SMED30027352

Overview
NameSMED30027352
Smed IDSMED30027352
Length (bp)4273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027352 (SMED30027352) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027352 (SMED30027352) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027352 (SMED30027352) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027352 (SMED30027352) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027352

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027352SMESG000075968.1 SmedASXL_008686SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30027352SMESG000075968.1 dd_Smed_v4_24482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30027352SMESG000075968.1 dd_Smed_v4_24482_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027352SMESG000075968.1 SMED_11548_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027352 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000414:25618..31358 +14323
Homology
BLAST of SMED30027352 vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 63.1586 bits (152), Expect = 2.422e-9
Identity = 58/209 (27.75%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I+             P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP   P
Sbjct:  254 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 462          
BLAST of SMED30027352 vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 63.1586 bits (152), Expect = 3.144e-9
Identity = 58/209 (27.75%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I+             P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP   P
Sbjct:  254 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 462          
BLAST of SMED30027352 vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 63.1586 bits (152), Expect = 3.173e-9
Identity = 58/209 (27.75%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I+             P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP   P
Sbjct:  277 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 485          
BLAST of SMED30027352 vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332064)

HSP 1 Score: 58.5362 bits (140), Expect = 3.893e-8
Identity = 49/217 (22.58%), Postives = 81/217 (37.33%), Query Frame = 3
Query: 2730 HSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPI-----------------------------------------KRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKITVS---DDDSGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPP 3173
            H +L+L E++I     +Q +F   T D+FR+ Q  E  P     NP+                                         K +L KP + +L          L    A + Y+SAD             Y+L  +  S   D   G  ++             P  L  +TR P+ +++DS +S +F+ +   F +PL+ L+SP+ +PP
Sbjct:  231 HMTLSLQEILIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPP 447          
BLAST of SMED30027352 vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332061)

HSP 1 Score: 58.5362 bits (140), Expect = 3.893e-8
Identity = 49/217 (22.58%), Postives = 81/217 (37.33%), Query Frame = 3
Query: 2730 HSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPI-----------------------------------------KRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKITVS---DDDSGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPP 3173
            H +L+L E++I     +Q +F   T D+FR+ Q  E  P     NP+                                         K +L KP + +L          L    A + Y+SAD             Y+L  +  S   D   G  ++             P  L  +TR P+ +++DS +S +F+ +   F +PL+ L+SP+ +PP
Sbjct:  231 HMTLSLQEILIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPP 447          
BLAST of SMED30027352 vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332063)

HSP 1 Score: 58.5362 bits (140), Expect = 4.350e-8
Identity = 49/217 (22.58%), Postives = 81/217 (37.33%), Query Frame = 3
