CLUMA_CG020609, isoform A

Overview
NameCLUMA_CG020609, isoform A
Smed IDSMED30027349
Length (bp)3945
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CLUMA_CG020609, isoform A (SMED30027349) t-SNE clustered cells

Violin plots show distribution of expression levels for CLUMA_CG020609, isoform A (SMED30027349) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CLUMA_CG020609, isoform A (SMED30027349) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CLUMA_CG020609, isoform A (SMED30027349) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027349

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027349SMESG000075557.1 Contig4121GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027349SMESG000019984.1 Contig4121GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30027349SMESG000019986.1 SmedASXL_005690SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30027349SMESG000019986.1 dd_Smed_v4_1706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027349SMESG000019986.1 dd_Smed_v4_6531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30027349SMESG000019984.1 dd_Smed_v4_396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027349SMESG000019984.1 dd_Smed_v4_396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027349SMESG000019986.1 dd_1706dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027349SMESG000019986.1 dd_1706dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
intestinal phagocyteSMED30027349SMESG000019984.1 dd_Smed_v6_396_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30027349SMESG000019986.1 dd_Smed_v6_1706_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Human
Match: PSAPL1 (prosaposin like 1 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:33131])

HSP 1 Score: 63.5438 bits (153), Expect = 1.691e-9
Identity = 78/419 (18.62%), Postives = 158/419 (37.71%), Query Frame = 1
Query:  958 KCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVL---VDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINS----------------NEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCR---ADEK-------KRIPLIKMVKPKTVARHHNKG---CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDH--------CQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
             C++C+++       +N     ++I   V+  C    S       K+        I S+L    D  P +VC  L++C    +H  + + L   +TF  +                     C+ C   +  ++     + TL  +   + + C          CK    QF+V     +R  + P+ +C+K  FC    A  +         +P +++  P+  +    K    C+ CM +V++ ++ +  + S   I   +  +C +  A++   CI         ++  ++A  +P K+C+ I LC + +  R  ++   ++       P+P+         C  C  ++     N  +  +  +I       CSI    +   C  +       +IES+    +P  VC+K+  CH
Sbjct:   63 PCDVCQDIAAAAGNGLNPDATESDILALVMKTCEWLPSQESSAGCKWMVDAHSSAILSMLRGAPDSAPAQVCTALSLCEPLQRHLATLRPLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLN--IQEQCESLGPGLAVLCKNYLFQFFVPADQALR-LLPPQELCRKGGFCEELGAPARLTQVVAMDGVPSLELGLPRKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMITHALERVCSVMPASITKECIILVDTYSPSLVQ-LVAKITPEKVCKFIRLCGNRRRARAVHDAYAIV-------PSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDILVAFKGGCSILPLPYMIQCKHFVTQYEPVLIESLKDMMDPVAVCKKVGACH 470          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 62.7734 bits (151), Expect = 3.355e-9
Identity = 38/177 (21.47%), Postives = 76/177 (42.94%), Query Frame = 2
Query: 3230 CDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPS 3760
            C++C  +V+    +I+N+   + IL    ++C  L   +  +C E     G  +L  +L + +   VC ++++C          +   L + V QP+    C  C   + + + N+   +  + +       CS +  PY   C  F +     +I+ +++  DP  VC  +  CPS
Sbjct:  315 CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG-------TRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS 484          

HSP 2 Score: 59.3066 bits (142), Expect = 4.329e-8
Identity = 78/428 (18.22%), Postives = 160/428 (37.38%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQF--LDLLNTFTTINSN------------------EKCKICRIHIQLIERIYNRSKTLEQ-MQAVVD---DFCGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFC--------------RADEKKRIPLIKMVKP---KTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            C++CK+++      +        I   +   C     P      K      L VI  ++  E   P +VC  L +C         L H +  ES +   LD+        +N                  +   +C+  IQ++  I    +T    +QA+V+   + C          CK +   Y ++ +++   + P+ +C  + FC              +   K  IP +++V+P     V    +  C+ C ++VK    +++ + + + I      +C     ++   C       G  +++ +L   SP  +C +++LC   +        L  L +H  +      C+ C  ++ + ++N   + +  EI   L + CS     +   C ++       +IE +++  +P  VC K+  C
Sbjct:   63 CDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTR--------LPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGAC 482          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 62.3882 bits (150), Expect = 3.805e-9
Identity = 38/177 (21.47%), Postives = 76/177 (42.94%), Query Frame = 2
Query: 3230 CDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPS 3760
            C++C  +V+    +I+N+   + IL    ++C  L   +  +C E     G  +L  +L + +   VC ++++C          +   L + V QP+    C  C   + + + N+   +  + +       CS +  PY   C  F +     +I+ +++  DP  VC  +  CPS
Sbjct:  318 CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG-------TRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS 487          

HSP 2 Score: 55.0694 bits (131), Expect = 7.038e-7
Identity = 43/230 (18.70%), Postives = 93/230 (40.43%), Query Frame = 1
Query: 1441 PRTVCQKLEFC--------------RADEKKRIPLIKMVKP---KTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            P+ +C  + FC              +   K  IP +++V+P     V    +  C+ C ++VK    +++ + + + I      +C     ++   C       G  +++ +L   SP  +C +++LC   +        L  L +H  +      C+ C  ++ + ++N   + +  EI   L + CS     +   C ++       +IE +++  +P  VC K+  C
Sbjct:  264 PKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTR--------LPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGAC 485          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Fly
Match: Sap-r (gene:FBgn0000416 transcript:FBtr0085714)

