKNSVPQLVSDSLAKKFDLEKLVTHRLPLNKINEGFDLLRSGK 374          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Xenopus
Match: nkx2-1 (NK2 homeobox 1 [Source:Xenbase;Acc:XB-GENE-485985])

HSP 1 Score: 102.064 bits (253), Expect = 3.704e-23
Identity = 106/350 (30.29%), Postives = 160/350 (45.71%), Query Frame = 1
Query:  100 FDFEERKIPTIEDENDVLLKILTVGICGSDVH-YWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLCSKV--IFHATPP-----------FDGT--LCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAVHAC-RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGM-----GAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGE 1074
            F  EE ++    D ++V +KI+  G+C +D H    + + G F    P+ILGHE + +V   G  VT +K GD+V I   +P C  C+ C+N + NLC K+   F A              F GT    +Y    E    K+ D    E+  LI    S    A      V  GS   + G G +GL  ++  K+ GA  I+ +D+N  + + A ELGA   I+ K D D + I   I E   G VD +IEC G  + +  A+  T  G G   IVG+     G PV    LL     +    G ++  +  P  +      + ++  L+T   PF++  +AF L+R G+
Sbjct:   21 FSIEEIEVAPPRD-HEVRVKIVATGVCRTDAHAVSTHFKEGLF----PVILGHEGAGIVESVGPGVTRVKPGDKV-IPLYIPQCGECKFCLNPKTNLCEKISRFFKANSSRFTCKGKQIYHFMGTSTFSEYTVCAETSVAKIDDAAPLEKVCLIGCGFSTGYGAAINTAKVEPGSSCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSDKFEKALELGATECINPK-DYD-KPIQQVISEMTGGGVDFSIECIGIIDVMVTALECTTVGWGTCAIVGVSLDEHGLPVAPFHLLMGRTLKATFFGGWKSVDNVPKLVEDYLGNKFDLDSLVTFTLPFDKINEAFDLMRDGK 362          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Xenopus
Match: bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:Xenbase;Acc:XB-GENE-987855])

HSP 1 Score: 99.3673 bits (246), Expect = 2.719e-22
Identity = 92/354 (25.99%), Postives = 149/354 (42.09%), Query Frame = 1
Query:  130 IEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLC----------------------SKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIE---PLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSK-IKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGMGAPVVQAP-----LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMI 1092
            +   ++V +K++  GIC +D H       G   ++ P+ILGHE + ++   G+ VT LK GD+V I   +P C +C  C+N   N C                       K  +H    +  T  +Y   P D   K+ D +  ++  L     P            V  GS   + G G IGL  ++  KS GA  I+ VD+N  +  +AK  GA   I   N LD  + + + I E  NG V  + EC G  + +  A+     G G  VI+G      Q       L      +  I G ++     P  +      + N+  L++   PF++  + F+L+RSG  ++ ++
Sbjct:   31 VPKASEVRIKMVATGICRTDDHVLKGALKG---IDFPVILGHEGAGIIESVGEGVTGLKPGDKV-IPLCIPQCGKCSSCLNPNTNCCLKTHLSESQNVMPDKTSRFLCKGKAAYHFL--WTSTFSEYTVVPVDAVAKIDDRVPMDKACLFGCGFPTGYGA-VVNTAKVEPGSTCAVFGLGGIGLSAVIGCKSAGAAIIIAVDINSAKFDIAKVFGATECI---NPLDYSKPIQEVITEMTNGGVHYSFECIGNTDTMKAALECCHMGYGTSVIIGEAPSAAQISFDPILLFTGRTWKGSIFGGWKSKESVPRLVDEFMANKFNLDGLVSHTLPFDQINEGFELLRSGNSIRTIL 374          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Mouse
Match: Sord (sorbitol dehydrogenase [Source:MGI Symbol;Acc:MGI:98266])

HSP 1 Score: 352.443 bits (903), Expect = 8.295e-119
Identity = 181/343 (52.77%), Postives = 243/343 (70.85%), Query Frame = 1
Query:   67 NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            NLS V+        E   IP +   NDVLLK+ +VGICGSDVHYW +GRIGDFVV+KP++LGHE +  V K G+ V +LK GDRVAIEPGVP    + C  GRYNL   + F ATPP DG LC++  H  DFC+KL D+++ EEGALIEPLSV ++ACRRG+V+LG+KVL+ GAG +G+V LLVAK++GA  +VV D++  RL  AKE+GA F I +  +   +EI SK++  +    + TIEC+GA + +   I AT SGG +VIVGMGA +V  PL++A IREVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+K+MI+
Sbjct:    9 NLSLVVHGPGDIRLENYPIPEL-GPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKE-TPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIK 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Mouse
Match: Adh6a (alcohol dehydrogenase 6A (class V) [Source:MGI Symbol;Acc:MGI:1916367])

HSP 1 Score: 105.531 bits (262), Expect = 1.531e-24
Identity = 93/348 (26.72%), Postives = 153/348 (43.97%), Query Frame = 1
Query:  139 ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--------VIFHATPPFD------------GTLCQYITHPEDFCFKLSDNLSNEEGALIE---PLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGL-VDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPL-LNALIREVDIRGV----FRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMI 1092
              +V +K+++ GICGSD H       G+ VV  P+I GHE + +V   G  V ++K GD+V I     CR C  C++ + N C K        V+   T  F              +  +Y   PE    K+ D    ++  LI    P      A     VT GS  ++ G G +G   ++  K+ GA  I+ VD+NE +   A+ LG   V    N    E+ V ++   + G+ VD   E        +    +   S G  +I G+     Q  L    ++    ++GV    ++  +C P  ++   Q +IN+ PL+T   PFN+  +A +L  SG+ ++ ++
Sbjct:   34 SGEVRIKMISSGICGSDDHVLK----GELVVNFPLIPGHEGAGIVESVGDGVCSMKPGDKVLILIIPQCRECDACLHPKGNFCYKQDVLPCSGVMLDGTSRFSCRGQKIYHSFRTSSFTEYTVVPEIAAVKIDDAAPMDKVCLISCGFPTGYGA-AVNSAKVTPGSTCVVFGLGGVGSAIVMGCKASGASRIIGVDINEEKFPRARALG---VTDCLNPNKLEKPVQEVVMEMTGVGVDFAFEAIGLVDTMVAAWNSCNNSYGVCLIAGLAPSDAQLSLEAPKILSGKTLKGVCLGDYKTRDCIPQIVTDYLQNKINIDPLVTYQLPFNQLHEALELFHSGKAIRCVL 373          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Mouse
Match: Adh6a (alcohol dehydrogenase 6A (class V) [Source:MGI Symbol;Acc:MGI:1916367])

HSP 1 Score: 103.605 bits (257), Expect = 6.852e-24
Identity = 93/342 (27.19%), Postives = 149/342 (43.57%), Query Frame = 1
Query:  139 ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--------VIFHATPPFD------------GTLCQYITHPEDFCFKLSDNLSNEEGALIE---PLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGL-VDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPL-LNALIREVDIRGV----FRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGE 1074
              +V +K+++ GICGSD H       G+ VV  P+I GHE + +V   G  V ++K GD+V I     CR C  C++ + N C K        V+   T  F              +  +Y   PE    K+ D    ++  LI    P      A     VT GS  ++ G G +G   ++  K+ GA  I+ VD+NE +   A+ LG   V    N    E+ V ++   + G+ VD   E        +    +   S G  +I G+     Q  L    ++    ++GV    ++  +C P  ++   Q +IN+ PL+T   PFN+  +A +L  SG+
Sbjct:   34 SGEVRIKMISSGICGSDDHVLK----GELVVNFPLIPGHEGAGIVESVGDGVCSMKPGDKVLILIIPQCRECDACLHPKGNFCYKQDVLPCSGVMLDGTSRFSCRGQKIYHSFRTSSFTEYTVVPEIAAVKIDDAAPMDKVCLISCGFPTGYGA-AVNSAKVTPGSTCVVFGLGGVGSAIVMGCKASGASRIIGVDINEEKFPRARALG---VTDCLNPNKLEKPVQEVVMEMTGVGVDFAFEAIGLVDTMVAAWNSCNNSYGVCLIAGLAPSDAQLSLEAPKILSGKTLKGVCLGDYKTRDCIPQIVTDYLQNKINIDPLVTYQLPFNQLHEALELFHSGK 367          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Mouse
Match: Adh6b (alcohol dehydrogenase 6B (class V) [Source:MGI Symbol;Acc:MGI:2446626])

