Myeloid leukemia factor 1

Overview
NameMyeloid leukemia factor 1
Smed IDSMED30027354
Length (bp)931
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myeloid leukemia factor 1 (SMED30027354) t-SNE clustered cells

Violin plots show distribution of expression levels for Myeloid leukemia factor 1 (SMED30027354) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myeloid leukemia factor 1 (SMED30027354) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myeloid leukemia factor 1 (SMED30027354) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027354

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027354SMESG000025667.1 Contig50845newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027354SMESG000025667.1 Contig50845uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30027354SMESG000025667.1 dd_Smed_v6_4787_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027354SMESG000025667.1 dd_Smed_v4_4787_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myeloid leukemia factor 1 vs. Ensembl Human
Match: MLF1 (myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:HGNC:7125])

HSP 1 Score: 87.4261 bits (215), Expect = 1.466e-19
Identity = 44/104 (42.31%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNN 651
            DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW +
Sbjct:   71 DPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQS 173          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Human
Match: MLF1 (myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:HGNC:7125])

HSP 1 Score: 87.0409 bits (214), Expect = 1.802e-19
Identity = 53/142 (37.32%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  235 DSFNHI----FDDFEKHIMGMNDMFNKCHTSFDTNFNLS-DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            DS  H     F   ++ +  M +   K   +F     LS DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW
Sbjct:   37 DSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFG---QLSVDPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEW 174          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Human
Match: MLF1 (myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:HGNC:7125])

HSP 1 Score: 87.0409 bits (214), Expect = 1.802e-19
Identity = 53/142 (37.32%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  235 DSFNHI----FDDFEKHIMGMNDMFNKCHTSFDTNFNLS-DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            DS  H     F   ++ +  M +   K   +F     LS DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW
Sbjct:   37 DSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFG---QLSVDPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEW 174          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Human
Match: MLF1 (myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:HGNC:7125])

HSP 1 Score: 87.0409 bits (214), Expect = 1.802e-19
Identity = 53/142 (37.32%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  235 DSFNHI----FDDFEKHIMGMNDMFNKCHTSFDTNFNLS-DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            DS  H     F   ++ +  M +   K   +F     LS DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW
Sbjct:   37 DSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFG---QLSVDPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEW 174          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Human
Match: MLF1 (myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:HGNC:7125])

HSP 1 Score: 87.0409 bits (214), Expect = 1.802e-19
Identity = 53/142 (37.32%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  235 DSFNHI----FDDFEKHIMGMNDMFNKCHTSFDTNFNLS-DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            DS  H     F   ++ +  M +   K   +F     LS DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW
Sbjct:   37 DSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFG---QLSVDPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEW 174          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Fly
Match: Mlf (gene:FBgn0034051 transcript:FBtr0087293)

HSP 1 Score: 88.1965 bits (217), Expect = 4.952e-20
Identity = 47/113 (41.59%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  325 NFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            N ++   +GA +  S+V    S  +   P+IYQA  S   GPGG+RE +R  +DSR   +KMAIG +IG R   IE++++M++GQ EE   F  L+E EAE+F+ E+ + A R
Sbjct:   91 NADIGGNSGASFCQSTVMTMSSGPDG-RPQIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEERQEFINLEEGEAEQFDREFTSRASR 202          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Fly
Match: Mlf (gene:FBgn0034051 transcript:FBtr0087292)

HSP 1 Score: 88.5817 bits (218), Expect = 7.419e-20
Identity = 47/113 (41.59%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  325 NFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            N ++   +GA +  S+V    S  +   P+IYQA  S   GPGG+RE +R  +DSR   +KMAIG +IG R   IE++++M++GQ EE   F  L+E EAE+F+ E+ + A R
Sbjct:   91 NADIGGNSGASFCQSTVMTMSSGPDG-RPQIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEERQEFINLEEGEAEQFDREFTSRASR 202          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Fly
Match: Mlf (gene:FBgn0034051 transcript:FBtr0306650)

HSP 1 Score: 88.1965 bits (217), Expect = 7.464e-20
Identity = 47/113 (41.59%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  325 NFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            N ++   +GA +  S+V    S  +   P+IYQA  S   GPGG+RE +R  +DSR   +KMAIG +IG R   IE++++M++GQ EE   F  L+E EAE+F+ E+ + A R
Sbjct:   70 NADIGGNSGASFCQSTVMTMSSGPDG-RPQIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEERQEFINLEEGEAEQFDREFTSRASR 181          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Fly
Match: Mlf (gene:FBgn0034051 transcript:FBtr0306649)