HSP 1 Score: 77.411 bits (189), Expect = 6.390e-14
Identity = 80/420 (19.05%), Postives = 168/420 (40.00%), Query Frame = 1
Query:  658 CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNT-----------------FTTINSNEK----------------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVA--RHHNK---------GCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLC 1773
            CT C   L FI++ +      ++++H++ + C          C+          I  ++   + +++C  + +C   +     +EV N     DE      C LC   ++  ++ +    +  NI+  +   C+   +  K++C+ F      E+I  ++ D  P ++C +L +C K      +Y   DL  +                 F  I S E+                C IC   ++ +E+   +  T + ++ ++++ C     P    C +   K G ++ + +L    P+ +C +L  C   +   + + + +K   +A  R  NK          C  C +I+ + +  +      + I+  +  +C+   ATV+  C TF  G    V+  +L+   P+++CQ + LC
Sbjct:  360 CTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQD-PPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPK-----TTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIEAVCNRLPATVRKQCDTFVDGYASAVLK-LLSDVPPKQVCQKLQLC 772          

HSP 2 Score: 67.781 bits (164), Expect = 6.002e-11
Identity = 64/321 (19.94%), Postives = 126/321 (39.25%), Query Frame = 1
Query: 1213 QFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEV----REKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKG-CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQ-------------------SDKERRQENNFLDL-----LLIHFHRKP---APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
              +   N    +   E C +C   +  I+       T ++++  V++ C          C+ F    G  V     + + PR VC  ++ C  +  K+   +++  P+  +   +   C  C++ V++ +  +  + S + I+  + GLC      +K  C+ F      E+I+ ++    P++IC  + LC                     DK   +E +F D+     L       P   A  +C  C  ++K  EK      +   I+  L E C   ++     C +  +  G +I + +LK+ +PK +C +L  C
Sbjct:  343 HLMGAANPGALVEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKED-VEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMC 662          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Fly
Match: Sap-r (gene:FBgn0000416 transcript:FBtr0085713)

HSP 1 Score: 77.411 bits (189), Expect = 7.166e-14
Identity = 80/420 (19.05%), Postives = 168/420 (40.00%), Query Frame = 1
Query:  658 CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNT-----------------FTTINSNEK----------------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVA--RHHNK---------GCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLC 1773
            CT C   L FI++ +      ++++H++ + C          C+          I  ++   + +++C  + +C   +     +EV N     DE      C LC   ++  ++ +    +  NI+  +   C+   +  K++C+ F      E+I  ++ D  P ++C +L +C K      +Y   DL  +                 F  I S E+                C IC   ++ +E+   +  T + ++ ++++ C     P    C +   K G ++ + +L    P+ +C +L  C   +   + + + +K   +A  R  NK          C  C +I+ + +  +      + I+  +  +C+   ATV+  C TF  G    V+  +L+   P+++CQ + LC
Sbjct:  437 CTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQD-PPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPK-----TTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIEAVCNRLPATVRKQCDTFVDGYASAVLK-LLSDVPPKQVCQKLQLC 849          