HSP 1 Score: 93.9745 bits (232), Expect = 1.775e-20
Identity = 91/350 (26.00%), Postives = 155/350 (44.29%), Query Frame = 1
Query:  142 NDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--VIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVA------------VHAC----------RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGL-VDKTIEC-SXXXXXXXXXXXXXXSGGCVVIVGM---GAPVVQAP--LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEV 1098
             +V +KI+  GICG+D H       G      P+ILGHE + VV   G  VT +K GD+V + P   CR C  C+  + N C K  ++       DGT     T      + +    +  E  ++  ++VA            + +C              VT GS  ++ G G IG   ++  K+ GA  I+ VD+NE +   A+ LG   V    N    ++ V ++ + + G+ VD   E        +    +   S G  VI+G+   G+ +   P  LL     +  + G ++  +  P  ++   QK+IN+ PLIT   PF +  + F+L++ G+ ++ ++ +
Sbjct:   42 GEVRVKIIASGICGTDNHTLE----GKMKTPFPVILGHEGAGVVESVGPGVTTVKPGDKVLMFPLPECRECFYCLYPKGNFCEKENILSPTGLMLDGT--SRFTCRGKKIYNIMGTSTFTEYTVVHEIAVAKIEAAAPMDTVCIMSCAVPTGFGAVFNTAQVTPGSSCVVFGLGGIGSAIVMACKASGACRIIGVDINEEKFPRARALG---VTDCLNPNKLKKPVQEVVKEMTGVGVDFAFEAIGLIETMVAALKSCNRSYGVCVIMGVAPTGSQLSFDPLVLLPGRTLKSSVLGGYKTRDDIPKLVTDYVQKKINIDPLITHRLPFPKINEGFRLLQEGKCIRCVLSM 382          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Mouse
Match: Adh1 (alcohol dehydrogenase 1 (class I) [Source:MGI Symbol;Acc:MGI:87921])

HSP 1 Score: 92.8189 bits (229), Expect = 3.506e-20
Identity = 101/374 (27.01%), Postives = 166/374 (44.39%), Query Frame = 1
Query:   79 VLKQQNQFDFEERKIPTIED-------ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--------VIFHATPPFD------------GTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAV---HACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQ----APLLNALIREVD--IRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMI 1092
            V+K +    +E  K  TIED        ++V +K++  G+C SD H       G  V   P +LGHE + +V   G+ VT +K GD+V       C  C++C +   N CS+         +   T  F              T  QY T  +D      D  S  +   +     +     A +   VT GS   + G G +GL  ++  K+ GA  I+ VD+N+ +   AKELGA   I+ ++   ++ I   ++E  +G VD + E  G  + +  A+ +  +   V +V    P  Q     P+L  L R     I G F+  +  P  ++    K+  + PLIT + PF +  +AF L+RSG+ ++ ++
Sbjct:    7 VIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVS----GTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHNFISTSTFSQY-TVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDKFAKAKELGATECINPQD--YSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEAFDLLRSGKSIRTVL 373          
BLAST of Sorbitol dehydrogenase-like protein vs. UniProt/SwissProt
Match: sp|P0DMQ6|DHSO_CHICK (Sorbitol dehydrogenase OS=Gallus gallus OX=9031 GN=SORD PE=1 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 1.135e-123
Identity = 179/346 (51.73%), Postives = 246/346 (71.10%), Query Frame = 1
Query:   58 SSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            +  NL+ V+ +      E R IP     N+VLL++ +VGICGSDVHYW +GRIGDFVV+ P++LGHE S  VIK G  VT+LK GDRVAIEPGVP    + C  GRYNL   + F ATPP DG LC+Y  H   +C+KL D+++ EEGALIEPLSV +HAC+R  VTLGS+V + G+G IGLVN+++AK +GA ++VV D++  RLQ AKELGA F I IKN+   +E+ +K++  +  + + T+EC+G    +  +I AT SGG +V+VG+G  +V  P++NA +REVDIRG+FRY N +P A+SL++ KRIN+ PL+T  FP  +A +AF+  + GEGVKIM++
Sbjct:    4 TGQNLAVVVHRAGDLRLENRPIPE-PGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVVKDPMVLGHEASGTVIKVGAGVTHLKPGDRVAIEPGVPRETDEFCKTGRYNLSPTIFFCATPPDDGNLCRYYKHSASYCYKLPDSVTFEEGALIEPLSVGIHACKRAGVTLGSRVFVSGSGPIGLVNVIIAKMMGAAAVVVTDLSASRLQTAKELGADFTIQIKNE-TPQEVAAKVESLLGCMPEITVECTGVQACIQASIYATRSGGTLVLVGLGPEMVTVPIVNAAVREVDIRGIFRYCNTWPVAISLLASKRINIKPLVTHRFPLEKALEAFETTKRGEGVKIMLK 347          
BLAST of Sorbitol dehydrogenase-like protein vs. UniProt/SwissProt
Match: sp|Q64442|DHSO_MOUSE (Sorbitol dehydrogenase OS=Mus musculus OX=10090 GN=Sord PE=1 SV=3)

HSP 1 Score: 352.443 bits (903), Expect = 5.802e-118
Identity = 181/343 (52.77%), Postives = 243/343 (70.85%), Query Frame = 1
Query:   67 NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            NLS V+        E   IP +   NDVLLK+ +VGICGSDVHYW +GRIGDFVV+KP++LGHE +  V K G+ V +LK GDRVAIEPGVP    + C  GRYNL   + F ATPP DG LC++  H  DFC+KL D+++ EEGALIEPLSV ++ACRRG+V+LG+KVL+ GAG +G+V LLVAK++GA  +VV D++  RL  AKE+GA F I +  +   +EI SK++  +    + TIEC+GA + +   I AT SGG +VIVGMGA +V  PL++A IREVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+K+MI+
Sbjct:    9 NLSLVVHGPGDIRLENYPIPEL-GPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKE-TPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIK 349          
BLAST of Sorbitol dehydrogenase-like protein vs. UniProt/SwissProt
Match: sp|P27867|DHSO_RAT (Sorbitol dehydrogenase OS=Rattus norvegicus OX=10116 GN=Sord PE=1 SV=4)

HSP 1 Score: 347.051 bits (889), Expect = 7.787e-116
Identity = 176/343 (51.31%), Postives = 240/343 (69.97%), Query Frame = 1
Query:   67 NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            NLS V+        E   IP +   NDVLLK+ +VGICGSDVHYW +GRIGDFVV+KP++LGHE +  V K G  V +LK GDRVAIEPGVP    + C  GRYNL   + F ATPP DG LC++  H  DFC+KL D+++ EEGALIEPLSV ++ACRRG+V+LG+KVL+ GAG IG+V LLVAK++GA  +VV+D++  RL  AKE+GA F I +  +    +I  K++  +    + TIEC+GA + +   I AT SGG +V+VGMG  ++  PL++A +REVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+K+MI+
Sbjct:    9 NLSLVVHGPGDIRLENYPIPEL-GPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGPMVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPSIFFCATPPDDGNLCRFYKHSADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPIGIVTLLVAKAMGASQVVVIDLSASRLAKAKEVGADFTIQVAKE-TPHDIAKKVESVLGSKPEVTIECTGAESSVQTGIYATHSGGTLVVVGMGPEMINLPLVHAAVREVDIKGVFRYCNTWPMAVSMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGLGLKVMIK 349          
BLAST of Sorbitol dehydrogenase-like protein vs. UniProt/SwissProt
Match: sp|Q58D31|DHSO_BOVIN (Sorbitol dehydrogenase OS=Bos taurus OX=9913 GN=SORD PE=1 SV=3)