HSP 1 Score: 88.1965 bits (217), Expect = 9.861e-20
Identity = 47/113 (41.59%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  325 NFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            N ++   +GA +  S+V    S  +   P+IYQA  S   GPGG+RE +R  +DSR   +KMAIG +IG R   IE++++M++GQ EE   F  L+E EAE+F+ E+ + A R
Sbjct:   89 NADIGGNSGASFCQSTVMTMSSGPDG-RPQIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEERQEFINLEEGEAEQFDREFTSRASR 200          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Fly
Match: Mlf (gene:FBgn0034051 transcript:FBtr0087295)

HSP 1 Score: 88.1965 bits (217), Expect = 1.738e-19
Identity = 46/106 (43.40%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  346 NGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            +GA +  S+V    S  +   P+IYQA  S   GPGG+RE +R  +DSR   +KMAIG +IG R   IE++++M++GQ EE   F  L+E EAE+F+ E+ + A R
Sbjct:   98 SGASFCQSTVMTMSSGPDG-RPQIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEERQEFINLEEGEAEQFDREFTSRASR 202          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Zebrafish
Match: mlf2 (myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GENE-050913-67])

HSP 1 Score: 78.5666 bits (192), Expect = 1.731e-16
Identity = 39/85 (45.88%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  409 PRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            P++YQ        PGG+RE ++  RDS+   E+M+IG +IG RG  +ER RN  TG  EE  +F  L+ESEA  F+EEW    GR
Sbjct:  111 PKVYQQTSEYRTAPGGIRETRQTMRDSQSGLERMSIGHHIGERGHVMERSRNRLTGDREERQDFFNLEESEAAAFDEEWRREVGR 195          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Zebrafish
Match: mlf2 (myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GENE-050913-67])

HSP 1 Score: 78.5666 bits (192), Expect = 1.731e-16
Identity = 39/85 (45.88%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  409 PRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            P++YQ        PGG+RE ++  RDS+   E+M+IG +IG RG  +ER RN  TG  EE  +F  L+ESEA  F+EEW    GR
Sbjct:  111 PKVYQQTSEYRTAPGGIRETRQTMRDSQSGLERMSIGHHIGERGHVMERSRNRLTGDREERQDFFNLEESEAAAFDEEWRREVGR 195          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Zebrafish
Match: mlf2 (myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GENE-050913-67])

HSP 1 Score: 78.5666 bits (192), Expect = 1.731e-16
Identity = 39/85 (45.88%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  409 PRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            P++YQ        PGG+RE ++  RDS+   E+M+IG +IG RG  +ER RN  TG  EE  +F  L+ESEA  F+EEW    GR
Sbjct:  111 PKVYQQTSEYRTAPGGIRETRQTMRDSQSGLERMSIGHHIGERGHVMERSRNRLTGDREERQDFFNLEESEAAAFDEEWRREVGR 195          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Zebrafish
Match: mlf1 (myeloid leukemia factor 1 [Source:ZFIN;Acc:ZDB-GENE-080917-7])

HSP 1 Score: 75.8702 bits (185), Expect = 1.483e-15
Identity = 36/87 (41.38%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  406 EP-RIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            EP +++ A       PGG++E +++ RDS    +KM+IG +I +RG  IERK N KTG+ E N +F+ +DE+EA+ F++EW     R
Sbjct:  120 EPAKVFAASSQTRCAPGGIKETKKSLRDSESGLQKMSIGHHIQDRGHVIERKENRKTGEKEFNQDFQNMDETEAQAFDQEWQQEVSR 206          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Zebrafish
Match: mlf1 (myeloid leukemia factor 1 [Source:ZFIN;Acc:ZDB-GENE-080917-7])

HSP 1 Score: 75.8702 bits (185), Expect = 1.523e-15
Identity = 36/87 (41.38%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  406 EP-RIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            EP +++ A       PGG++E +++ RDS    +KM+IG +I +RG  IERK N KTG+ E N +F+ +DE+EA+ F++EW     R
Sbjct:  117 EPAKVFAASSQTRCAPGGIKETKKSLRDSESGLQKMSIGHHIQDRGHVIERKENRKTGEKEFNQDFQNMDETEAQAFDQEWQQEVSR 203          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Xenopus
Match: XB-GENE-5888675 (uncharacterized LOC443671 [Source:Xenbase;Acc:XB-GENE-5888675])