HSP 2 Score: 67.781 bits (164), Expect = 5.674e-11
Identity = 64/321 (19.94%), Postives = 126/321 (39.25%), Query Frame = 1
Query: 1213 QFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEV----REKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKG-CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQ-------------------SDKERRQENNFLDL-----LLIHFHRKP---APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
              +   N    +   E C +C   +  I+       T ++++  V++ C          C+ F    G  V     + + PR VC  ++ C  +  K+   +++  P+  +   +   C  C++ V++ +  +  + S + I+  + GLC      +K  C+ F      E+I+ ++    P++IC  + LC                     DK   +E +F D+     L       P   A  +C  C  ++K  EK      +   I+  L E C   ++     C +  +  G +I + +LK+ +PK +C +L  C
Sbjct:  420 HLMGAANPGALVEGGELCTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKED-VEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLCPKTTYALWDLRISLEDDVDGEDKSSSEEISFNDIESLEELPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDKYGDKIADLLLKEMDPKLICTELGMC 739          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 58.9214 bits (141), Expect = 2.982e-8
Identity = 84/438 (19.18%), Postives = 165/438 (37.67%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPA-KDKC---IKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLD---------------LLNTFTTINSNEK-------CKICRIHIQLIERIYNRSKT----LEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL---PRTVCQKLEFCRADEK----------KRIPLIKMVKP----KTVARHHNKG---------CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQS-------DKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQ 2085
            C+LCK ++ ++E  +   +  + +   +  AC +       ++C   +  Y  + + +I+  L  +DP  VC  L +C+         Q                  LLN    +   EK         +C+  +  I    + ++     +  + A V++ C +        CK++  + G  V ++++   P+ +C +  FC   +K          K IP +KM       K VA    K          C  C +++K  EN++    S   I   V  +C+I  +T+   C    +  G  +I+ ++    P+ +C  + LC         DK+             HF    A   C  C   +++ +     + +  EI+  +L+ CS       + C +        +++ +L+  +P  VC KL  C +
Sbjct:   61 CDLCKEVLVVVEQLLKDNVTESELLGYLEKACQLIPDEGLANQCKEIVDNYFPVLMGIIQGEL--DDPGVVCGALGLCVSQQAALAKAQLTSNEIPQVDLNQRVSPFLLNIPQLLYPEEKRETPKQKGDVCQDCVTFINDTQDEARVNSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMSMQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEKVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSGVSHVPVMDKQ-------------HFA---AGGFCDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDFVCMKLGACPE 480          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 58.5362 bits (140), Expect = 4.184e-8
Identity = 84/440 (19.09%), Postives = 165/440 (37.50%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPA-KDKC---IKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLD---------------LLNTFTTINSNEK-------CKICRIHIQLIERIYNRSKT----LEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL-----PRTVCQKLEFCRADEK----------KRIPLIKMVKP----KTVARHHNKG---------CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQS-------DKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQ 2085
            C+LCK ++ ++E  +   +  + +   +  AC +       ++C   +  Y  + + +I+  L  +DP  VC  L +C+         Q                  LLN    +   EK         +C+  +  I    + ++     +  + A V++ C +        CK++  + G  V ++++     P+ +C +  FC   +K          K IP +KM       K VA    K          C  C +++K  EN++    S   I   V  +C+I  +T+   C    +  G  +I+ ++    P+ +C  + LC         DK+             HF    A   C  C   +++ +     + +  EI+  +L+ CS       + C +        +++ +L+  +P  VC KL  C +
Sbjct:   61 CDLCKEVLVVVEQLLKDNVTESELLGYLEKACQLIPDEGLANQCKEIVDNYFPVLMGIIQGEL--DDPGVVCGALGLCVSQQAALAKAQLTSNEIPQVDLNQRVSPFLLNIPQLLYPEEKRETPKQKGDVCQDCVTFINDTQDEARVNSSFISTLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMSMEQQPKDICARAGFCPTKQKSVPMEKLLPAKSIPAVKMFPAVKVEKPVATMPAKNLVRVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEKVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALCSGVSHVPVMDKQ-------------HFA---AGGFCDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDFVCMKLGACPE 482          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 68.5514 bits (166), Expect = 3.850e-11
Identity = 78/422 (18.48%), Postives = 168/422 (39.81%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQFLD----------LLNTFTTINSNEKC-------KICRIHIQLIERIYNRSKTLEQMQAVVDDF----CGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKT------VARHHNKG----CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFL---DLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C++CK +I ++   +   +    I++ +   C +   P      K        ++ ++L  E  +P  +C  L +C         LKH +   + +  D          ++N    +N  E+         IC   ++L+  + +  ++       + D     C + +      CK +   +  V ++V  ++ P+ +C  + FC  D++K  PL  ++  KT      +  +   G    C+ C  ++ + E +++ + + E I+  +  +C +  A     C    +     +I  +    +P+ IC  +  C + ++  Q  N L    LL I   +  A D+C  C  M+K+ ++    + + + I+  L   C+       + C    N      ++ +L+  +P  +C KLH C 
Sbjct:   27 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFC--DQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ 446          

HSP 2 Score: 62.003 bits (149), Expect = 4.307e-9
Identity = 60/310 (19.35%), Postives = 133/310 (42.90%), Query Frame = 1
Query:  928 EVFDEISVNQKCNLCKNMIKLLEISVNKTLN-ATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEK-----------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCRADEK--------KRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDK 1785
            E F E      CN C  ++  ++ ++    + + N+ +  L+ C +      + C K Y     +V   VL+   P ++C  +  C       +S    +++   T I + +            C++C++ I  IE++ + ++T E ++  ++  C +    Y   C+    ++Y  +   + ++  P+ +C  L +C A  K        + IPL+K+   K  A  +   C  C  ++K  + ++ K+ +   I+  +  +C+    ++++ C           +  +L +  P  IC  ++LCQS+K
Sbjct:  148 ETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMC-KSYINQFSDVAIQVLLQMQPKQLCSMVGFC----DQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDY---CTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEK 449          

HSP 3 Score: 53.5286 bits (127), Expect = 2.287e-6
Identity = 62/308 (20.13%), Postives = 132/308 (42.86%), Query Frame = 1
Query:  301 LDSEISTADQPRVHRNKCEICQGIMTRYKSAIDMSLS-TKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLID---IFQQPTTKQ---CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMR---VVDPNTLEVINMSEVFDE-ISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKC---IKFYQGLGLEVIKSVLVDEDPTKVCKKLTIC 1182
            L+ +  T  +P+   + C  C  +++  + A+  + S +K++ +  L  C+  D    ++C ++        I+ + + +   ++C ++  C  E S    N++    LI    I + P       C  C   +  IE+ ++     E ++HSL   C++        C+ +        I+ +   ++ + IC  L  C  R   + + N L  I + ++  E  +    C +CK M+K ++  + K      I+N +   C       +D+C   +  Y+ L ++++   L   DP+ +C KL +C
Sbjct:  143 LNPQEETFKEPKTG-DICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPK-QLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQNGNMLRGIPLLKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEAL---DPSFICAKLHLC 445          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 60.077 bits (144), Expect = 2.274e-8
Identity = 74/419 (17.66%), Postives = 165/419 (39.38%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQFLD----------LLNTFTTINSNEKC-------KICRIHIQLIERIYNRSKTLEQMQAVVDDF----CGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKT------VARHHNKG----CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C++CK +I ++   +   +    I++ +   C +   P      K        ++ ++L  E  +P  +C  L +C         LKH +   + +  D          ++N    +N  E+         IC   ++L+  + +  ++       + D     C + +      CK +   +  V ++V  ++ P+ +C  + FC  D++K  PL  ++  KT      +  +   G    C+ C  ++ + E +++ + + E I+  +  +C +  A     C    +     +I  +    +P+ IC  +  C + ++  Q       + I   +  A D+C  C  M+K+ ++    + + + I+  L   C+       + C    N      ++ +L+  +P  +C KLH C 
Sbjct:   26 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFC--DQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQN------VKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ 436          