Query: 2730 HSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPI-----------------------------------------KRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKITVS---DDDSGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPP 3173
            H +L+L E++I     +Q +F   T D+FR+ Q  E  P     NP+                                         K +L KP + +L          L    A + Y+SAD             Y+L  +  S   D   G  ++             P  L  +TR P+ +++DS +S +F+ +   F +PL+ L+SP+ +PP
Sbjct:  231 HMTLSLQEILIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPP 447          
BLAST of SMED30027352 vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332062)

HSP 1 Score: 58.151 bits (139), Expect = 4.478e-8
Identity = 49/217 (22.58%), Postives = 81/217 (37.33%), Query Frame = 3
Query: 2730 HSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPI-----------------------------------------KRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKITVS---DDDSGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPP 3173
            H +L+L E++I     +Q +F   T D+FR+ Q  E  P     NP+                                         K +L KP + +L          L    A + Y+SAD             Y+L  +  S   D   G  ++             P  L  +TR P+ +++DS +S +F+ +   F +PL+ L+SP+ +PP
Sbjct:  226 HMTLSLQEILIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPP 442          
BLAST of SMED30027352 vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 64.3142 bits (155), Expect = 8.302e-10
Identity = 53/192 (27.60%), Postives = 80/192 (41.67%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI---TVSDDDSGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              LTL++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   +   T  D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  230 GQLTLADALIVGNCNNQVKFSELTIDMFRMLQALEREPVNLATQSSKPGTLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYP 421          
BLAST of SMED30027352 vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 58.9214 bits (141), Expect = 3.578e-8
Identity = 53/194 (27.32%), Postives = 80/194 (41.24%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFT--EKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI---TVSDDDSGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              LTL++ +I  F      ++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   +   T  D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  254 GQLTLADALISFFCCCNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPGTLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYP 447          
BLAST of SMED30027352 vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 58.5362 bits (140), Expect = 4.453e-8
Identity = 53/194 (27.32%), Postives = 80/194 (41.24%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFT--EKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI---TVSDDDSGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              LTL++ +I  F      ++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   +   T  D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  251 GQLTLADALISFFCCCNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPGTLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYP 444          
BLAST of SMED30027352 vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 58.9214 bits (141), Expect = 4.474e-8
Identity = 53/194 (27.32%), Postives = 80/194 (41.24%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFT--EKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI---TVSDDDSGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              LTL++ +I  F      ++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   +   T  D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  271 GQLTLADALISFFCCCNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPGTLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYP 464          