HSP 1 Score: 85.5001 bits (210), Expect = 7.111e-19
Identity = 53/144 (36.81%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  223 SLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSF-DTNFNL-SDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWN 648
            S+  DSF  +  DF      M+ M         D + N+  DP    +SSSSV  Y S       +++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ RN KTG  E N  F  LDE+E   F+ EW 
Sbjct:   74 SMPTDSFTGMSSDFRDVFHSMDSMMANMRNRMRDMHRNVEGDPCTHSFSSSSVMTY-SKTGDEPAKVFQASSQTRRAPGGIKETKKAVRDSESGIEKMAIGHHIHDRAHIIQKSRNHKTGDQELNQEFLNLDEAEGPSFDNEWQ 216          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Xenopus
Match: XB-GENE-5888675 (uncharacterized LOC443671 [Source:Xenbase;Acc:XB-GENE-5888675])

HSP 1 Score: 84.3445 bits (207), Expect = 1.396e-18
Identity = 52/155 (33.55%), Postives = 76/155 (49.03%), Query Frame = 1
Query:  196 RSSSKDNQISLRND----SFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWN 648
            R     +Q++LR D     F  +F   +  +  M +     H + +      DP    +SSSSV  Y S       +++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ RN KTG  E N  F  LDE+E   F+ EW 
Sbjct:   53 RRGQPGSQVALREDHRSSDFRDVFHSMDSMMANMRNRMRDMHRNVE-----GDPCTHSFSSSSVMTY-SKTGDEPAKVFQASSQTRRAPGGIKETKKAVRDSESGIEKMAIGHHIHDRAHIIQKSRNHKTGDQELNQEFLNLDEAEGPSFDNEWQ 201          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Xenopus
Match: mlf2 (myeloid leukemia factor 2 [Source:NCBI gene;Acc:595062])

HSP 1 Score: 78.5666 bits (192), Expect = 2.198e-16
Identity = 41/109 (37.61%), Postives = 62/109 (56.88%), Query Frame = 1
Query:  337 SDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            S  N   +SSS+V +Y +    + P++YQ        PGG+RE +RA RDS    E+M+IG +I +R   ++R  N +TG  EE   F  +DE++A  F+EEW+    R
Sbjct:   97 SGSNCQTFSSSTVISYSNMPGGNTPKVYQETTQTRMAPGGIRETRRAVRDSNSGMEQMSIGHHIRDRSHIVQRSHNRRTGDQEERQEFINMDENDAASFDEEWSRQTTR 205          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Mouse
Match: Mlf1 (myeloid leukemia factor 1 [Source:MGI Symbol;Acc:MGI:1341819])

HSP 1 Score: 85.8853 bits (211), Expect = 4.644e-19
Identity = 43/104 (41.35%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNN 651
            DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    E+MA+G +I +RG  I + +N KTG  E N  F  ++ES+A  F++EW N
Sbjct:   99 DPNGHSFCSSSVMTY-SKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQN 201          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Mouse
Match: Mlf1 (myeloid leukemia factor 1 [Source:MGI Symbol;Acc:MGI:1341819])

HSP 1 Score: 85.8853 bits (211), Expect = 6.513e-19
Identity = 43/104 (41.35%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNN 651
            DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    E+MA+G +I +RG  I + +N KTG  E N  F  ++ES+A  F++EW N
Sbjct:  114 DPNGHSFCSSSVMTY-SKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQN 216          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Mouse
Match: Mlf2 (myeloid leukemia factor 2 [Source:MGI Symbol;Acc:MGI:1353554])

HSP 1 Score: 79.337 bits (194), Expect = 9.176e-17
Identity = 47/122 (38.52%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  283 MNDMF-NKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            MNDM  N  H +   N          +SSS+V +Y S+     P++YQ    +   PGG+RE +R  RDS    E+M+IG +I +R   ++R RN +TG  EE  ++  LDESEA  F++EW
Sbjct:   82 MNDMIGNMEHMAAGGNCQT-------FSSSTVISY-SNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEW 195          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Mouse
Match: Mlf2 (myeloid leukemia factor 2 [Source:MGI Symbol;Acc:MGI:1353554])