HSP 2 Score: 56.6102 bits (135), Expect = 2.158e-7
Identity = 57/302 (18.87%), Postives = 131/302 (43.38%), Query Frame = 1
Query:  928 EVFDEISVNQKCNLCKNMIKLLEISVNKTLN-ATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEK-----------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDK 1785
            E F E      CN C  ++  ++ ++    + + N+ +  L+ C +      + C K Y     +V   VL+   P ++C  +  C       +S    +++   T I + +            C++C++ I  IE++ + ++T E ++  ++  C +    Y   C+    ++Y  +   + ++  P+ +C  L +C A  +K +  +K+   K  A  +   C  C  ++K  + ++ K+ +   I+  +  +C+    ++++ C           +  +L +  P  IC  ++LCQS+K
Sbjct:  147 ETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMC-KSYINQFSDVAIQVLLQMQPKQLCSMVGFC----DQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSA-RRKNLQNVKISAEKAAAGDY---CTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEK 439          

HSP 3 Score: 51.6026 bits (122), Expect = 8.476e-6
Identity = 60/304 (19.74%), Postives = 130/304 (42.76%), Query Frame = 1
Query:  301 LDSEISTADQPRVHRNKCEICQGIMTRYKSAIDMSLS-TKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLID---IFQQPTTKQ---CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKC---IKFYQGLGLEVIKSVLVDEDPTKVCKKLTIC 1182
            L+ +  T  +P+   + C  C  +++  + A+  + S +K++ +  L  C+  D    ++C ++        I+ + + +   ++C ++  C  E S    N++    LI    I + P       C  C   +  IE+ ++     E ++HSL   C++        C+ +        I+ +   ++ + IC  L  C  R      L+ + +S   ++ +    C +CK M+K ++  + K      I+N +   C       +D+C   +  Y+ L ++++   L   DP+ +C KL +C
Sbjct:  142 LNPQEETFKEPKTG-DICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPK-QLCSMVGFCDQEKSTPLQNIIPAKTLIPAAKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARR---KNLQNVKISA--EKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEAL---DPSFICAKLHLC 435          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 58.5362 bits (140), Expect = 6.134e-8
Identity = 74/425 (17.41%), Postives = 165/425 (38.82%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQFLD----------LLNTFTTINSNEKC-------KICRIHIQLIERIYNRSKTLEQMQAVVDDF----CGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKT------------VARHHNKG----CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C++CK +I ++   +   +    I++ +   C +   P      K        ++ ++L  E  +P  +C  L +C         LKH +   + +  D          ++N    +N  E+         IC   ++L+  + +  ++       + D     C + +      CK +   +  V ++V  ++ P+ +C  + FC  D++K  PL  ++  KT            +  +   G    C+ C  ++ + E +++ + + E I+  +  +C +  A     C    +     +I  +    +P+ IC  +  C + ++  Q       + I   +  A D+C  C  M+K+ ++    + + + I+  L   C+       + C    N      ++ +L+  +P  +C KLH C 
Sbjct:   29 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFC--DQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQN------VKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ 445          

HSP 2 Score: 55.4546 bits (132), Expect = 4.893e-7
Identity = 57/308 (18.51%), Postives = 131/308 (42.53%), Query Frame = 1
Query:  928 EVFDEISVNQKCNLCKNMIKLLEISVNKTLN-ATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEK-----------------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDK 1785
            E F E      CN C  ++  ++ ++    + + N+ +  L+ C +      + C K Y     +V   VL+   P ++C  +  C       +S    +++   T I + +                  C++C++ I  IE++ + ++T E ++  ++  C +    Y   C+    ++Y  +   + ++  P+ +C  L +C A  +K +  +K+   K  A  +   C  C  ++K  + ++ K+ +   I+  +  +C+    ++++ C           +  +L +  P  IC  ++LCQS+K
Sbjct:  150 ETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMC-KSYINQFSDVAIQVLLQMQPKQLCSMVGFC----DQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSA-RRKNLQNVKISAEKAAAGDY---CTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEK 448          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 58.151 bits (139), Expect = 7.987e-8
Identity = 74/425 (17.41%), Postives = 165/425 (38.82%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQFLD----------LLNTFTTINSNEKC-------KICRIHIQLIERIYNRSKTLEQMQAVVDDF----CGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKT------------VARHHNKG----CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C++CK +I ++   +   +    I++ +   C +   P      K        ++ ++L  E  +P  +C  L +C         LKH +   + +  D          ++N    +N  E+         IC   ++L+  + +  ++       + D     C + +      CK +   +  V ++V  ++ P+ +C  + FC  D++K  PL  ++  KT            +  +   G    C+ C  ++ + E +++ + + E I+  +  +C +  A     C    +     +I  +    +P+ IC  +  C + ++  Q       + I   +  A D+C  C  M+K+ ++    + + + I+  L   C+       + C    N      ++ +L+  +P  +C KLH C 
Sbjct:    5 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFC--DQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQN------VKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ 421          