BLAST of SMED30027352 vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 58.5362 bits (140), Expect = 4.813e-8
Identity = 53/194 (27.32%), Postives = 80/194 (41.24%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFT--EKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI---TVSDDDSGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              LTL++ +I  F      ++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   +   T  D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  237 GQLTLADALISFFCCCNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPGTLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYP 430          
BLAST of SMED30027352 vs. Ensembl Xenopus
Match: SCAI (suppressor of cancer cell invasion [Source:NCBI gene;Acc:100493243])

HSP 1 Score: 62.003 bits (149), Expect = 5.881e-9
Identity = 58/211 (27.49%), Postives = 88/211 (41.71%), Query Frame = 3
Query: 2688 IENRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP--------KCCLR----------NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            I NRL      ++        L L++ +I      Q++F   T D+FR+ Q  E  P        K  L+          NP K +L KP   +L      S   L  N+A + Y+SA              YD   + T S+ D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP   P
Sbjct:  210 ISNRLSEGAGPMLEQGMVVGQLMLADALIIGNCNNQVKFSELTIDMFRMLQALEREPMNLTSQMNKPGLQDPAEKPMKRENPHKYLLYKPTFSQLYTFLAASFKELPANSALLIYLSATGVFPTGRSDYEGPYDFGGVLTNSNRDVVNGDAVHKRNQSYKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 420          
BLAST of SMED30027352 vs. Ensembl Mouse
Match: Scai (suppressor of cancer cell invasion [Source:MGI Symbol;Acc:MGI:2443716])

HSP 1 Score: 62.7734 bits (151), Expect = 2.518e-9
Identity = 57/209 (27.27%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I             +P  L  +TR PL ++VDS +S  +++  + F +PL+CLLSP   P
Sbjct:  254 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGIQEPADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDGEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIVVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 462          
BLAST of SMED30027352 vs. Ensembl Mouse
Match: Scai (suppressor of cancer cell invasion [Source:MGI Symbol;Acc:MGI:2443716])

HSP 1 Score: 62.3882 bits (150), Expect = 3.255e-9
Identity = 57/209 (27.27%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I             +P  L  +TR PL ++VDS +S  +++  + F +PL+CLLSP   P
Sbjct:  254 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGIQEPADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDGEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIVVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 462          
BLAST of SMED30027352 vs. UniProt/SwissProt
Match: sp|Q8N9R8|SCAI_HUMAN (Protein SCAI OS=Homo sapiens OX=9606 GN=SCAI PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 1.510e-8
Identity = 58/209 (27.75%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASIN-------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I+             P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP   P
Sbjct:  254 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 462          
BLAST of SMED30027352 vs. UniProt/SwissProt
Match: sp|Q8C8N2|SCAI_MOUSE (Protein SCAI OS=Mus musculus OX=10090 GN=Scai PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 2.277e-8
Identity = 57/209 (27.27%), Postives = 87/209 (41.63%), Query Frame = 3
Query: 2694 NRLVSTNQNIISHS----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDD--SGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            NRL  T   ++        L+L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA              YD   + T S+ D  +G +I             +P  L  +TR PL ++VDS +S  +++  + F +PL+CLLSP   P