HSP 1 Score: 346.665 bits (888), Expect = 1.189e-115
Identity = 175/343 (51.02%), Postives = 236/343 (68.80%), Query Frame = 1
Query:   67 NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            NLS V+        E   IP     N+VLLK+ +VGICGSDVHYW +GRIGDFVV+KP++LGHE S  V+K G  V +L+ GDRVAIEPG P    + C  GRYNL   + F ATPP DG LC++  H  +FC+KL DN++ EEGALIEPLSV +HACRR  VTLG+KVL+ GAG IGLV+LL AK++GA  +VV D++  RL  AKE+GA F++ I N+   +EI  K++  +    + TIEC+G    +   I AT SGG +V+VG+G+ +   PL++A  REVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+K+MI+
Sbjct:    8 NLSLVVHGPGDLRLENYPIPE-PGPNEVLLKMHSVGICGSDVHYWQHGRIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVSLLAAKAMGAAQVVVTDLSASRLSKAKEVGADFILQISNE-SPQEIAKKVEGLLGSKPEVTIECTGVETSIQAGIYATHSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYCNTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMIK 348          
BLAST of Sorbitol dehydrogenase-like protein vs. UniProt/SwissProt
Match: sp|P07846|DHSO_SHEEP (Sorbitol dehydrogenase OS=Ovis aries OX=9940 GN=SORD PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 3.404e-115
Identity = 176/346 (50.87%), Postives = 238/346 (68.79%), Query Frame = 1
Query:   58 SSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            ++ NLS V+        E   IP     N+VLLK+ +VGICGSDVHYW  GRIGDFVV+KP++LGHE S  V+K G  V +L+ GDRVAI+PG P +  + C  GRYNL   + F ATPP DG LC++  H  +FC+KL DN++ EEGALIEPLSV +HACRR  VTLG+KVL+ GAG IGLVNLL AK++GA  +VV D++  RL  AKE+GA F++ I N+   EEI  K++  +    + TIEC+G    +   I AT SGG +V+VG+G+ +   PL++A  REVDI+GVFRY N +P A+S+++ K +NV PL+T  FP  +A +AF+  + G G+K+MI+
Sbjct:    4 AAENLSLVVHGPGDLRLENYPIPE-PGPNEVLLKMHSVGICGSDVHYW-QGRIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIQPGAPRQTDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVNLLAAKAMGAAQVVVTDLSASRLSKAKEVGADFILEISNE-SPEEIAKKVEGLLGSKPEVTIECTGVETSIQAGIYATHSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYCNTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMIK 346          
BLAST of Sorbitol dehydrogenase-like protein vs. TrEMBL
Match: A0A481SZM9 (Alcohol dehydrogenase OS=Folsomia candida OX=158441 PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 5.019e-130
Identity = 195/350 (55.71%), Postives = 258/350 (73.71%), Query Frame = 1
Query:   52 GMSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIE 1095
            G +  NL+ +L +Q     E R +P   D+ +VLL++ +VGICGSDVHYW NGRIGDF+V+ P+I+GHE + VV KCGKNV +LK GDRVAIEPGVPCRRC  C  GRYNLC  ++F ATPP  G LC+Y TH   FC+KL D+++ EEGAL+EPLSV VHACRR  VTLGS VLI GAG IGLV+LLVA+S+GA  I+V D+ E RLQVAKELGA  V+ +      +++  ++++ +  + + +IECSGA + + LAI +TISGGCV++VG+GAP V+ P++NA +REVDIRGVFRYANCYPAAL+L++  +++V  LIT  F   E   AF+  ++G G  +K+MI 
Sbjct:    3 GGADDNLTAILYKQGDLRLENRPVPEPNDD-EVLLRMASVGICGSDVHYWTNGRIGDFIVKAPMIIGHEAAGVVTKCGKNVKHLKPGDRVAIEPGVPCRRCDSCKYGRYNLCPDIVFCATPPCHGNLCRYYTHDAAFCYKLPDHVTIEEGALLEPLSVGVHACRRAGVTLGSVVLICGAGPIGLVSLLVARSMGASKIIVSDLAENRLQVAKELGADLVLKVDPSASGQDLALQVEQTLGVMPNISIECSGAESSIRLAILSTISGGCVLLVGLGAPEVKLPVVNAAVREVDIRGVFRYANCYPAALALVATGKVDVKKLITHRFKLEETLQAFETAKTGAGGAIKVMIS 351          
BLAST of Sorbitol dehydrogenase-like protein vs. TrEMBL
Match: A0A481SZ37 (Alcohol dehydrogenase (Fragment) OS=Brunneria borealis OX=1603012 PE=2 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 4.882e-129
Identity = 197/349 (56.45%), Postives = 252/349 (72.21%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIE 1095
            M++ NL+ VL + N    E+R IP    E+ VLLK+  VGICGSDVHY + GRIGDF+V++P+I+GHE S +V K GKNVTNLKEGDRVAIEPGVPCR C+ C  GRYNLC  +IF ATPP  G L +Y  H  DFC+KL DN+S EEGAL+EPLSV VHACRRG V LGS VLI GAG IGLV L+ AK++GA  +++ D+ + RL VAK++GA   + +  + + E+ V K+   +NG  D +I+CSGA + + LAI  T SGG  V+VGMGAP V+ PL+NAL+REVDI+G+FRY N YP ALS+++  R+NV  LIT  FP  E   AF++ +SGEG  +KIMI 
Sbjct:   34 MATDNLTAVLYKVNDLRLEQRPIPE-PAEDQVLLKMACVGICGSDVHYLVKGRIGDFIVKEPMIMGHEASGIVAKVGKNVTNLKEGDRVAIEPGVPCRMCKFCKEGRYNLCPDIIFCATPPSHGNLSRYYVHAADFCYKLPDNVSLEEGALLEPLSVGVHACRRGGVALGSTVLITGAGPIGLVTLITAKAMGAAKVLITDIVQHRLDVAKKMGADETLLVGTNENVEDTVKKVHSLLNGEPDISIDCSGAESTIKLAILGTRSGGTAVVVGMGAPEVKIPLVNALVREVDIKGIFRYVNEYPIALSMVASGRVNVKQLITHNFPLEETLKAFEVAKSGEGNPIKIMIH 381          
BLAST of Sorbitol dehydrogenase-like protein vs. TrEMBL
Match: A0A481SZ34 (Alcohol dehydrogenase OS=Thermobia domestica OX=89055 PE=2 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 6.749e-128
Identity = 199/350 (56.86%), Postives = 255/350 (72.86%), Query Frame = 1
Query:   55 MSST--NLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMI 1092
            MS+T  NLS +L ++N    E+R IP  +D+ +VLLK+ +VGICGSDVHY +NG IGDFVV  P++LGHE S +V K GKNVTNLKEGDRVAIEPGVPCR C+ C +G+YNLC  VIF ATPP DG LC+Y TH  DFC+KL D++S EEGAL+EPLSV VHACRR  +TLGS VL+ GAG IGLV+LL AK++GA  +++ D+   RL+VAKE+GA   + +   + TEE   +I++ +    DKTIECSGA   + LAI AT SGG +V+VG+G P V  PL+NA  RE+DIRGVFRYAN YP ALS+++  ++NV  LIT  F   E   A++  R+G G  +K+MI
Sbjct:    1 MSATTDNLSAILYKKNDLRLEQRPIPEPKDD-EVLLKMHSVGICGSDVHYLVNGAIGDFVVRSPMVLGHEASGIVAKVGKNVTNLKEGDRVAIEPGVPCRYCKFCKDGKYNLCPDVIFCATPPIDGNLCRYYTHAADFCYKLPDHVSLEEGALLEPLSVGVHACRRAGITLGSVVLVTGAGPIGLVSLLAAKAMGASRVIITDIVAHRLEVAKEIGADDTL-LMGKVSTEEAAQQIEKILGRQPDKTIECSGAEPCIQLAIQATESGGVIVLVGLGPPKVNVPLVNAACREIDIRGVFRYANDYPLALSMVASGKLNVKKLITHNFKLEETAQAYETARTGAGGAIKVMI 348          
BLAST of Sorbitol dehydrogenase-like protein vs. TrEMBL
Match: A0A443RM07 (Sorbitol dehydrogenase-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_13315 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 5.390e-127
Identity = 194/348 (55.75%), Postives = 247/348 (70.98%), Query Frame = 1
Query:   61 STNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
            S NLS VL ++      +  IP+    N+VLL   +VGICGSDVHYW+ GRIG +VV +PII+GHETSA V++ G+ V +LK GDRVAIEPGVPCR+C  C  G+YNLC+ + FHATPP +GTL +Y  H  DFCFKL DN+S EEGAL+EPLSVAV+AC+R  VT+GS VLI GAG IGLV+LL +K+ GA  + + D+NE+RLQ AK+LGA  ++++ N  +T EIV  +K+      D TIECSGA   + LAI AT SGGCV +VGMG   V  PLL+A  REVDIRG+FRY N YP AL L++  ++NV PLIT  F   E   AF+  ++GEG+K+MI   K
Sbjct:    4 SDNLSAVLFKKGDLRLVQTPIPSKPGNNEVLLATQSVGICGSDVHYWVEGRIGSYVVNEPIIMGHETSATVVEVGEGVQHLKPGDRVAIEPGVPCRKCNHCKVGKYNLCANIFFHATPPDNGTLTRYFKHAADFCFKLPDNVSFEEGALLEPLSVAVYACKRAGVTIGSNVLICGAGPIGLVSLLASKAFGASRVCITDINEKRLQTAKDLGADCILNVINIKNTNEIVDCVKQCFGRSPDITIECSGAEASIKLAILATESGGCVQLVGMGPSEVTVPLLSACCREVDIRGIFRYRNSYPQALELVASGKVNVKPLITHRFTLEETLKAFETAKNGEGIKVMINCAK 351          
BLAST of Sorbitol dehydrogenase-like protein vs. TrEMBL
Match: A0A481SZ55 (Alcohol dehydrogenase OS=Isotomurus palustris OX=36144 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 1.968e-126
Identity = 198/351 (56.41%), Postives = 251/351 (71.51%), Query Frame = 1
Query:   52 GMSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHING-LVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIE 1095
            G +  NL+ +L +Q     E R IP  +D+ +VLL++  VGICGSDVHY   GRIGDF+V  P+I+GHE + +V KCGKNV NLK GDRVA+EPGVPCRRC  C  G+YNLC  V+F ATPP  G L +Y TH  D+CFKL D++S EEGAL+EPLSV V ACRR  VTLGS VLI GAG IGLV+LLVAKS+GA  IV+ D+   RL VAKELGA  V+ ++   D  E+  ++K  + G + + TIECSGA + + LAI AT SGGCVV+VG+G   V  P++NA +REVDIRGVFRYANCYPAAL+L++  ++NV  LIT  F   E  +AF+  R+G+G  +K+MI 
Sbjct:    2 GGTDDNLTAILYKQGDLRLENRPIPEPKDD-EVLLRMSAVGICGSDVHYLTKGRIGDFIVTSPMIIGHEAAGIVAKCGKNVKNLKIGDRVAVEPGVPCRRCDHCKTGQYNLCPDVVFCATPPVHGNLSRYYTHDADYCFKLPDHVSLEEGALLEPLSVGVQACRRAGVTLGSTVLICGAGPIGLVSLLVAKSMGAGKIVIADLAANRLAVAKELGADEVLTVEMSSDAAELAKQVKAKLGGEMPNVTIECSGAESMIKLAILATRSGGCVVLVGLGPAEVTIPVVNAAVREVDIRGVFRYANCYPAALALVASGKVNVKRLITHNFKLEETLEAFETARTGKGGAIKVMIH 351          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Cavefish
Match: sord (sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-1231])