HSP 1 Score: 79.337 bits (194), Expect = 9.176e-17
Identity = 47/122 (38.52%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  283 MNDMF-NKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            MNDM  N  H +   N          +SSS+V +Y S+     P++YQ    +   PGG+RE +R  RDS    E+M+IG +I +R   ++R RN +TG  EE  ++  LDESEA  F++EW
Sbjct:   82 MNDMIGNMEHMAAGGNCQT-------FSSSTVISY-SNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEW 195          
BLAST of Myeloid leukemia factor 1 vs. UniProt/SwissProt
Match: sp|P58340|MLF1_HUMAN (Myeloid leukemia factor 1 OS=Homo sapiens OX=9606 GN=MLF1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.605e-18
Identity = 53/142 (37.32%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  235 DSFNHI----FDDFEKHIMGMNDMFNKCHTSFDTNFNLS-DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            DS  H     F   ++ +  M +   K   +F     LS DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW
Sbjct:   62 DSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFG---QLSVDPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEW 199          
BLAST of Myeloid leukemia factor 1 vs. UniProt/SwissProt
Match: sp|Q9NKV0|MLF_DROME (Myeloid leukemia factor OS=Drosophila melanogaster OX=7227 GN=Mlf PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.742e-18
Identity = 46/106 (43.40%), Postives = 67/106 (63.21%), Query Frame = 1
Query:  346 NGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            +GA +  S+V    S  +   P+IYQA  S   GPGG+RE +R  +DSR   +KMAIG +IG R   IE++++M++GQ EE   F  L+E EAE+F+ E+ + A R
Sbjct:   98 SGASFCQSTVMTMSSGPDG-RPQIYQASTSTKTGPGGVRETRRTVQDSRTGVKKMAIGHHIGERAHIIEKEQDMRSGQLEERQEFINLEEGEAEQFDREFTSRASR 202          
BLAST of Myeloid leukemia factor 1 vs. UniProt/SwissProt
Match: sp|Q5R4T3|MLF1_PONAB (Myeloid leukemia factor 1 OS=Pongo abelii OX=9601 GN=MLF1 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.865e-18
Identity = 44/104 (42.31%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNN 651
            DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMAIG +I +R   I++ +N KTG  E N  F  ++ES+A  F+EEW +
Sbjct:   99 DPNGHSFCSSSVMTY-SKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQS 201          
BLAST of Myeloid leukemia factor 1 vs. UniProt/SwissProt
Match: sp|Q9QWV4|MLF1_MOUSE (Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.248e-18
Identity = 43/104 (41.35%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNN 651
            DPNG  + SSSV  Y S      P+++QA     + PGG++E ++A RDS    E+MA+G +I +RG  I + +N KTG  E N  F  ++ES+A  F++EW N
Sbjct:   99 DPNGHSFCSSSVMTY-SKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQN 201          
BLAST of Myeloid leukemia factor 1 vs. UniProt/SwissProt
Match: sp|Q32KY3|MLF1_BOVIN (Myeloid leukemia factor 1 OS=Bos taurus OX=9913 GN=MLF1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.200e-18
Identity = 42/104 (40.38%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNN 651
            DPNG  +SSSSV  Y S      P+++QA     + PGG++E ++A RDS    EKMA+G ++ +R   I++ +N KTG  E N  F  ++E +A  F++EW N
Sbjct:   99 DPNGHSFSSSSVMTY-SKVGDEPPKVFQASTQTRRAPGGIKETRKALRDSDSGLEKMAVGHHLHDRAHVIKKSKNNKTGDEEVNQEFINMNECDAHAFDDEWQN 201          
BLAST of Myeloid leukemia factor 1 vs. TrEMBL
Match: A0A1I8H8Y7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.451e-26