Sbjct:  254 NRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGIQEPADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDGEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIVVDSSNSVAYKNFTNLFGQPLVCLLSPTAYP 462          
BLAST of SMED30027352 vs. TrEMBL
Match: A0A2C9JH12 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056348 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.729e-13
Identity = 69/245 (28.16%), Postives = 101/245 (41.22%), Query Frame = 3
Query: 2601 YNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSS---LTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLR-------------------------NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISAD------------SYDLNKITVSDDDSGAS---------------INPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            +N  +     F  +  L NVV+ +S    + +RL   N   +   +   LTL EV+I     +Q++F   T D+FR+ Q  E  P+  L                          NP K +L KP   +L      +   L  N A V YISAD            +YDL  +  +    G S               ++P  L  YTR PL LI+DS +S  F++  + F +PL+CLLSP  +P
Sbjct:  181 WNLVLGEIKAFIEADNLINVVDVDSSSIVLSHRLTPLNTPPLEKGTPVYLTLQEVLIVGNCHEQVKFSELTLDMFRMLQSLEREPQDDLSNQIYDNSPAPGRTPFENGDRTNKRDNPHKYLLYKPTYGQLNTFLASAFKELPPNGAMVLYISADGCPGNQKHTDDAAYDLGGVITNSRKEGESQPKGKKGEFYKEMHCLHPGDLYPYTRKPLFLIIDSSNSSAFQNFPNLFGQPLVCLLSPEQVP 425          
BLAST of SMED30027352 vs. TrEMBL
Match: A0A3S0ZUT2 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_008816 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.547e-12
Identity = 66/245 (26.94%), Postives = 100/245 (40.82%), Query Frame = 3
Query: 2601 YNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSS---LTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLR-------------------------NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISAD------------SYDLNKITVSDDDSGAS---------------INPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            +N  +     F  +  + NV++ +S    + +RL   N   +   +   LTL EV+I     +Q++F   T D+FR+ Q  E  P+  L                          NP K +L KP   +L      +   L  N A V YISAD            +YDL  +  +    G                 ++P  L  YTR PL LI+DS +S  F++  + F +PL+CLLSP  +P
Sbjct:  182 WNLVLGEIKAFIEADGIINVMDVDSSSIVLSHRLTPLNTPPLEKGTPVYLTLQEVLIVGNCHEQVKFSELTLDMFRMLQSLEREPQDDLSNQIYDTSPAPGRTPFENGERSNKRDNPHKYLLYKPTYGQLNTFLASAFKELPPNGAMVLYISADGCLGNQKHTDDAAYDLGGVITNSRREGEEPAKGKKAELYKEMHCLHPGDLYPYTRKPLFLIIDSSNSSAFQNFPTIFGQPLVCLLSPEQVP 426          
BLAST of SMED30027352 vs. TrEMBL
Match: V3ZS62 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_168977 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 8.323e-12
Identity = 66/244 (27.05%), Postives = 100/244 (40.98%), Query Frame = 3
Query: 2601 YNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSS---LTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLR------------------------NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISAD------------SYDLNKITVSDDDSGA---------------SINPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            +N  +     F  +  + NVV+ +S    + +RL   N       +   L+L E++I     +Q++F   T D+FR+ Q  E  P+  L                         NP K +L KP   +L      +   L  N A + YISAD            +YDL  +  +    G                S++P  L  YTR PL LIVDS +S  F++  + F +PL+CLLSP  +P
Sbjct:  180 WNLVLGEIKAFIEADNIINVVDVDSTTIVLSHRLTPLNTPPADKGAPVYLSLQEILIVGNCHEQVKFSELTLDMFRMLQTLEREPQEDLTTQIYDVSPAPGRQLFENGDRTRRDNPHKYLLYKPTYGQLNTFLASAFKELPPNGAMLLYISADGCLGNAKHTDDAAYDLGGVVTNSRREGETPSKGKRPGVLKEMHSLHPGDLYPYTRKPLFLIVDSDNSSAFQNFPTLFGQPLVCLLSPEQVP 423          
BLAST of SMED30027352 vs. TrEMBL
Match: A0A2T7NL03 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17659 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.457e-10
Identity = 66/261 (25.29%), Postives = 102/261 (39.08%), Query Frame = 3