HSP 1 Score: 306.605 bits (784), Expect = 2.134e-101
Identity = 171/350 (48.86%), Postives = 229/350 (65.43%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
            M + NLS VL  +                  VLL++ +VGICGSDVHYW NGRIGDFVV+KP++LGHE +  V K G  VT+LK   R   E          C +GRYNL   + F ATPP DG L +Y  H  +FC+KL DN+S EEGALIEPLSV +HACRR  VTLGS VL+ GAG IGLV LL AK++GA  +++ D++  RL  AKELGA F++ +K +   +E+  +++  + G+   +IEC+GA + +  AI AT SGG VV+VG+GA +   P+LNA +REVDIRGVFRY N +P A+++++ KR+NV PL+T  FP  +A  AF+  R G GVK+M++  K
Sbjct:    1 MDTDNLSVVLHAKGDLRL-------------VLLQMHSVGICGSDVHYWQNGRIGDFVVKKPMVLGHEAAGRVFKVGPGVTHLKPAPRDMDE---------FCKSGRYNLSPTIFFCATPPDDGNLSRYYIHNANFCYKLPDNVSYEEGALIEPLSVGIHACRRAGVTLGSSVLVCGAGPIGLVTLLAAKAMGASQVIISDLSADRLAKAKELGADFLLPVKREDTAQEMAKRVEGILGGMPHISIECTGAESCIQTAIYATRSGGVVVLVGLGAEMATVPILNAAVREVDIRGVFRYCNTWPVAIAMLASKRVNVMPLVTHRFPLEQAVQAFETSRQGLGVKVMLKCDK 328          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Cavefish
Match: sord (sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-1231])

HSP 1 Score: 144.821 bits (364), Expect = 1.790e-39
Identity = 77/161 (47.83%), Postives = 101/161 (62.73%), Query Frame = 1
Query:  109 EERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAG 591
            E+R IP     N+VL+++ +VGICGSDVH W +GR G  V +KP++LGHE S  V++ G  VT+L+ GDR AIEP VP    +   +GRY+L   + F+                  FC++L DN+S EEGALIE LSV +HACRR  VTLGS VL+  AG
Sbjct:   22 EQRPIPE-PGPNEVLIQMHSVGICGSDVHLWQDGRAGCSVGKKPMVLGHEGSGPVLRVGSGVTHLQPGDREAIEPAVPSEMDEYVKSGRYHLSPNIFFY------------------FCYRLPDNVSYEEGALIELLSVGIHACRRAGVTLGSSVLVCKAG 163          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Cavefish
Match: sord (sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-1231])

HSP 1 Score: 141.739 bits (356), Expect = 3.280e-38
Identity = 78/161 (48.45%), Postives = 101/161 (62.73%), Query Frame = 1
Query:  109 EERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAG 591
            E+R IP     N+VL+++ +VGICGSDVH W +GR G  V +KP++LGHE S  V++ G  VT+L+ GDR AIEP VP    +   +GRY+L   + F+      G LC+           L DN+S EEGALIE LSV +HACRR  VTLGS VL+  AG
Sbjct:   22 EQRPIPE-PGPNEVLIQMHSVGICGSDVHLWQDGRAGCSVGKKPMVLGHEGSGPVLRVGSGVTHLQPGDREAIEPAVPSEMDEYVKSGRYHLSPNIFFYFCYR-SGMLCKTRKKNGSLILILPDNVSYEEGALIELLSVGIHACRRAGVTLGSSVLVCKAG 180          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000031417.1 (alcohol dehydrogenase 1-like [Source:NCBI gene;Acc:103044566])

HSP 1 Score: 92.0485 bits (227), Expect = 5.842e-20
Identity = 95/352 (26.99%), Postives = 154/352 (43.75%), Query Frame = 1
Query:  136 DENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK-----VIFHATP----------PF-----DGTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAVHAC-RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVG------MGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
             +N++ LK++   IC SDV++   G+  D     P+++GHE + +V   G  VT  K GD+V       CR C+ C N + N+C K      +F  +P          P       G   +Y    +    K+ D+   +   L    +S    A      V  GS   + G G +GL  ++  K  GA  I+ VD+NE R + AK LGA   ++ K  L  + I   + E  NG VD ++EC G  + +  A+ + I G G  VI G        A  +Q  L+     +    G F+  +  P  +      RIN+   +T     ++  +A K++ +G  ++ +I V K
Sbjct:   33 QKNEIRLKVIAASICLSDVYHMYKGKPKDGF---PVVMGHEGAGIVESVGPGVTEFKPGDKVIPLYLSQCRDCKFCKNPKTNMCEKDWSGNQMFKQSPSEIRFTCRSKPLLQFMRTGIFSEYTIKNKIALVKVHDDAQLDRVFLFGCGVSTGYGAAINNAKVEPGSVCAVFGLGAVGLSAVMGCKHAGASRIIAVDINEERFEKAKILGATDFVNPK--LHQKPISEVLIEMTNGGVDYSVECVGQVDVMRSALESCIKGWGVSVIAGWTDLYDFSARPIQ--LIAGRTWKGTSFGGFKGKDDVPKLVLDHMAGRINLDVFVTHNMNLDQINEAIKMMMAGGCIRPVISVSK 377          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000018061.2 (alcohol dehydrogenase 1-like [Source:NCBI gene;Acc:103043775])

HSP 1 Score: 90.5077 bits (223), Expect = 1.605e-19
Identity = 91/379 (24.01%), Postives = 164/379 (43.27%), Query Frame = 1
Query:   79 VLKQQNQFDFEERKIPTIED-------ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVI-FHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVA-VH---------------------ACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVG------MGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
            V+K +    +E  K   IE+       ++++ +K++  G+C +D+++   G+ G      P +LGHE + VV   G  VT  K GD+V       C  C+ C + + NLC K    +  P   G + ++  H +    + +   +  E  ++  + +A +H                     A     V  GS   + G G +GL  ++  KS GA  I+ VD+NE + + AK  GA   ++ K     + I   + E  +G VD ++EC G    +  A+ + + G G  VIVG        A  +Q  L+        + G ++  +  P  +      RI +   +T      +  DA +L++SG+ ++ +I + K
Sbjct:    7 VIKCKAAVAWEPNKPLVIEEIEVAPPQKDEIRVKVVATGLCHTDLYHLFEGKEG-----FPTVLGHEGAGVVESVGPGVTEFKPGDKVIPLCASQCNECRFCKSSKTNLCEKSWSTNPCPTMAGPVTRFSCHGQPV-LQFACTSTFSEYTVMNKIDLAKIHDDAQLDRVCLLACGVSTGYGAAINSAKVQPGSVCAVFGLGAVGLAAVMGCKSAGASRIIAVDINEEKFEKAKIFGATDFVNPK--AHKKPISDVLIEMTDGGVDYSLECVGNVELMRSALESCVKGWGVSVIVGYTDLHDFAARPIQ--LIAGRTWTGSLLGGYKMKDDVPKLVLDHIAGRIKLDEFVTHTMNLEQINDAIELMKSGKCIRTIINMSK 375          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Sea Lamprey
Match: sord (sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-1231])