Identity = 54/108 (50.00%), Postives = 76/108 (70.37%), Query Frame = 1
Query:  340 DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            D NG  YS +SVYAY SD  S EP++YQA      GPGG+RE ++A +DSR  EE++A+G +IG RG  +ER+RN  TGQ +E+ ++ G+DESE ++F+ EW+  A R
Sbjct:   20 DFNGRVYSHASVYAYRSD-GSGEPQVYQAVSESRAGPGGVRETRKALKDSRSREERIAVGHHIGGRGHTVERRRNTGTGQQQEDHHYDGIDESEGQQFDREWDRRAAR 126          
BLAST of Myeloid leukemia factor 1 vs. TrEMBL
Match: A0A267DDX3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030875g3 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.304e-25
Identity = 59/141 (41.84%), Postives = 90/141 (63.83%), Query Frame = 1
Query:  241 FNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            F+ +F+  E+    M+D   +   + + +    D NG  YS +SVYAY SD  S EP++YQA      GPGG+RE ++A +DSR  EE++A+G +IG RG  +ER+RN  TGQ +E+ ++ G+DESE ++F+ EW+  A R
Sbjct:  114 FDRVFEGVERM---MSDAGERMLAAQEAS-QRPDFNGRVYSHASVYAYRSD-GSGEPQVYQAVSESRAGPGGVRETRKALKDSRSREERIAVGHHIGGRGHTVERRRNTGTGQQQEDHHYDGIDESEGQQFDREWDRRAAR 249          
BLAST of Myeloid leukemia factor 1 vs. TrEMBL
Match: A0A1I8IPQ5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.269e-25
Identity = 62/158 (39.24%), Postives = 92/158 (58.23%), Query Frame = 1
Query:  199 SSSKDNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLS---DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            S+ +   ++L   SF      F++   G+  M +            S   D NG  YS +SVYAY SD  S EP++YQA      GPGG+RE ++A +DSR  EE++A+G +IG RG  +ER+RN  TGQ +E+ ++ G+DESE ++F+ EW+  A R
Sbjct:   95 STGRGGGLALPGYSFG--LPQFDRLFEGVERMMSDAGERMLAAQEASQRPDFNGRVYSHASVYAYRSD-GSGEPQVYQAVSESRAGPGGVRETRKALKDSRSREERIAVGHHIGGRGHTVERRRNTGTGQQQEDHHYDGIDESEGQQFDREWDRRAAR 249          
BLAST of Myeloid leukemia factor 1 vs. TrEMBL
Match: A0A267E674 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030875g2 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.661e-25
Identity = 62/158 (39.24%), Postives = 92/158 (58.23%), Query Frame = 1
Query:  199 SSSKDNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLS---DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            S+ +   ++L   SF      F++   G+  M +            S   D NG  YS +SVYAY SD  S EP++YQA      GPGG+RE ++A +DSR  EE++A+G +IG RG  +ER+RN  TGQ +E+ ++ G+DESE ++F+ EW+  A R
Sbjct:   95 STGRGGGLALPGYSFG--LPQFDRLFEGVERMMSDAGERMLAAQEASQRPDFNGRVYSHASVYAYRSD-GSGEPQVYQAVSESRAGPGGVRETRKALKDSRSREERIAVGHHIGGRGHTVERRRNTGTGQQQEDHHYDGIDESEGQQFDREWDRRAAR 249          
BLAST of Myeloid leukemia factor 1 vs. TrEMBL
Match: A0A1S3ITN0 (myeloid leukemia factor 2 OS=Lingula unguis OX=7574 GN=LOC106166777 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.964e-22
Identity = 59/150 (39.33%), Postives = 82/150 (54.67%), Query Frame = 1
Query:  235 DSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSER 684
            D F  IF      +  M  +    H + +   N  D N   +S SSV +Y S+     P++YQA  S    PGG+RE ++A RDS  A EKMAIGR+I +RG  I + +N +TG  EEN +F  +DE EA RF+ EW   A +  + S+R
Sbjct:   83 DPFGGIFGHMNSMMGNMRSLMGNMHQNMEHLQNDPDSNVHTFSQSSVMSY-SNTGQGPPKVYQATTSTRTAPGGVRETRKAVRDSETATEKMAIGRHIKDRGHVITKAKNTRTGDMEENQDFVNIDEEEAPRFDSEWTQRAQQGFSQSQR 231          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Cavefish
Match: mlf1 (myeloid leukemia factor 1 [Source:NCBI gene;Acc:103044363])