Query: 2580 QADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSS---LTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPK----------------------------------CCLRNPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISAD------------SYDLNKITVSDDDSGAS---------------INPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            + D    +N  +    +F  +  + NVV+ +S    + +RL   N   +   +   LTL E++I     +Q++F   T D+FR+ Q  E  P+                                      NP K +L KP   +L      +   L  N A + YISAD            +YDL  +  +    G                 ++P  L  YTR PL LIVDS +S  F++  + F +PL+CLLSP  +P
Sbjct:  167 EPDDQMEWNLVLGEIKSFIEADNIINVVDMDSSSIVLSHRLTPLNTPPLEKGAPVYLTLQEILIVGNCHEQVKFSELTLDMFRMLQTLEREPQDELVTQTFDTSPAPGRPPFRDLPPQSSLENGERSGARDNPHKYLLYKPTFGQLNTFLASAFKELPPNGAMLLYISADGSHGNQKHTDDAAYDLGGVITNSRRDGEDPTKSKRPGHLKEIHCLHPGDLYPYTRKPLFLIVDSDNSSAFQNFPNLFGQPLVCLLSPDQVP 427          
BLAST of SMED30027352 vs. TrEMBL
Match: A0A0L8IHM0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021848mg PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.546e-10
Identity = 67/252 (26.59%), Postives = 100/252 (39.68%), Query Frame = 3
Query: 2580 QADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSS---LTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLR-------------------------NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISAD------------SYDLNKITVSDDDSGASIN---------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            + D    +N  +    +F  +  + +VV+ +S    + +RL   N   +   +   LTL E++I     +Q++F   T D+FR+ Q  E  P+  L                          NP K +L KP   +L          L  N A + YISAD            +YDL  +  +    G  +N               P  L  YTR PL LI DS +S  F+   + F +PL+CLLSP  LP
Sbjct:  134 EPDDQMEWNLVLGEIKSFIEADNIISVVDVDSSSIVLSHRLTPLNTPPLDKGTPVYLTLQEILIVGNCNEQVKFSELTLDMFRMLQTLEREPQEDLTTQLYDTSPAPGRQPFENGDRSIRRDNPHKYLLYKPTFSQLNTFLASGFKELPPNGALLLYISADGCYGNSKHTDDAAYDLGGVVTNSRREGDILNKNKRPGSLKEMHCLHPGDLYPYTRKPLFLICDSDNSSAFQCFPNLFGQPLVCLLSPEQLP 385          
BLAST of SMED30027352 vs. Ensembl Cavefish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 55.4546 bits (132), Expect = 3.296e-7
Identity = 51/191 (26.70%), Postives = 79/191 (41.36%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP------------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISA-----------DSYDLNKI---TVSDDDSGASI------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              LTL++ +I         F   T D+FR+ Q  E  P                  K   R NP K +L KP   +L      S   L  ++  + Y+SA           + YD+  +   T  D  +G ++            +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  228 GQLTLADALI---------FSELTIDMFRMLQALEREPVNLATQTTTKPGTLEPSEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPASSVLLVYLSATGVFPSARLEYEPYDVGGVLTNTNRDVVNGETVQKRNQAQKEMHLHPGDLFPFTRKPLFIIVDSTNSTAYKNFSNLFGQPLVCLLSPTVYP 409          
BLAST of SMED30027352 vs. Ensembl Sea Lamprey
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 53.9138 bits (128), Expect = 2.096e-7
Identity = 54/210 (25.71%), Postives = 88/210 (41.90%), Query Frame = 3
Query: 2697 RLVSTNQNIISHS-----SLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCL-------------------RNPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKI-TVSDDDSGA---------------SINPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            RL  +    + HS      LTL++ I+     +Q++F   T D+FR+ Q  E  P+  +                    NP K +L KP   +L      +   L  ++A + Y+SA              Y+   + T +  D+ A                ++P  L+ +TR PL+++VDS  S  ++ + SPF  PL+CLLSP   P
Sbjct:  200 RLAPSEALALPHSLLVPTPLTLADAILVGNCAEQVKFSELTLDMFRMLQALERTPRGHVAPADRTPPARPQEPPERRRENPHKYLLYKPTFSQLYTFVATAFRELPPDSALLLYLSASGVFPPSDCKERGPYEQGGVMTYTRRDTAAPDPLVKCNCSSQNLTGLHPGDLLPFTRKPLVVVVDSPSSSAYKGVYSPFGVPLLCLLSPTSCP 409          
BLAST of SMED30027352 vs. Ensembl Nematostella
Match: EDO34366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK0])

HSP 1 Score: 60.8474 bits (146), Expect = 2.947e-9