HSP 1 Score: 243.047 bits (619), Expect = 5.157e-79
Identity = 115/194 (59.28%), Postives = 144/194 (74.23%), Query Frame = 1
Query:  130 IEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVI 711
            +   N+VLLK+ +VGICGSDVHYW +GRIGDFV+++P++LGHE +  V   G +VT+L  GDRVAIEPGVP    + C NGRYNL   + F ATPP  G+LC+Y TH   FC+KL DN+S EEGAL+EPLSV +HACRR  V+LGS V I GAG IGLV LLVAK +GA  +V+ D++  RL  A+ELGA FV+
Sbjct:    3 VPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFVLQEPMVLGHEAAGTVCAVGTSVTHLVPGDRVAIEPGVPRENDEFCKNGRYNLSPSIFFCATPPDHGSLCRYYTHSASFCYKLPDNVSYEEGALVEPLSVGIHACRRAGVSLGSYVFICGAGPIGLVCLLVAKGMGAAKVVITDLSSERLAKARELGADFVL 196          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Yeast
Match: SOR1 (Sorbitol dehydrogenase; protein sequence is 99% identical to the Sor2p sorbitol dehydrogenase; expression is induced in the presence of sorbitol or xylose [Source:SGD;Acc:S000003920])

HSP 1 Score: 256.144 bits (653), Expect = 3.095e-82
Identity = 143/350 (40.86%), Postives = 211/350 (60.29%), Query Frame = 1
Query:   61 STNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIK--NDLDTEEIVSKIKEHING-LVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYA-NCYPAALSLISQKRINVAPLITKIFPFNEAEDA--FKLVRSGEGVKIMI 1092
            ++N + VL++      E+R IPTI+D + V L I   GICGSD+HY+ +G IG ++++ P++LGHE+S  V++ G  VT +K GDRVAIEPGVP R       GRYNLC  + F ATPP DGTL +Y   PEDF  KL + +S EEGA +EPLSV VH+ +   V  G+KV++ GAG +GL+   VA++ GA  ++ VDV + +LQ AK+ GA    +    +    +++   +++ + G   D   ECSGA   ++ A+  T  GG +V VGMG      P+     +E+ + G FRY+   Y  A++L++  ++NV PLIT  F F +A  A  + +   GE VK +I
Sbjct:    4 NSNPAVVLEKVGDIAIEQRPIPTIKDPHYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPIDGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Yeast
Match: SOR2 (Sorbitol dehydrogenase; protein sequence is 99% identical to the Sor1p sorbitol dehydrogenase [Source:SGD;Acc:S000002405])

HSP 1 Score: 253.832 bits (647), Expect = 2.285e-81
Identity = 142/350 (40.57%), Postives = 210/350 (60.00%), Query Frame = 1
Query:   61 STNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIK--NDLDTEEIVSKIKEHING-LVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYA-NCYPAALSLISQKRINVAPLITKIFPFNEAEDA--FKLVRSGEGVKIMI 1092
            ++N + VL++      E+R IPTI+D + V L I   GICGSD+HY+ +G IG ++++ P++LGHE+S  V++ G  VT +K GDRVAIEPGVP R       G YNLC  + F ATPP DGTL +Y   PEDF  KL + +S EEGA +EPLSV VH+ +   V  G+KV++ GAG +GL+   VA++ GA  ++ VDV + +LQ AK+ GA    +    +    +++   +++ + G   D   ECSGA   ++ A+  T  GG +V VGMG      P+     +E+ + G FRY+   Y  A++L++  ++NV PLIT  F F +A  A  + +   GE VK +I
Sbjct:    4 NSNPAVVLEKVGDIAIEQRPIPTIKDPHYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGSYNLCPHMAFAATPPIDGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Yeast
Match: XYL2 (Xylitol dehydrogenase; converts xylitol to D-xylulose; expression induced by xylose, even though this pentose sugar is not well utilized by S. cerevisiae; null mutant has cell wall defect [Source:SGD;Acc:S000004060])

HSP 1 Score: 251.521 bits (641), Expect = 1.985e-80
Identity = 136/334 (40.72%), Postives = 203/334 (60.78%), Query Frame = 1
Query:   61 STNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGL-VDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANC-YPAALSLISQKRINVAPLITKIFPFNEAEDAFK 1056
            +T  + VL++  +       IP I D N+V+++I   GICGSD+HY+ +GRI ++VVE P++LGHE+S +V   G+NV  LK GDRVA+EPG+P R       GRYNL   + F ATPPFDGTL +Y    +DF +KL D++S EEGALIEPLSVA+HA +   +  G++ ++ GAG IGL+   VA   GA  +V VD+ E +L+ A++ GA  +++  +      + S IK+ I     D   ECSGA   +   I    +GG +V VGMG   +Q P+     +E+  +G FRY    Y  ++ L+S +++++ P IT  + F +A +AF+
Sbjct:    5 TTQEAIVLERPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPFDGTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAIHANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVNSGDLPHGVTVDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQFPISIIPTKELTFQGCFRYCQGDYSDSIELVSSRKLSLKPFITHRYSFKDAVEAFE 338          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Yeast
Match: BDH1 (NAD-dependent (R,R)-butanediol dehydrogenase; catalyzes oxidation of (R,R)-2,3-butanediol to (3R)-acetoin, oxidation of meso-butanediol to (3S)-acetoin, and reduction of acetoin; enhances use of 2,3-butanediol as an aerobic carbon source [Source:SGD;Acc:S000000056])

HSP 1 Score: 119.013 bits (297), Expect = 3.212e-30
Identity = 77/249 (30.92%), Postives = 122/249 (49.00%), Query Frame = 1
Query:  124 PTIEDENDVLLKILTVGICGSDVHYWINGRI---GDFVVEK------PIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPC--------------RRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECS 801
            P I+ +++V++ +   GICGSD+H +++G I    D    K      P+ +GHE S +V K G  VT +K GD V ++    C              + C  C  G  NLC+   F       G   + +   +     +   +  +  AL+EPLSV  HA +      GS  L++GAG IGL  +LV K +GA  IVV ++ ERR+++AK+LG       K+   + EI+  + +  +G  D + +CS
Sbjct:   21 PEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEILRGLTKSHDGF-DYSYDCS 268          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Yeast
Match: BDH2 (Putative medium-chain alcohol dehydrogenase with similarity to BDH1; transcription induced by constitutively active PDR1 and PDR3 [Source:SGD;Acc:S000000057])

HSP 1 Score: 109.383 bits (272), Expect = 1.135e-26
Identity = 94/324 (29.01%), Postives = 148/324 (45.68%), Query Frame = 1
Query:  118 KIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEK-----------PIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCR--------------RCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHING--LVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGM-GAPVVQAPLLNALIREVDIRGVFRYANC-YPAALSLISQKRINV 1002
            K P I   +++++ I   GICG+D+H + +G I  F  E            P  +GHE +  V++ G  V NLK GD+V +EP   CR               C  C  G YN+CS +         G   + +   E  C+K+ D +  +  ALI+PL+V  HA R      GS  LIIGAG IGL  +L   + G   IVV +  + R ++A+++GA   ++       +E +  ++   +G    D T +CSG    LN AI      G  V + M G   +Q   ++  + E    G   Y +  + A +  + + RI++
Sbjct:   19 KEPHIVAPDELVIDIEWCGICGTDLHEYTDGPI--FFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNICSYLGLCGAGVQSGGFAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWHAIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGAR--VYDPTAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQCLTFRGTAVNLAMWGHHKIQFSPMDITLHERKYTGSMCYTHHDFEAVIEALEEGRIDI 338          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Nematostella
Match: EDO32810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU04])

HSP 1 Score: 340.887 bits (873), Expect = 2.195e-115
Identity = 168/315 (53.33%), Postives = 228/315 (72.38%), Query Frame = 1
Query:  166 TVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEG--VKIMIEVGK 1104
            TVGICGSDVHYW +G IGDFV+  P++LGHE+S V+   G+ V++LKEGDRVAIEPG PCR C  C  GRYNLC+K+ F ATPP+ G+LC+   H  DFC+KL D++S EEGAL+EPLSV VHAC R  +T+GS VL+ GAG IGLV LL AK+ GA  + + D++E RL+ A+ELGA + I +++  D  ++  K++E + G  D+T+EC+GA + ++  I AT SGG +VIVGMG   +  P+++AL REVDIRG+FRY NCYP AL++++  R+NV PLIT  F   E+  AF+  R+G G  +K++I   K
Sbjct:    3 TVGICGSDVHYWKHGCIGDFVLTAPMVLGHESSGVICAVGEGVSDLKEGDRVAIEPGTPCRTCSYCKKGRYNLCAKMNFCATPPYHGSLCRRYNHQADFCYKLPDHVSLEEGALLEPLSVGVHACNRAGITIGSNVLVCGAGPIGLVTLLTAKACGASKVAITDLDEGRLKKARELGADYTIKVESR-DGRDMARKVQE-LLGPADQTVECTGAESSIHTGIYATKSGGVLVIVGMGKSKITLPIVDALCREVDIRGIFRYVNCYPTALAMVASGRVNVKPLITHHFKLEESLQAFETSRTGAGGAIKVLIHCNK 315          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Nematostella
Match: EDO47765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY5])