HSP 2 Score: 55.4546 bits (132), Expect = 5.537e-7
Identity = 59/318 (18.55%), Postives = 136/318 (42.77%), Query Frame = 1
Query:  901 NTLEVIN-MSEVFDEISVNQKCNLCKNMIKLLEISVNKTLN-ATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEK-----------------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDK 1785
            N  +++N   E F E      CN C  ++  ++ ++    + + N+ +  L+ C +      + C K Y     +V   VL+   P ++C  +  C       +S    +++   T I + +                  C++C++ I  IE++ + ++T E ++  ++  C +    Y   C+    ++Y  +   + ++  P+ +C  L +C A  +K +  +K+   K  A  +   C  C  ++K  + ++ K+ +   I+  +  +C+    ++++ C           +  +L +  P  IC  ++LCQS+K
Sbjct:  116 NVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMC-KSYINQFSDVAIQVLLQMQPKQLCSMVGFC----DQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSA-RRKNLQNVKISAEKAAAGDY---CTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEK 424          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Xenopus
Match: psap (prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy) [Source:NCBI gene;Acc:550039])

HSP 1 Score: 57.7658 bits (138), Expect = 1.086e-7
Identity = 74/425 (17.41%), Postives = 165/425 (38.82%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQFLD----------LLNTFTTINSNEKC-------KICRIHIQLIERIYNRSKTLEQMQAVVDDF----CGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKT------------VARHHNKG----CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C++CK +I ++   +   +    I++ +   C +   P      K        ++ ++L  E  +P  +C  L +C         LKH +   + +  D          ++N    +N  E+         IC   ++L+  + +  ++       + D     C + +      CK +   +  V ++V  ++ P+ +C  + FC  D++K  PL  ++  KT            +  +   G    C+ C  ++ + E +++ + + E I+  +  +C +  A     C    +     +I  +    +P+ IC  +  C + ++  Q       + I   +  A D+C  C  M+K+ ++    + + + I+  L   C+       + C    N      ++ +L+  +P  +C KLH C 
Sbjct:    8 CDMCKEVITVVGNFLKDNMTQGEIKDYLNKMCDLLPDPGLSATCKQELSEYFPIVLNMLEQELSNPGVLCSALGLCTSLQRHLASLKHPKQLLTNEIPDVDASKLVYPYIVNVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMCKSYINQFSDVAIQVLLQMQPKQLCSMVGFC--DQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSARRKNLQN------VKISAEKAAAGDYCTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQ 424          

HSP 2 Score: 54.6842 bits (130), Expect = 9.296e-7
Identity = 59/318 (18.55%), Postives = 136/318 (42.77%), Query Frame = 1
Query:  901 NTLEVIN-MSEVFDEISVNQKCNLCKNMIKLLEISVNKTLN-ATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEK-----------------CKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDK 1785
            N  +++N   E F E      CN C  ++  ++ ++    + + N+ +  L+ C +      + C K Y     +V   VL+   P ++C  +  C       +S    +++   T I + +                  C++C++ I  IE++ + ++T E ++  ++  C +    Y   C+    ++Y  +   + ++  P+ +C  L +C A  +K +  +K+   K  A  +   C  C  ++K  + ++ K+ +   I+  +  +C+    ++++ C           +  +L +  P  IC  ++LCQS+K
Sbjct:  119 NVPQLLNPQEETFKEPKTGDICNDCLKLVSDVQDALRSNASFSKNLVDHALHECELLDPGMAEMC-KSYINQFSDVAIQVLLQMQPKQLCSMVGFC----DQEKSTPLQNIIPAKTLIPAAKVQPAVKITENPLAGNGVFCEVCQLMISQIEKLLDNNRTKENIKHSLEKVCKLLPAEYSQKCEDIIEEYYDPLIELLEQEANPQFICTTLGYCSA-RRKNLQNVKISAEKAAAGDY---CTVCKMMMKYVDELLEKNATEIRIKNFLSRVCNFLPDSMQDECSGLVNQYEPLFVQLLLEALDPSFICAKLHLCQSEK 427          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Mouse
Match: Psapl1 (prosaposin-like 1 [Source:MGI Symbol;Acc:MGI:1924193])