Identity = 54/211 (25.59%), Postives = 82/211 (38.86%), Query Frame = 3
Query: 2706 STNQNIISHSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPK----------------------------CCLRNPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKITVS-----DDDSGAS-----------INPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            S +    S S L+L E+II    EKQ++F   T D+FR+ Q  E  P+                                NP K +L KP   ++          L  N   + Y+S D+            Y+   +  S     +++ GA            + P+ LV  TR PLL++VD   S  F+   + F +PL+CL+SP   P
Sbjct:  224 SMHAGPPSGSVLSLQEIIIIGNCEKQVKFSELTLDMFRMLQALEREPEENPPRTLETSMSNEQLPEDRSSTETSINPKRPNPHKYLLYKPTFAQIHVFLSVGFKELPTNGVLMVYVSGDACVGSSRQGDDGPYEQGGVLTSQRKTGNEEGGAKRRPTNTKEAHCLYPDDLVPLTRKPLLVVVDCPSSHAFKFFPNLFGQPLLCLMSPSSAP 434          
BLAST of SMED30027352 vs. Ensembl Medaka
Match: scai (suppressor of cancer cell invasion [Source:NCBI gene;Acc:101156422])

HSP 1 Score: 60.4622 bits (145), Expect = 1.100e-8
Identity = 52/193 (26.94%), Postives = 79/193 (40.93%), Query Frame = 3
Query: 2733 SSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLP-----------------KCCLR-NPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISA-------------DSYDLNKI---TVSDDDSGASI-------------NPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
              L L++ +I      Q++F   T D+FR+ Q  E  P                 K   R NP K +L KP   +L      S   L  N+  + Y+SA               YD   +   T  D  +G ++             +P  L  +TR PL +IVDS +S  +++  + F +PL+CLLSP + P
Sbjct:  230 GQLVLADALIIGNCNNQVKFSELTIDMFRMLQALEREPVNLATQTSKQGTLEPNEKPAKRENPHKYLLYKPTFSQLFTFLSASFKELPANSVLLIYLSATGVFPTGHSDYEVGGYDFGGVLTNTNRDIVNGETVQKRIQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSAAYKNFTNLFGQPLVCLLSPTMYP 422          
BLAST of SMED30027352 vs. Planmine SMEST
Match: SMESG000075968.1 (SMESG000075968.1)

HSP 1 Score: 432.565 bits (1111), Expect = 9.206e-138
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 3
Query: 2541 EFKVFISINKSLMQADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADSYDLNKITVSDDDSGASINPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPPESK 3182
            EFKVFISINKSLMQADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADSYDLNKITVSDDDSGASINPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPPESK
Sbjct:  149 EFKVFISINKSLMQADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNIISHSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADSYDLNKITVSDDDSGASINPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPPESK 362          
BLAST of SMED30027352 vs. Planmine SMEST
Match: SMESG000075966.1 (SMESG000075966.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.070e-8
Identity = 38/127 (29.92%), Postives = 59/127 (46.46%), Query Frame = 3
Query: 2865 PIKRVLNKPRLHELKACFLRSITRLKFNNAFVCYISADS------------YDLNKITVSDD---DSGAS----------INPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILP 3170
            P K +L +P L E  +     +  L  N   + Y+S D             Y+L  +  S +    +G S          I+P  L  YTR PL +IVDS +S  F++  + F++PL+CL+SP  +P
Sbjct:  332 PHKYLLYRPTLPEFNSYLATCMKELPLNGGILIYLSCDGLKSTPSKNDVEGYELGGVITSGNREYSTGKSKKRQVKEMCCIHPGDLYIYTRKPLFIIVDSNNSTAFQNFSNLFDQPLVCLMSPEQVP 458          
The following BLAST results are available for this feature:
BLAST of SMED30027352 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCAI2.422e-927.75suppressor of cancer cell invasion [Source:HGNC Sy... [more]
SCAI3.144e-927.75suppressor of cancer cell invasion [Source:HGNC Sy... [more]
SCAI3.173e-927.75suppressor of cancer cell invasion [Source:HGNC Sy... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027352 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG132933.893e-822.58gene:FBgn0035677 transcript:FBtr0332064[more]
CG132933.893e-822.58gene:FBgn0035677 transcript:FBtr0332061[more]
CG132934.350e-822.58gene:FBgn0035677 transcript:FBtr0332063[more]