HSP 1 Score: 87.8113 bits (216), Expect = 4.246e-19
Identity = 80/336 (23.81%), Postives = 147/336 (43.75%), Query Frame = 1
Query:   97 QFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPF--DGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGN-VTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGA--PVVQAPLLNALIREVDIRGVFRYANCYPAALSLIS--QKRINVAPLITKIFPFNEAEDAFKLVRSGEGVK 1083
            Q     R +P + + ++V++K+   GIC  D+        G+    K ++LGHE S VV   G +V N+  GDRV + P   C  C+ C  G+ + C K    +      +G   QY          +   +S ++ AL EP+S  +H   + +     SK+L+ G G  GL+ + +    G   + V++ +E+   +A  L   F I   + + T+ + +   ++     D  IEC+G +  +  AI     GG ++I G  A    V+      L +E+ I G       +  ++ L+    + ++   L   +F   + + A   ++ G  +K
Sbjct:   11 QLSVITRPVPHVSNPSEVIVKVAYSGICDRDLQI----LEGELPAAKCVVLGHEFSGVVSDVGSDVKNVSIGDRVVVNPNSSCNTCKACRRGQPHFCEKGGTGSAIGVWKNGGWTQYARVHAPNIHIVPPQVSLKQAALCEPISCVLHGLDKLHPAARDSKILVSGTGVTGLLWMCILHFHGYRRVTVIEFSEQWRMLAMGLSLGFKILHPDTVHTDLVEATQSQNNTWGFDVIIECTGLSVLVQSAIKWLGYGGKLLIFGSSAKDSEVKISPYEILHKEIQILGSSMNPFSFLHSVELVRDMSEYLDYEKLGISVFKLTDYQAALTKLKQGSVLK 342          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Nematostella
Match: EDO35781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKJ4])

HSP 1 Score: 78.9518 bits (193), Expect = 4.064e-16
Identity = 86/347 (24.78%), Postives = 143/347 (41.21%), Query Frame = 1
Query:   94 NQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATP---PFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTL-----GSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGM-----GAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIE 1095
            N      R  P ++   DV++KI    + G+D+H  + GRI      K IILGH+   +V + G +V ++  GDRV I P   C  C  C+ G+ +LC KV    T      +G   Q+          L   ++ E+    EP+S  +    RG   L      ++VLI GAG  GL+        G   +V+ +V + R ++A  L   F +   + L +E   +K  +      D  ++C+G       ++     GG +++ G       A +    LL   ++ +  +G           L  +    +    L  + F   E   A + +RSGE  K + E
Sbjct:   10 NHLSVITRPTPHVQSPRDVVVKIAYSAVSGTDLHV-LEGRID---CAKSIILGHQFVGIVKEIGADVQHVSVGDRVVINPLTSCGICDFCLKGQPHLC-KVEGKNTAIGIKRNGGWAQFCRLSAKNVIPLPHQVTFEQALFSEPMSCIL----RGWDLLVPLQTDAEVLICGAGNSGLLWASFLHFRGYREVVISEVLKGRQKIAHGLNFGFQLVTPDVLVSEARNAKQNDDQEWGFDVVVDCTGDPKCFEQSLQWLRQGGRLLLFGTCPRNANASINPNQLLQKELKIISYQGNSFTFTSGIQVLQDMGNHYLAFERLGVRTFQLQEYMAAIETMRSGEISKAVFE 347          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Medaka
Match: sord (sorbitol dehydrogenase [Source:NCBI gene;Acc:101165040])

HSP 1 Score: 338.191 bits (866), Expect = 2.377e-113
Identity = 181/350 (51.71%), Postives = 239/350 (68.29%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK 1104
            M+  NLS VL  +     E R +P     NDVLL++ +VGICGSDVHYW +GRIGDFV+ KP++LGHE +  V+K G  V +LK GDRVAIEPGVP    +   +GRYNL   + F ATPP DG LCQY TH  +FC+KL DN++ EEGALIEPLSV +HACRR  VT+GS VLI GAG IGLV LLVAK++GA  +V+ D+   RL  AKELGA F + +      +++  K+++ +      TIEC+GA + L  AI  T SGG VV+VG+GA +   PL+NA +REVDIRGVFRY N +P A+++++  ++NV PL+T  FP  +A  AF+  R G G+K+M++  K
Sbjct:    1 MAQENLSVVLHSKGDLRLENRPVPE-PGPNDVLLQMHSVGICGSDVHYWQHGRIGDFVLTKPMVLGHEAAGTVVKIGSQVKHLKVGDRVAIEPGVPREMDEFFKSGRYNLSPTIFFCATPPDDGNLCQYYTHSANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTIGSSVLICGAGPIGLVCLLVAKAMGASQVVITDLFPDRLAKAKELGADFQVTVSKSDSPQQLAKKVEDLLGVQPQITIECTGAESCLQTAIYGTRSGGVVVLVGLGAEMATVPLINAAVREVDIRGVFRYCNTWPMAIAMLASGKVNVKPLVTHRFPLEQAVQAFETTRQGLGIKVMLKCDK 349          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Medaka
Match: adh5 (class III alcohol dehydrogenase [Source:NCBI gene;Acc:100049398])

HSP 1 Score: 92.8189 bits (229), Expect = 4.558e-20
Identity = 92/353 (26.06%), Postives = 160/353 (45.33%), Query Frame = 1
Query:  142 NDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLCSKV----------------------IFHATPPFDGT--LCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAVHAC-RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGM---GAPVVQAP--LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVG 1101
            ++V +K+   G+C +D  Y ++G   + +   P+ILGHE +  V   G+ VT+ K GD V I   VP C  C+ C N + NLC K+                      IFH    F GT    +Y    +    K+++    ++  L+   +S    A      V  GS   + G G +GL  ++  K  GA+ I+ VD+N  + + AKE GA   ++ K+   ++ I   + E  +G VD + EC G    +  A+ A   G G  VI+G+   G  +   P  L+   + +    G ++     P  +     K++ V   +T   PF++  + F+L+ +G+ ++ ++  G
Sbjct:   92 HEVRIKLFATGVCHTDA-YTLSGSDPEGLF--PVILGHEGAGTVESVGEGVTSFKPGDTV-IPLYVPQCGECKFCKNPKTNLCQKIRVTQGQGLLPDKTSRFTCKGKQIFH----FMGTSTFSEYTVVADISLAKVNEKAPLDKVCLLGCGISTGYGAALNTAKVEPGSTCAVFGLGAVGLAAIMGCKVAGANRIIGVDINPEKFERAKEFGATEFVNPKD--HSKPIQEVLVEMTDGGVDYSFECIGNVQIMRAALEACHKGWGQSVIIGVAGAGQEISTRPFQLVTGRVWKGTAFGGWKSVESVPRLVEDYMNKKLKVDEFVTHTLPFDQINEGFELMHAGKSIRTVLTFG 434          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Medaka
Match: ENSORLT00000022084.2 (alcohol dehydrogenase 1 [Source:NCBI gene;Acc:101172875])

HSP 1 Score: 91.2781 bits (225), Expect = 1.078e-19
Identity = 88/349 (25.21%), Postives = 155/349 (44.41%), Query Frame = 1
Query:  136 DENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSK--VIFHATPPFD-----------------GTLCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAVHAC-RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVG------MGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEV 1098
            + ++V +KI+   +C +D+++   G   +     P ILGHE++ +V   G +VT  + GD+V       CR C+ C + + NLC K  +  H    F+                 G+  +Y+   +    K+      ++  LI   +S    A      V  GS   + G G +GL  ++  K  GA+ I+ VD N ++ + AK  GA   ++ K+    + I   + E  NG VD + EC G  + +  A+ +   G G  VIVG        A  +Q  L+     +  + G F+  +  P  +    QK+I V   IT      +  + F+L++SG+ ++ ++ V
Sbjct:   33 EADEVRIKIVATAVCHTDLYHLFEGTETELF---PTILGHESAGIVESVGSSVTEFQPGDKVIPLFINQCRECRFCRSPKTNLCDKGPIGAHDKLAFEKSRITCKGKKVLPFMGIGSFSEYVLMKQIAVAKIDPVAPLDKVCLIGCAISTGFGAAVNTAKVEAGSTCAVFGLGAVGLAAVMGCKFAGAERIIAVDTNPKKEEKAKVFGATDFVNPKD--HNKPINQVLAEMTNGGVDYSFECIGNVDVMRSALESCNPGWGVSVIVGWTNRHDFAARPIQ--LIVGRTWKGSLFGGFKSKDGVPEMVRAYLQKKIKVDEFITHSKTLAQVNEGFELMKSGQSIRTVLNV 374          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Medaka
Match: adh5 (class III alcohol dehydrogenase [Source:NCBI gene;Acc:100049398])