HSP 1 Score: 56.6102 bits (135), Expect = 2.059e-7
Identity = 81/422 (19.19%), Postives = 160/422 (37.91%), Query Frame = 1
Query:  925 SEVFDEISVNQ-KCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTS---PAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTIC---LKHAQHHESYQFL---DLLNTFTTINSN----------EKCKICRIHIQLIERIYNRSKT-LEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVRE---KVLPRTVCQKLEFC---------RADEKKRIPLIKMVKPKTVARHHNKG--CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLL-IHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            S V+++ +V    C++C+++       VN     ++I   V+  C    S    AK K +       +  + S   + D   VC  LT+C    +H     S + L   D         SN           +  +C   +QLI  + +  ++ L   +  V + C          C+ +  +  +  ++    + P+ VC+K  FC         R      +P ++M  P+T       G  C  C+ +V+  +  +  + +   I   +  +C +    +   CIT       E++  +++  +P K+C+ I LC S +  R  +  +     +    +     CQ C  ++    +N ++  +  +I       C I    +   C  +       +IES+    NP  +C+K+  CH
Sbjct:   54 SAVWNKPTVKSLPCSVCQDVAAAAGNGVNPGATESDILTSVMKTCEWLPSQESSAKCKWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPLQRHLAETTSERPLTQEDANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQSMGPGLAALCENYIHRQFVPAKQTLQGLPPQEVCRKGGFCERESAHWLTRVAAVDGVPSLEMEMPRTNELQMQLGLTCDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPEPLVQQCITLVDTYSPELVQ-LMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIESLKFMMNPTDLCKKMGACH 474          
BLAST of CLUMA_CG020609, isoform A vs. UniProt/SwissProt
Match: sp|O13035|SAP_CHICK (Prosaposin OS=Gallus gallus OX=9031 GN=PSAP PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.400e-9
Identity = 50/226 (22.12%), Postives = 100/226 (44.25%), Query Frame = 1
Query: 1441 PRTVCQKLEFCRADEKKRIPL-----------IKM--VKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            P+ +C  + FC +   K +PL           +KM  V+  TV       C+ C  +VK    ++  + + E I  ++  +C +  A+VK+ C  F +  G  +I+ +L + +P  +C ++  C ++K  +Q              KPA   C  C  ++ + +K    + +  EI+  L + C    +  ++ CV++       +++ + +  +P  VC KL  C
Sbjct:  263 PKDICAMVGFCPS--VKSVPLQTLVPAQVVHEVKMETVEKATVQEKTFSVCEICETMVKEVTGLLESNKTEEEIVHEMEVVCYLLPASVKDQCKDFIEVYGQALIDMLLEATNPEAVCVMLKCCAANKPPQQP----------VVVKPAGGFCDICKMIVAYADKELEKNATTTEIEALLEKVCHFLPESVSDQCVQFVEQYEPVVVQLLAEMMDPTFVCTKLGVC 476          
BLAST of CLUMA_CG020609, isoform A vs. UniProt/SwissProt
Match: sp|Q6NUJ1|SAPL1_HUMAN (Proactivator polypeptide-like 1 OS=Homo sapiens OX=9606 GN=PSAPL1 PE=2 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 8.119e-9
Identity = 78/419 (18.62%), Postives = 158/419 (37.71%), Query Frame = 1
Query:  958 KCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVL---VDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINS----------------NEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCK----QFYVKVGLEVREKVLPRTVCQKLEFCR---ADEK-------KRIPLIKMVKPKTVARHHNKG---CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDH--------CQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
             C++C+++       +N     ++I   V+  C    S       K+        I S+L    D  P +VC  L++C    +H  + + L   +TF  +                     C+ C   +  ++     + TL  +   + + C          CK    QF+V     +R  + P+ +C+K  FC    A  +         +P +++  P+  +    K    C+ CM +V++ ++ +  + S   I   +  +C +  A++   CI         ++  ++A  +P K+C+ I LC + +  R  ++   ++       P+P+         C  C  ++     N  +  +  +I       CSI    +   C  +       +IES+    +P  VC+K+  CH
Sbjct:   63 PCDVCQDIAAAAGNGLNPDATESDILALVMKTCEWLPSQESSAGCKWMVDAHSSAILSMLRGAPDSAPAQVCTALSLCEPLQRHLATLRPLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLN--IQEQCESLGPGLAVLCKNYLFQFFVPADQALR-LLPPQELCRKGGFCEELGAPARLTQVVAMDGVPSLELGLPRKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMITHALERVCSVMPASITKECIILVDTYSPSLVQ-LVAKITPEKVCKFIRLCGNRRRARAVHDAYAIV-------PSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDILVAFKGGCSILPLPYMIQCKHFVTQYEPVLIESLKDMMDPVAVCKKVGACH 470          
BLAST of CLUMA_CG020609, isoform A vs. UniProt/SwissProt
Match: sp|P07602|SAP_HUMAN (Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 1.611e-8
Identity = 38/177 (21.47%), Postives = 76/177 (42.94%), Query Frame = 2
Query: 3230 CDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPS 3760
            C++C  +V+    +I+N+   + IL    ++C  L   +  +C E     G  +L  +L + +   VC ++++C          +   L + V QP+    C  C   + + + N+   +  + +       CS +  PY   C  F +     +I+ +++  DP  VC  +  CPS
Sbjct:  315 CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG-------TRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS 484          