CG132934.478e-822.58gene:FBgn0035677 transcript:FBtr0332062[more]
back to top
BLAST of SMED30027352 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scai8.302e-1027.60suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai3.578e-827.32suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai4.453e-827.32suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai4.474e-827.32suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai4.813e-827.32suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCAI5.881e-927.49suppressor of cancer cell invasion [Source:NCBI ge... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Scai2.518e-927.27suppressor of cancer cell invasion [Source:MGI Sym... [more]
Scai3.255e-927.27suppressor of cancer cell invasion [Source:MGI Sym... [more]
back to top
BLAST of SMED30027352 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8N9R8|SCAI_HUMAN1.510e-827.75Protein SCAI OS=Homo sapiens OX=9606 GN=SCAI PE=1 ... [more]
sp|Q8C8N2|SCAI_MOUSE2.277e-827.27Protein SCAI OS=Mus musculus OX=10090 GN=Scai PE=1... [more]
back to top
BLAST of SMED30027352 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JH127.729e-1328.16Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3S0ZUT26.547e-1226.94Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
V3ZS628.323e-1227.05Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7NL031.457e-1025.29Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0L8IHM02.546e-1026.59Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai3.296e-726.70suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai2.096e-725.71suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027352 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343662.947e-925.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027352 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai1.100e-826.94suppressor of cancer cell invasion [Source:NCBI ge... [more]
back to top
BLAST of SMED30027352 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075968.19.206e-138100.00SMESG000075968.1[more]
SMESG000075966.11.070e-829.92SMESG000075966.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027352 ID=SMED30027352|Name=SMED30027352|organism=Schmidtea mediterranea sexual|type=transcript|length=4273bp
ATTCTTATCCCATTTTTAATTCTGTCGAAATCACTTTTAATAGCTTCAAT
TACTCGTTTGTTATCCGCAGTAGATAATATCTTTAAGTTAACTGAGGTTA
GAAGAAAAACTTACATATTTCGATGGTTTCTTCTGCCTACTGTCTTTCCT
CCAATATAAGAACCGGTTCTTTAATTCAAAATAAATGCCAAAATAAAAGA
AGTTTTTAACGGTGTTAATCACCCAAAAAAAAAGAAATTACAATAACAAA
CTATGTTGGATATTTTGAAATAAATAATTGAGTTTTAAAAGTTATATCTT
TAAACTAGCCGTAATCCCGTGCTTTGCTACGGTTATATTTAAGATGATGA
TTAACAATGAACAATTTAAAAGTGATAAACAAACAGACTTTTATCTATAA
GATAAATAAATAGCAAAATGATTGAGTTGTAAAATGTTATTAAATATTAG
TTTTTTTGTTGTAAATCCTAACTATATATTTATTTTTTATAACAGATTTA
AGTATATTTTTCATTTTGTATATAGTGAAAGAAGTCTTGCTATACTAATT
ACAAGCACTTTATTAGACTGTTCTCATTTGTTTAAAGAAATTTTTCGTGC
TCTTCAAAAATAACAGTCATTTTTGTTGGAATATCAATTATTCTTAACAC
ATGTTTATCTTTAATAGCGTTCACAATTATATGACGTTTTATCGTTCAAA
TCTATGAATTCTTTATTCTTTTTCTCTCCCTAATGATTGGTGTAATACTG
ATGATATTAAATTTGAATTCATTGGTAGGCCTTTATAGAAACGTATCTAC
TAAACGCATTTATATGAAAACATTAATATTCACAGTATAAATGTTCTAAA
TATTATCCCAATATTCTTTTTTATCTCTGTCGCGAAAAAGTCATTGACAT
GCAACGAAACTCGACATTGGAAACAATTTTCATTTCCTACCAACGTTTAG
CAGGAATGTTTGTTTTTTAGGTTGACGTATATACTTTGCACTTAATTCTT
TTAGGACTTGATTAAGTGTATTGACGCTTAATTTTCTATGTTTTACTTGT
GTTTATCGGTTATCTCCCATCCACTATGTTTGAAAATTCAAAAGATTCAG
AAAGCCAAATAGGTAAATATGATACATGGAAACATGTTATCATTTTATGC
TTTTGACACCACATAAGGGTACATATTTCATTCAGTTCCACAGTTTTAGT
TTTTTATATTCGCATTTTGCAACATATATTTTCCAAGGCTATCTTTGATC
CAGTTAACGTACTTGTTTATGAATCTTTAAGTCATTTTATTGCAAACATA
AACATTATATATGTGAAAAGTGATTGATAAGTGGTGGCGTTTAACCAAAT
GCTACCACTCTACTTGTACATGTCTTTAATAACCAAAGAAAAATACCATT
TTCTATAATTGTATCAGATAGGCATGTACTAAAATATATAATTTCGTTAT
TTTGAAAAGTTTAAATATTCACATTGAGTCATTTTGAACATTGTCTTTTA