HSP 1 Score: 88.9669 bits (219), Expect = 1.145e-18
Identity = 99/387 (25.58%), Postives = 171/387 (44.19%), Query Frame = 1
Query:   40 FKY*GMSSTNLSFVLKQQNQFDFEERKIPTIED-------ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVP-CRRCQLCINGRYNLCSKV----------------------IFHATPPFDGT--LCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAVHAC-RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGM---GAPVVQAP--LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGV 1080
            F+  G +      V+K +    +E  K  +IE+        ++V +K+   G+C +D  Y ++G   + +   P+ILGHE +  V   G+ VT+ K GD V I   VP C  C+ C N + NLC K+                      IFH    F GT    +Y    +    K+++    ++  L+   +S    A      V  GS   + G G +GL  ++  K  GA+ I+ VD+N  + + AKE GA   ++ K+   ++ I   + E  +G VD + EC G    +  A+ A   G G  VI+G+   G  +   P  L+   + +    G ++     P  +     K++ V   +T   PF++  + F+L+ +G+ +
Sbjct:   51 FRPEGTNMETAGKVIKCKAAVAWEPGKPLSIEEVEVAPPKAHEVRIKLFATGVCHTDA-YTLSGSDPEGLF--PVILGHEGAGTVESVGEGVTSFKPGDTV-IPLYVPQCGECKFCKNPKTNLCQKIRVTQGQGLLPDKTSRFTCKGKQIFH----FMGTSTFSEYTVVADISLAKVNEKAPLDKVCLLGCGISTGYGAALNTAKVEPGSTCAVFGLGAVGLAAIMGCKVAGANRIIGVDINPEKFERAKEFGATEFVNPKD--HSKPIQEVLVEMTDGGVDYSFECIGNVQIMRAALEACHKGWGQSVIIGVAGAGQEISTRPFQLVTGRVWKGTAFGGWKSVESVPRLVEDYMNKKLKVDEFVTHTLPFDQINEGFELMHAGKSL 427          
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Medaka
Match: adh5 (class III alcohol dehydrogenase [Source:NCBI gene;Acc:100049398])

HSP 1 Score: 83.9593 bits (206), Expect = 2.243e-17
Identity = 84/335 (25.07%), Postives = 154/335 (45.97%), Query Frame = 1
Query:  142 NDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRC--QLCI---NGRYNLCSKVIFHATPPFDGT--LCQYITHPEDFCFKLSDNLSNEEGALIE-PLSVAVHAC-RRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGM---GAPVVQAP--LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVG 1101
            ++V +K+   G+C +D  Y ++G   + +   P+ILGHE +  V   G+ VT+ K G++ +      C R   Q  +     R+    K IFH    F GT    +Y    +    K+++    ++  L+   +S    A      V  GS   + G G +GL  ++  K  GA+ I+ VD+N  + + AKE GA   ++ K+   ++ I   + E  +G VD + EC G    +  A+ A   G G  VI+G+   G  +   P  L+   + +    G ++     P  +     K++ V   +T   PF++  + F+L+ +G+ ++ ++  G
Sbjct:   35 HEVRIKLFATGVCHTDA-YTLSGSDPEGLF--PVILGHEGAGTVESVGEGVTSFKPGEQPSATQSSRCTRTSGQGLLPDKTSRFTCKGKQIFH----FMGTSTFSEYTVVADISLAKVNEKAPLDKVCLLGCGISTGYGAALNTAKVEPGSTCAVFGLGAVGLAAIMGCKVAGANRIIGVDINPEKFERAKEFGATEFVNPKD--HSKPIQEVLVEMTDGGVDYSFECIGNVQIMRAALEACHKGWGQSVIIGVAGAGQEISTRPFQLVTGRVWKGTAFGGWKSVESVPRLVEDYMNKKLKVDEFVTHTLPFDQINEGFELMHAGKSIRTVLTFG 360          
BLAST of Sorbitol dehydrogenase-like protein vs. Planmine SMEST
Match: SMESG000042474.1 (SMESG000042474.1)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 349/351 (99.43%), Postives = 351/351 (100.00%), Query Frame = 1
Query:   55 MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGKV 1107
            MSSTN+SFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSGAANGLNLAIAATISGGCVVIVGMGAPVV+APLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGKV
Sbjct:    1 MSSTNMSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSGAANGLNLAIAATISGGCVVIVGMGAPVVKAPLLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGKV 351          
BLAST of Sorbitol dehydrogenase-like protein vs. Planmine SMEST
Match: SMESG000031416.1 (SMESG000031416.1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.097e-18
Identity = 92/352 (26.14%), Postives = 149/352 (42.33%), Query Frame = 1
Query:  139 ENDVLLKILTVGICGSDVHYWINGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRCQLCINGRYNLCS----------------------KVIFHATPPFDG--TLCQYITHPEDFCFKLSDNLSNEEGALIEPLSVAVH--ACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVVDVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSXXXXXXXXXXXXXXSG-GCVVIVGM---GAPVVQAP--LLNALIREVDIRGVFRYANCYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEV 1098
            + +V +KIL  G+C +D  Y ++G   + V   P++LGHE S +V   G+ V+++  GD V       CR C+ C N + NLCS                      K +FH    + G  T  +Y    E    K+S         L+       +  A     V  GS   + G G +GL  ++  K+ GA  I+ VD+N  +   AK+ GA   ++   D   +     I +  +G  D T EC G    +  A+ A   G G  VIVG+   G  +   P  L+     +    G ++  +  P  +    QK+I +   +T   P     DAF+L+  G+ ++ +I +
Sbjct:   36 KGEVRIKILHTGVCHTDA-YTLSGCDSEGVF--PVVLGHEGSGIVESVGQEVSSISPGDHVIPLYTPQCRNCKFCKNSKTNLCSLIRSTQGAGLMPDGTTRFTCKGKNLFH----YMGCSTFSEYTVVAEISLAKVSKEAPLNRICLLGCGITTGYGAAINTAKVEPGSVCAVWGLGAVGLAAIMGCKAAGASRIIGVDLNPDKFPYAKQFGATECLN-PLDFKDQPFQQVIIDLTDGGCDFTFECVGNIETMRCALEACHKGWGLSVIVGVAPSGKEISTRPFQLVTGRTWKGTAFGGYKSRDSVPKLVDDYMQKKIKIDEFVTHEMPLKSINDAFQLMHDGKSLRAVINI 379          
The following BLAST results are available for this feature:
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SORD5.714e-11551.31sorbitol dehydrogenase [Source:HGNC Symbol;Acc:HGN... [more]
SORD1.385e-11253.14sorbitol dehydrogenase [Source:HGNC Symbol;Acc:HGN... [more]
ADH1A1.930e-2427.95alcohol dehydrogenase 1A (class I), alpha polypept... [more]
ADH1C1.232e-2227.47alcohol dehydrogenase 1C (class I), gamma polypept... [more]
ADH1B7.826e-2226.93alcohol dehydrogenase 1B (class I), beta polypepti... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R04B5.55.333e-11448.86pep chromosome:WBcel235:V:10087480:10088998:1 gene... [more]
R04B5.64.558e-9646.97pep chromosome:WBcel235:V:10085281:10087313:1 gene... [more]
D2063.11.430e-1528.93pep chromosome:WBcel235:V:4327121:4328736:1 gene:W... [more]
H24K24.32.739e-1428.69Alcohol dehydrogenase class-3 [Source:UniProtKB/S... [more]
H24K24.34.992e-1428.40Alcohol dehydrogenase class-3 [Source:UniProtKB/S... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sodh-21.195e-12255.43gene:FBgn0022359 transcript:FBtr0082324[more]
Sodh-11.399e-11854.86gene:FBgn0024289 transcript:FBtr0081627[more]
Sodh-11.399e-11854.86gene:FBgn0024289 transcript:FBtr0339932[more]
CG48366.618e-3831.82gene:FBgn0270925 transcript:FBtr0083828[more]
CG48367.605e-3831.82gene:FBgn0270925 transcript:FBtr0083827[more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sord2.675e-11451.43sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
sord1.492e-7753.30sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adh8b3.190e-2226.07alcohol dehydrogenase 8b [Source:ZFIN;Acc:ZDB-GENE... [more]
adh8b3.190e-2226.07alcohol dehydrogenase 8b [Source:ZFIN;Acc:ZDB-GENE... [more]
adh8b3.190e-2226.07alcohol dehydrogenase 8b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata11.343e-12252.89GATA binding protein 1 [Source:Xenbase;Acc:XB-GENE... [more]
psmd124.119e-2529.38proteasome 26S subunit, non-ATPase 12 [Source:Xenb... [more]
psmd123.570e-2429.75proteasome 26S subunit, non-ATPase 12 [Source:Xenb... [more]
nkx2-13.704e-2330.29NK2 homeobox 1 [Source:Xenbase;Acc:XB-GENE-485985][more]
bpnt12.719e-2225.993'(2'), 5'-bisphosphate nucleotidase 1 [Source:Xen... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sord8.295e-11952.77sorbitol dehydrogenase [Source:MGI Symbol;Acc:MGI:... [more]
Adh6a1.531e-2426.72alcohol dehydrogenase 6A (class V) [Source:MGI Sym... [more]
Adh6a6.852e-2427.19alcohol dehydrogenase 6A (class V) [Source:MGI Sym... [more]
Adh6b1.775e-2026.00alcohol dehydrogenase 6B (class V) [Source:MGI Sym... [more]
Adh13.506e-2027.01alcohol dehydrogenase 1 (class I) [Source:MGI Symb... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DMQ6|DHSO_CHICK1.135e-12351.73Sorbitol dehydrogenase OS=Gallus gallus OX=9031 GN... [more]
sp|Q64442|DHSO_MOUSE5.802e-11852.77Sorbitol dehydrogenase OS=Mus musculus OX=10090 GN... [more]
sp|P27867|DHSO_RAT7.787e-11651.31Sorbitol dehydrogenase OS=Rattus norvegicus OX=101... [more]
sp|Q58D31|DHSO_BOVIN1.189e-11551.02Sorbitol dehydrogenase OS=Bos taurus OX=9913 GN=SO... [more]
sp|P07846|DHSO_SHEEP3.404e-11550.87Sorbitol dehydrogenase OS=Ovis aries OX=9940 GN=SO... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481SZM95.019e-13055.71Alcohol dehydrogenase OS=Folsomia candida OX=15844... [more]
A0A481SZ374.882e-12956.45Alcohol dehydrogenase (Fragment) OS=Brunneria bore... [more]
A0A481SZ346.749e-12856.86Alcohol dehydrogenase OS=Thermobia domestica OX=89... [more]
A0A443RM075.390e-12755.75Sorbitol dehydrogenase-like protein OS=Dinothrombi... [more]
A0A481SZ551.968e-12656.41Alcohol dehydrogenase OS=Isotomurus palustris OX=3... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sord2.134e-10148.86sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
sord1.790e-3947.83sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
sord3.280e-3848.45sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSAMXT00000031417.15.842e-2026.99alcohol dehydrogenase 1-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000018061.21.605e-1924.01alcohol dehydrogenase 1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sord5.157e-7959.28sorbitol dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SOR13.095e-8240.86Sorbitol dehydrogenase; protein sequence is 99% id... [more]
SOR22.285e-8140.57Sorbitol dehydrogenase; protein sequence is 99% id... [more]
XYL21.985e-8040.72Xylitol dehydrogenase; converts xylitol to D-xylul... [more]
BDH13.212e-3030.92NAD-dependent (R,R)-butanediol dehydrogenase; cata... [more]
BDH21.135e-2629.01Putative medium-chain alcohol dehydrogenase with s... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO328102.195e-11553.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477654.246e-1923.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357814.064e-1624.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sord2.377e-11351.71sorbitol dehydrogenase [Source:NCBI gene;Acc:10116... [more]
adh54.558e-2026.06class III alcohol dehydrogenase [Source:NCBI gene;... [more]
ENSORLT00000022084.21.078e-1925.21alcohol dehydrogenase 1 [Source:NCBI gene;Acc:1011... [more]
adh51.145e-1825.58class III alcohol dehydrogenase [Source:NCBI gene;... [more]
adh52.243e-1725.07class III alcohol dehydrogenase [Source:NCBI gene;... [more]
back to top
BLAST of Sorbitol dehydrogenase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000042474.10.000e+099.43SMESG000042474.1[more]
SMESG000031416.12.097e-1826.14SMESG000031416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027355 ID=SMED30027355|Name=Sorbitol dehydrogenase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1359bp
CAAAATTCCAAGTATCAAATAATTATTTCGACAGGTATTTTTAAATATTA
AGGCATGAGTTCCACGAATTTGTCTTTTGTTCTCAAACAACAGAATCAAT
TTGATTTCGAAGAAAGAAAGATACCCACTATTGAAGATGAAAATGATGTA
CTATTAAAAATTTTAACTGTCGGTATATGTGGATCTGATGTACATTATTG
GATCAATGGTCGAATAGGGGATTTTGTTGTCGAAAAACCTATAATATTAG
GTCATGAAACTTCTGCTGTTGTAATAAAATGTGGGAAAAATGTCACTAAT
TTGAAAGAAGGAGATCGAGTGGCTATTGAACCTGGAGTTCCATGTAGACG
ATGTCAATTATGCATCAACGGGCGATATAATTTGTGTTCAAAGGTTATAT
TTCATGCAACTCCTCCATTCGATGGAACATTATGCCAATATATCACTCAT
CCTGAAGACTTTTGTTTCAAATTATCTGATAATTTATCGAATGAAGAAGG
GGCACTTATTGAACCTTTATCTGTCGCAGTTCATGCTTGTAGACGAGGAA
ATGTTACGTTGGGATCTAAAGTTTTAATTATTGGAGCGGGTACCATAGGA
TTGGTTAATTTATTAGTTGCAAAGTCTTTGGGGGCAGATAGTATTGTGGT
TGTCGATGTTAACGAGCGCCGTCTTCAAGTAGCTAAAGAACTTGGAGCTG
CATTTGTTATTCATATTAAAAATGATTTGGACACTGAGGAAATAGTTAGC
AAAATAAAAGAGCATATTAATGGACTAGTTGATAAGACAATTGAATGTAG
TGGTGCCGCAAATGGTCTCAATTTAGCTATTGCAGCAACAATTTCAGGTG
GTTGTGTTGTCATTGTTGGAATGGGAGCTCCAGTTGTTCAAGCTCCTCTT
TTAAATGCTCTCATTCGGGAAGTTGATATTCGAGGAGTTTTTCGATATGC
TAATTGTTATCCGGCAGCTTTGTCATTAATTTCACAAAAGCGAATAAATG
TTGCCCCTTTGATCACTAAAATATTTCCTTTCAATGAAGCTGAAGATGCC
TTTAAGTTAGTTAGAAGTGGCGAAGGTGTGAAAATTATGATTGAAGTCGG
AAAAGTATGATCGGATGAATAATGAAATAGTTTTGTGTCCATGATTAATT
TATTAAAAAAACAATTTTTGATTAAATTTTCAATAAATCATTTATATAAA
AATGTAATATTTATATATTGTATAATATTGTGCTTATTGATCCAATATTG
TGATTAGATTTGTTTGATCTTGATAGAATTGTGAATATTCTTAAAGCGAT
AGACATCGGCATAACATAAAATAAACAAAATAACGTCTAAAATTTGTCAA
CGTTTAAAC
back to top