HSP 2 Score: 59.3066 bits (142), Expect = 2.079e-7
Identity = 78/428 (18.22%), Postives = 160/428 (37.38%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE--DPTKVCKKLTIC---------LKHAQHHESYQF--LDLLNTFTTINSN------------------EKCKICRIHIQLIERIYNRSKTLEQ-MQAVVD---DFCGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFC--------------RADEKKRIPLIKMVKP---KTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            C++CK+++      +        I   +   C     P      K      L VI  ++  E   P +VC  L +C         L H +  ES +   LD+        +N                  +   +C+  IQ++  I    +T    +QA+V+   + C          CK +   Y ++ +++   + P+ +C  + FC              +   K  IP +++V+P     V    +  C+ C ++VK    +++ + + + I      +C     ++   C       G  +++ +L   SP  +C +++LC   +        L  L +H  +      C+ C  ++ + ++N   + +  EI   L + CS     +   C ++       +IE +++  +P  VC K+  C
Sbjct:   63 CDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTR--------LPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGAC 482          
BLAST of CLUMA_CG020609, isoform A vs. UniProt/SwissProt
Match: sp|Q8C1C1|SAPL1_MOUSE (Proactivator polypeptide-like 1 OS=Mus musculus OX=10090 GN=Psapl1 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 1.316e-6
Identity = 80/422 (18.96%), Postives = 163/422 (38.63%), Query Frame = 1
Query:  925 SEVFDEISVNQ-KCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTS---PAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTIC---LKHAQHHESYQFLD-----------LLNTFTTINSNE--KCKICRIHIQLIERIYNRSKT-LEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVRE---KVLPRTVCQKLEFC---------RADEKKRIPLIKMVKPKTVARHHNKG--CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLL-IHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            S V+++ +V    C++C+++       VN     ++I   V+  C    S    AK K +       +  + S   + D   VC  LT+C    +H     S + L            L N   + + ++  +  +C   +QLI  + +  ++ L   +  V + C          C+ +  +  +  ++    + P+ VC+K  FC         R      +P ++M  P+T       G  C  C+ +V+  +  +  + +   I   +  +C +    +   CIT       E++  +++  +P K+C+ I LC S +  R  +  +     +    +     CQ C  ++    +N ++  +  +I       C I    +   C  +       +IES+    NP  +C+K+  CH
Sbjct:   51 SAVWNKPTVKSLPCSVCQDVAAAAGNGVNPGATESDILTSVMKTCEWLPSQESSAKCKWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPLQRHLAETTSERPLTQEDANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQSMGPGLAALCENYIHRQFVPAKQTLQGLPPQEVCRKGGFCERESAHWLTRVAAVDGVPSLEMEMPRTNELQMQLGLTCDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPEPLVQQCITLVDTYSPELVQ-LMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIESLKFMMNPTDLCKKMGACH 471          
BLAST of CLUMA_CG020609, isoform A vs. UniProt/SwissProt
Match: sp|P26779|SAP_BOVIN (Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1 SV=3)

HSP 1 Score: 55.8398 bits (133), Expect = 2.048e-6
Identity = 79/433 (18.24%), Postives = 162/433 (37.41%), Query Frame = 1
Query:  961 CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKD----KCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTIC---------LKHAQHHESYQF--LDLLNTFTTINSN-------------------EKCKICRIHIQLIERIYNRSKTLEQ-MQAVVD---DFCGIFNCPYEYPCKQF---YVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARH-------------------HNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            C++CK++I      +        I   +   C     P       + +  Y  + L++IK  +    P +VC  L +C         L H +  ES Q   LD+        +N                       +C+  IQL+  +    +T    ++A+VD   + C          CK +   Y +V +++   + P+ +C    FC  DE K +P+  +V  + V+ +                    +  C+ C ++VK    +++ + + E I   +  +C     ++   C       G  +++ +L   SP  +C +++LC S          L    +    +     C+ C  ++ + ++N   + +  +I   L + CS    ++   C ++       +IE +++  +P  VC K+  C
Sbjct:   63 CDICKDVITAAGNLLKDNATEQEILMYLERTCDWLPKPNMSASCKEIVDSYLPVILDMIKGQM--SHPGEVCSALNLCESLQKHLAELNHQKQLESNQIPELDMAEVVAPFMANIPFLLYPQDGSHSKPQPKKANGNVCQDCIQLVTDVQEALRTNSTFVEALVDHAKEECDRLGPGMSDMCKNYINQYSEVAIQMVMHMQPKEICVLAGFC--DEVKEMPMKTLVPAEVVSENVIPALGLVEPIKKDPAPAKADIYCEVCEFVVKEVAKLIDNNRTEEEILHALDKVCSKLPTSLAEQCQEVVDTYGSSILSILLDEASPELVCSMLHLCSS--------RGLPAATVRVMPRKDGGFCEVCKKLVGYLDRNLEKNSTKEQILAALEKGCSFLPDQYRKQCDQFVTEYEPVLIEILVEVMDPSFVCLKIGAC 483          