GTATGTATGTTCATATTGATAACTCGCAAACGGTCTCTGTATATATTTAT
GAAGTTATTTGATGATTTTTTTTAAATCAGGCATCTTAATTCATTCTAAA
AACTTTATTATGTGATTTAAAAAATACTCAGTGAAAAGTTTGTGATTTAT
TGATGATCAATTCGTTACATCATAAATTCAATGTTCAAAATGCTTTTTTA
AAAATTTAATCAAATTCATGAGGAAGGAAATTAAAATGTTTTAGTACATT
TTCTAAAAACAAATTTTAATTCAATTAAAAACCTGTTCTAAATTGTTTGA
ATTGTCTAATATCCCTTTGTTACATTGAAACATTACATAAAACCAAATCA
TCAATACTTAGCCAGACTTCGAGCAGTTGTAGTTATCTTTTATATGCGTT
CAGAAATCCGATCGCTTAAAGGGTCAAGTGACCTCCGCTATGAAGATGAT
GCCAACAGATATGCTACAAACCAACACTACTTACTAATTCAATCTTCATA
TTTTTCGTAACGACCTTTGCGAACTAAAATAATAATCATGAAATGTAGAT
CCAATGGATATTGTGTAATGAGGATTATGAAAAATAAATTACATTAAATA
CATTCTGATGTGCTTATTTCTTTAGCGATATGTGATTTATAAAAATAGGA
ACCATCTACTTACATTTCTACGTAAATTTGTCTACTTTTGAGACATGGAA
TTATGAATAAAAATTTTTAATGTCTGCGCATATGCAGACCATGCCAGTTC
AAGTGTTAAAATTACAGTTTTACAAATCCTAATACAATTATTTATACTGC
AATTAGGATCAGTTGAATATGAGAAAAGAGAAATACATATTTATTTTTTA
ATTTTCTTTCATGAAACGATAAAATTTTCAGCATAATGGTCCACCAAATC
ATTCCATTTAGCCATTTACCTTTTTATGATACAGGGTTATGGTCAGCGAT
AAGATTTACTACATCTTTATTCTCTTTTTCTGTTATTTTTGAAAACGATT
TATACACAATTTTTCTACTTTAACTTTCATTAACCTTTAGGAATTCAAAG
TCTTCATTTCCATTAACAAAAGTCTTATGCAAGCGGACAAATTTTACACT
TATAATGATTGTATAACTCGTACAAATAATTTTTATAATTCATTGCAACT
GTTCAATGTTGTCGAAACAAACAGTGATTTCTACAATATAGAAAATCGGT
TGGTCTCTACTAATCAGAATATAATCTCACACAGCTCGTTGACATTGTCC
GAAGTTATTATTTGTTCATTTACCGAGAAACAAATTGAATTCGACGGCCG
AACTCCTGACATTTTCAGAGTGTGGCAATTGTTTGAATGTTTGCCGAAAT
GTTGTTTAAGGAATCCCATTAAAAGGGTTCTAAATAAGCCAAGACTTCAC
GAATTAAAAGCTTGCTTTCTTCGATCAATTACGCGCCTGAAGTTTAATAA
TGCTTTTGTCTGTTATATTTCAGCGGATTCATATGATCTCAATAAAATAA
CTGTAAGTGATGATGATTCAGGTGCAAGCATTAATCCGAATTTATTGGTT
TGTTATACAAGAGCACCACTTTTATTGATAGTCGATAGCAAAGATAGTGA
TATATTCAGGGATTTGAAGAGTCCATTTAACAAACCCCTAATATGTCTAT
TATCTCCAAGAATCCTACCGCCAGAATCAAAATGTTAGTTATAATTTAGG
AGATTTTTGAATTTTAAAATTAAATCTTTAAATAATATTGATTTTATCTT
AAAAACCTAATATAAGCACATTATAATTTCAAAATTTATGAAATCGAATA
ATTAAAATAAAATATCGATATTAAGACAAAATTTTCATAAAATATAACAA
TTTAATCAAAATATAAACAATTTTAATTTTTCAATTTAAATTCTCTTTTA
ATTGATATGTTATTCTTTTCTATTATCATAAATTTTGGTTCACCTTTTAT
TTATCTGTTGTGTAAAATTTCAATTAATTTAAGGATTAAATAAACATTAC
AGAAATGTAAACACAAGAAAGCGCCATTCAAACACACGCTTTATGATTTA
TTTTTGACATAAATAAATAAATTTTAAATAATTTTTCAGCAAAACTTTGC
CTAATTAAGAAATTCAAGCTCAAAAGTTCAATCAATATAAATTATTTTAT
TTGCATAATATTAAAAGGATATATTTTTTAACTAATAAGGTTGTTTGACG
AAAAATAATCTTACAATATTTTACCTTTATTAAAAATCTTTTTTTACTAT
ATTGCACGTACAGATTTTAACACCGAAGAAATTTATTAGCGCCAACTGCA
AAAATGTAAAAATATTTTATCATCGTCAGAATTCCCATAGACCAGCTAAG
ATAAAGGTTAGAAAATTGCGAAACACGTTATCTATTTTATGTAAAAATTA
TAAACTCTTTTTTTTCTAGTCATGAATATAATAATAATGTATGAAGACTT
CATCTATAAAGATAAGTAAAATATTTCAAAATTAATTGCACTATCAATAA
ATCCCAGCTGTTGGACAAAATCGAAATGATCATCGAGAACTTAACAGGTG
CAAGTTTTCCGGATTAGTGTTAAGAAGATATTTGTATGTCATACAAATTT
TTATATAAATTTTATTACATATTGAAATTGTGTGATTATAAAACCAAATA
ATAAGTAACAATATTCAAGGTCTTGGTGAATTTCAGATCATGTCAGGTAA
GTAAATCACTTATCAGTTGCTAAATACAAGAAAACTTTCAAATTTGATAT
TACAATAAAACTATGTGAAAATC
back to top

protein sequence of SMED30027352-orf-1

>SMED30027352-orf-1 ID=SMED30027352-orf-1|Name=SMED30027352-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MQADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENRLVSTNQNII
SHSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPIKR
VLNKPRLHELKACFLRSITRLKFNNAFVCYISADSYDLNKITVSDDDSGA
SINPNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPPE
SKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000651Ras-like_Gua-exchang_fac_N
IPR022709SCAI
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:1903507negative regulation of nucleic acid-templated transcription
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022709Protein SCAIPFAMPF12070SCAIcoord: 148..200
e-value: 9.4E-12
score: 44.6
coord: 9..90
e-value: 1.4E-6
score: 27.5
NoneNo IPR availablePANTHERPTHR21243:SF15PROTEIN SCAIcoord: 151..195
NoneNo IPR availablePANTHERPTHR21243FAMILY NOT NAMEDcoord: 151..195