protein sequence of SMED30027355-orf-1

>SMED30027355-orf-1 ID=SMED30027355-orf-1|Name=SMED30027355-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=352bp
MSSTNLSFVLKQQNQFDFEERKIPTIEDENDVLLKILTVGICGSDVHYWI
NGRIGDFVVEKPIILGHETSAVVIKCGKNVTNLKEGDRVAIEPGVPCRRC
QLCINGRYNLCSKVIFHATPPFDGTLCQYITHPEDFCFKLSDNLSNEEGA
LIEPLSVAVHACRRGNVTLGSKVLIIGAGTIGLVNLLVAKSLGADSIVVV
DVNERRLQVAKELGAAFVIHIKNDLDTEEIVSKIKEHINGLVDKTIECSG
AANGLNLAIAATISGGCVVIVGMGAPVVQAPLLNALIREVDIRGVFRYAN
CYPAALSLISQKRINVAPLITKIFPFNEAEDAFKLVRSGEGVKIMIEVGK
V*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR013149ADH_C
IPR011032GroES-like_sf
IPR013154ADH_N
IPR016040NAD(P)-bd_dom
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013149Alcohol dehydrogenase, C-terminalPFAMPF00107ADH_zinc_Ncoord: 181..310
e-value: 1.4E-21
score: 76.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 157..296
e-value: 3.1E-116
score: 389.5
NoneNo IPR availableGENE3DG3DSA:3.90.180.10coord: 14..336
e-value: 3.1E-116
score: 389.5
NoneNo IPR availablePANTHERPTHR43161FAMILY NOT NAMEDcoord: 3..348
NoneNo IPR availablePANTHERPTHR43161:SF9SORBITOL DEHYDROGENASEcoord: 3..348
NoneNo IPR availableCDDcd05285sorbitol_DHcoord: 7..348
e-value: 0.0
score: 507.031
IPR013154Alcohol dehydrogenase, N-terminalPFAMPF08240ADH_Ncoord: 30..140
e-value: 8.6E-29
score: 99.6
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 143..314
IPR011032GroES-like superfamilySUPERFAMILYSSF50129GroES-likecoord: 6..179