HSP 1 Score: 82.0333 bits (201), Expect = 8.636e-18
Identity = 50/124 (40.32%), Postives = 73/124 (58.87%), Query Frame = 1
Query:  274 IMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            + GM +     H +FD     +D N   +SSSSV  Y S       +++QA       PGG+RE +R+ +DS    EKM+IG +I +RG  IE+K N KTG+ E N +F+ +DE+EA+ F+EEW
Sbjct:   83 MAGMRNRMTDMHRNFDNT--STDSNSHAFSSSSVMTY-SKVGDEPAKVFQASSQTRSAPGGIRETRRSLKDSVSGVEKMSIGHHIQDRGHVIEKKHNNKTGERELNQDFQNMDETEAQSFDEEW 203          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Cavefish
Match: mlf1 (myeloid leukemia factor 1 [Source:NCBI gene;Acc:103044363])

HSP 1 Score: 82.0333 bits (201), Expect = 9.875e-18
Identity = 50/124 (40.32%), Postives = 73/124 (58.87%), Query Frame = 1
Query:  274 IMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEW 645
            + GM +     H +FD     +D N   +SSSSV  Y S       +++QA       PGG+RE +R+ +DS    EKM+IG +I +RG  IE+K N KTG+ E N +F+ +DE+EA+ F+EEW
Sbjct:   84 MAGMRNRMTDMHRNFDNTS--TDSNSHAFSSSSVMTY-SKVGDEPAKVFQASSQTRSAPGGIRETRRSLKDSVSGVEKMSIGHHIQDRGHVIEKKHNNKTGERELNQDFQNMDETEAQSFDEEW 204          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Cavefish
Match: mlf2 (myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GENE-050913-67])

HSP 1 Score: 78.1814 bits (191), Expect = 1.620e-16
Identity = 37/85 (43.53%), Postives = 54/85 (63.53%), Query Frame = 1
Query:  409 PRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            P++YQ    +   PGG+RE +++ RDS    E+M+IG +IG+R   +ER RN +TG  E+  +F  L+ESEA  F+EEW    GR
Sbjct:  109 PKVYQQTSEVRTAPGGIRETRQSLRDSASGMERMSIGHHIGDRAHVMERSRNRRTGDREDRQDFINLEESEAASFDEEWRRGLGR 193          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Medaka
Match: mlf1 (myeloid leukemia factor 1 [Source:NCBI gene;Acc:101163836])

HSP 1 Score: 100.523 bits (249), Expect = 7.143e-25
Identity = 61/152 (40.13%), Postives = 87/152 (57.24%), Query Frame = 1
Query:  220 ISLRN---DSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLS-DPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR 663
            ++LRN   D     F  F+  +  + +     H +FD   NLS D N   +SSSSV  Y S      P++++A  S  Q PGG++E  RA +DS    E+M++G YI +RG  +E+K N KTGQ E N +F+ LDESEA+ F+EEW   A +
Sbjct:   33 LALRNEHRDLMRDPFGMFDSMMTNIRNTMEGMHRNFD---NLSTDSNTHAFSSSSVMTY-SKVGDEPPKVFKATSSTRQAPGGIKETLRALKDSDSGLEQMSVGHYIQDRGHVVEKKFNKKTGQKEFNQDFQNLDESEAQCFDEEWQQEASK 180          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Medaka
Match: mlf2 (myeloid leukemia factor 2 [Source:NCBI gene;Acc:101175023])

HSP 1 Score: 83.1889 bits (204), Expect = 2.382e-18
Identity = 51/137 (37.23%), Postives = 71/137 (51.82%), Query Frame = 1
Query:  274 IMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSER 684
            +MGM+ +       F    + S     F SS+ +     DA +  P++YQ       GPGG+RE  ++ RDS    E++AIG +IG R   +ER RN +TG  EE  +F  LDESEAE F+ EW    GR  +   R
Sbjct:   60 MMGMSHLVFIYFVFFQERMSGSPNCQTFSSSTVISYSSLDAGA--PKVYQQTSETRTGPGGIRETMQSVRDSESGLERLAIGHHIGERAHIVERSRNRRTGDREERQDFINLDESEAEAFDVEWRRGTGRYASPGAR 194          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Medaka
Match: mlf2 (myeloid leukemia factor 2 [Source:NCBI gene;Acc:101175023])

HSP 1 Score: 82.0333 bits (201), Expect = 6.238e-18
Identity = 41/96 (42.71%), Postives = 56/96 (58.33%), Query Frame = 1
Query:  397 NSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSER 684
            ++  P++YQ       GPGG+RE  ++ RDS    E++AIG +IG R   +ER RN +TG  EE  +F  LDESEAE F+ EW    GR  +   R
Sbjct:  105 DAGAPKVYQQTSETRTGPGGIRETMQSVRDSESGLERLAIGHHIGERAHIVERSRNRRTGDREERQDFINLDESEAEAFDVEWRRGTGRYASPGAR 200          
BLAST of Myeloid leukemia factor 1 vs. Ensembl Medaka
Match: mlf2 (myeloid leukemia factor 2 [Source:NCBI gene;Acc:101175023])

HSP 1 Score: 82.0333 bits (201), Expect = 6.238e-18
Identity = 41/96 (42.71%), Postives = 56/96 (58.33%), Query Frame = 1
Query:  397 NSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSER 684
            ++  P++YQ       GPGG+RE  ++ RDS    E++AIG +IG R   +ER RN +TG  EE  +F  LDESEAE F+ EW    GR  +   R
Sbjct:  105 DAGAPKVYQQTSETRTGPGGIRETMQSVRDSESGLERLAIGHHIGERAHIVERSRNRRTGDREERQDFINLDESEAEAFDVEWRRGTGRYASPGAR 200          
BLAST of Myeloid leukemia factor 1 vs. Planmine SMEST
Match: SMESG000025667.1 (SMESG000025667.1)

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 247/251 (98.41%), Postives = 248/251 (98.80%), Query Frame = 1
Query:   64 MYQRHFSMFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSSKDNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKRH 816
            M+QRHFSMFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSS DNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAY SDANSSEPRIYQAHKSI QGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKRH
Sbjct:    1 MFQRHFSMFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSSNDNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYQSDANSSEPRIYQAHKSIKQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKRH 251          
BLAST of Myeloid leukemia factor 1 vs. Planmine SMEST
Match: SMESG000025667.1 (SMESG000025667.1)

HSP 1 Score: 496.893 bits (1278), Expect = 4.885e-180
Identity = 241/244 (98.77%), Postives = 241/244 (98.77%), Query Frame = 1
Query:   85 MFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSSKDNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKRH 816
            MFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSS DNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAY SDANSSEPRIYQAHKSI QGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKRH
Sbjct:    1 MFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSSNDNQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYSSSSVYAYQSDANSSEPRIYQAHKSIKQGPGGLREEQRAERDSRRAEEKMAIGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGRRLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKRH 244          
The following BLAST results are available for this feature:
BLAST of Myeloid leukemia factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MLF11.466e-1942.31myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:... [more]
MLF11.802e-1937.32myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:... [more]
MLF11.802e-1937.32myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:... [more]
MLF11.802e-1937.32myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:... [more]
MLF11.802e-1937.32myeloid leukemia factor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mlf4.952e-2041.59gene:FBgn0034051 transcript:FBtr0087293[more]
Mlf7.419e-2041.59gene:FBgn0034051 transcript:FBtr0087292[more]
Mlf7.464e-2041.59gene:FBgn0034051 transcript:FBtr0306650[more]
Mlf9.861e-2041.59gene:FBgn0034051 transcript:FBtr0306649[more]
Mlf1.738e-1943.40gene:FBgn0034051 transcript:FBtr0087295[more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlf21.731e-1645.88myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mlf21.731e-1645.88myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mlf21.731e-1645.88myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mlf11.483e-1541.38myeloid leukemia factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
mlf11.523e-1541.38myeloid leukemia factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
XB-GENE-58886757.111e-1936.81uncharacterized LOC443671 [Source:Xenbase;Acc:XB-G... [more]
XB-GENE-58886751.396e-1833.55uncharacterized LOC443671 [Source:Xenbase;Acc:XB-G... [more]
mlf22.198e-1637.61myeloid leukemia factor 2 [Source:NCBI gene;Acc:59... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mlf14.644e-1941.35myeloid leukemia factor 1 [Source:MGI Symbol;Acc:M... [more]
Mlf16.513e-1941.35myeloid leukemia factor 1 [Source:MGI Symbol;Acc:M... [more]
Mlf29.176e-1738.52myeloid leukemia factor 2 [Source:MGI Symbol;Acc:M... [more]
Mlf29.176e-1738.52myeloid leukemia factor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58340|MLF1_HUMAN1.605e-1837.32Myeloid leukemia factor 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q9NKV0|MLF_DROME1.742e-1843.40Myeloid leukemia factor OS=Drosophila melanogaster... [more]
sp|Q5R4T3|MLF1_PONAB1.865e-1842.31Myeloid leukemia factor 1 OS=Pongo abelii OX=9601 ... [more]
sp|Q9QWV4|MLF1_MOUSE3.248e-1841.35Myeloid leukemia factor 1 OS=Mus musculus OX=10090... [more]
sp|Q32KY3|MLF1_BOVIN8.200e-1840.38Myeloid leukemia factor 1 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H8Y73.451e-2650.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DDX37.304e-2541.84Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IPQ59.269e-2539.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6749.661e-2539.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3ITN01.964e-2239.33myeloid leukemia factor 2 OS=Lingula unguis OX=757... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mlf18.636e-1840.32myeloid leukemia factor 1 [Source:NCBI gene;Acc:10... [more]
mlf19.875e-1840.32myeloid leukemia factor 1 [Source:NCBI gene;Acc:10... [more]
mlf21.620e-1643.53myeloid leukemia factor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myeloid leukemia factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mlf17.143e-2540.13myeloid leukemia factor 1 [Source:NCBI gene;Acc:10... [more]
mlf22.382e-1837.23myeloid leukemia factor 2 [Source:NCBI gene;Acc:10... [more]
mlf26.238e-1842.71myeloid leukemia factor 2 [Source:NCBI gene;Acc:10... [more]
mlf26.238e-1842.71myeloid leukemia factor 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Myeloid leukemia factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000025667.10.000e+098.41SMESG000025667.1[more]
SMESG000025667.14.885e-18098.77SMESG000025667.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027354 ID=SMED30027354|Name=Myeloid leukemia factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=931bp
GCAAAGTTAATTAAAACTTCGTTGTTATAGTTTCACAATTTATTTTTTTC
TAAAAAAGTTGAAATGTATCAACGTCATTTTTCTATGTTCGATGATCCAT
TTTTCAATACACCAAATGATATCGAGAGTACTTTCAACAATTTAGAATCA
TTTATGAATAGACCAATGATAGATATAAAAAGACCAGCGGTTAAAAGATC
TTCTTCAAAAGACAATCAAATTTCCTTAAGAAATGATTCTTTTAATCACA
TTTTTGATGATTTTGAAAAACATATTATGGGAATGAATGACATGTTCAAT
AAATGTCATACTTCGTTTGATACTAATTTCAATCTCAGCGATCCGAATGG
AGCATTTTATTCATCTTCTTCTGTTTACGCGTATCACAGTGATGCGAATT
CAAGTGAACCTCGAATTTACCAAGCTCATAAGTCCATTAACCAAGGCCCT
GGTGGATTACGAGAAGAGCAAAGGGCGGAAAGAGACAGCCGAAGGGCTGA
AGAGAAAATGGCAATCGGTAGGTATATTGGTAATCGGGGACGGGAAATTG
AGAGAAAACGAAATATGAAAACCGGGCAAAATGAGGAAAACGTAAATTTT
CGTGGATTGGACGAATCTGAAGCTGAGAGATTTAATGAGGAGTGGAATAA
TTTGGCAGGAAGACGACTCAACAATAGTGAAAGAATGGGGAACGCGCACC
AATTGAAAGGCGATTCCCACAGCCGCCAACATATGAAGGATAAGGATTAT
AATAAATCTGATAATCACCGCCATTTGGCAATAACCGAGGGGAAAAGCCG
ATTGAGGAAACGACATTAAATTTCGAAATTTGACTTTTGATTTCATATAA
ACATGATCACATTTTGATTTGCTAAGGTTATGTCATTATTAATGTTAGAT
TTTAAGGAAATTATATAATTTTACGTAAAAA
back to top

protein sequence of SMED30027354-orf-1

>SMED30027354-orf-1 ID=SMED30027354-orf-1|Name=SMED30027354-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MYQRHFSMFDDPFFNTPNDIESTFNNLESFMNRPMIDIKRPAVKRSSSKD
NQISLRNDSFNHIFDDFEKHIMGMNDMFNKCHTSFDTNFNLSDPNGAFYS
SSSVYAYHSDANSSEPRIYQAHKSINQGPGGLREEQRAERDSRRAEEKMA
IGRYIGNRGREIERKRNMKTGQNEENVNFRGLDESEAERFNEEWNNLAGR
RLNNSERMGNAHQLKGDSHSRQHMKDKDYNKSDNHRHLAITEGKSRLRKR
H*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR019376Myeloid_leukemia_factor
Vocabulary: biological process
TermDefinition
GO:0002318myeloid progenitor cell differentiation
GO:0006351transcription, DNA-templated
GO:0007049cell cycle
GO:0007050cell cycle arrest
GO:0007275multicellular organism development
GO:0030154cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0019904protein domain specific binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019376Myeloid leukemia factorPFAMPF10248Mlf1IPcoord: 5..195
e-value: 5.4E-39
score: 133.9
IPR019376Myeloid leukemia factorPANTHERPTHR13105MYELOID LEUKEMIA FACTORcoord: 37..243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 124..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 202..251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 212..241
NoneNo IPR availablePANTHERPTHR13105:SF15MYELOID LEUKEMIA FACTOR 1coord: 37..243