HSP 2 Score: 55.0694 bits (131), Expect = 3.733e-6
Identity = 38/178 (21.35%), Postives = 74/178 (41.57%), Query Frame = 2
Query: 3230 CDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDA-CTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPS 3760
            C++C  VV+    +I+N+     IL  + +VC  L   +  QC E     G  +L  +L + +   VC ++++C +        + M        P+     C  C   + + + N+   +  E++       CS +   Y   C  F +     +I+ +++  DP  VC  +  CP+
Sbjct:  316 CEVCEFVVKEVAKLIDNNRTEEEILHALDKVCSKLPTSLAEQCQEVVDTYGSSILSILLDEASPELVCSMLHLCSSRGLPAATVRVM--------PRKDGGFCEVCKKLVGYLDRNLEKNSTKEQILAALEKGCSFLPDQYRKQCDQFVTEYEPVLIEILVEVMDPSFVCLKIGACPA 485          
BLAST of CLUMA_CG020609, isoform A vs. TrEMBL
Match: A0A131XQS9 (Putative saposin (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.374e-28
Identity = 135/687 (19.65%), Postives = 290/687 (42.21%), Query Frame = 1
Query:  658 CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTIN-------SNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQ----FYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRK 2685
            C+ C A +  +EQ I      E V++ L   CE+F   ++  C+     N    +K +        IC  +TLC        +L   N+  V D    +  C+ CK  ++     + K      I+  V   C +F S ++DKCI         VI  VL +  P ++C++L  C+               +T T++        S++ C +C +  + +       +T E+++  +D  C +     E  C +    +Y  +   + +++ P  VC++L  C + +K ++P +  V PK   +  ++ C  C  +VK   N +  + + E ++  +  +C +   ++K  CI        +++  I+   SP ++CQ + LC S ++       +  +     +KPA + C  C  ++KF      ++K+  E++  L + C++        C +  N+   ++++ I++   P++VC++L  C     +   ++       +   DE+C  C   V++   ++        I++ +   C ++    + QC+   NT    ++  VL +     IC+ +  C                   +S   + +C  C  ++ +++  + + ++   V+ ++  +CS L     + C+ +    G  ++  +  ++DP++ C   K+C K
Sbjct:  435 CSICKAFITLLEQVIPLNATVEDVKYVLDQICELFPTETKRNCRSFVDKNAAVILKFLANDVAPAVICHEITLC-------MSLPPKNIGAVLD----SPDCDYCKLTVEFFYDELKKRETEEEIKLIVEKVCQLFPSSSRDKCISTINTYVDMVISLVLQEFTPEQICQQLGFCV---------------STRTSVPVILPKKVSDDTCDLCMVVAKFVYDKVKDERTEEKVKEALDQVCSLLPSSLEQKCVEMVNNYYDMLVNLLLQELDPDQVCKELGLCPSTKKAKMPPVASVPPK---KPTDEECDICKVVVKFVYNELQDNKTEEEVKNVLDKVCALLPDSLKQTCINTVNTYYDQLVELIVQGFSPEQVCQELGLCPSGRKA-----MMPAVANVPSKKPADEECDICKVVVKFVYNELQDNKTEEEVKNLLDKVCNLLPDSLKQTCTDTVNTYYDQLVQLIVQGFTPEQVCQELGLCPSVLRKPAAARP-----AKVANDEECTYCTTIVQYVYDALQDEKTEEEIKEVLDEVCNLFHGDRRQQCINMVNTYFEIIVALVLQDFTPQQICQTIGMC------------------PSSLGGDIECTFCQYALHFIQNELVENDTEARVEAVLDRLCSKLPSDLAKECIAFVEEYGPAVMVLLAQEIDPSIVCVAIKVCPK 1064          

HSP 2 Score: 130.183 bits (326), Expect = 1.457e-26
Identity = 148/774 (19.12%), Postives = 316/774 (40.83%), Query Frame = 1
Query:  352 CEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPC----KQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAP---------DHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIES-ILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDV 2631
            C IC+  +T  +  I ++ + + ++    QIC+      ++ C +F       +++ ++       IC  I LC+     +   VL             +  C  C  +++F    +  +   E+++  +   C++F  +S+  C    +T +   I  VL     ++ICQ L  C   V    ++ VI   +V D+      C+LC  + K +   V        ++  +   C++  S  + KC++        ++  +L + DP +VCK+L +C       +  +   + +      ++E+C IC++ ++ +      +KT E+++ V+D  C +     +  C      +Y ++   + +   P  VCQ+L  C +  K  +P +  V  K  A   ++ C  C  +VK   N +  + + E ++  +  +C++   ++K  C         +++  I+   +P ++CQ + LC S                   RKPA          + C  C T++++      + K+  EI+  L E C++F       C+   N T FEII + +L+   P+++C+ +  C   +S G + +     +               + F +  + ++   A ++  +   C+     L  +C+ F    G  V+  +    + + +C  +  C  D   + S      L++  SG     C  C ++V ++E+ +    + + V + +   C  + +  Q  C     T G  L++ +
Sbjct:  435 CSICKAFITLLEQVIPLNATVEDVKYVLDQICELFPTETKRNCRSFVDKNAAVILKFLANDVAPAVICHEITLCMSLPPKNIGAVLD------------SPDCDYCKLTVEFFYDELKKRETEEEIKLIVEKVCQLFPSSSRDKCISTINTYVDMVISLVLQEFTPEQICQQLGFC---VSTRTSVPVILPKKVSDDT-----CDLCMVVAKFVYDKVKDERTEEKVKEALDQVCSLLPSSLEQKCVEMVNNYYDMLVNLLLQELDPDQVCKELGLC----PSTKKAKMPPVASVPPKKPTDEECDICKVVVKFVYNELQDNKTEEEVKNVLDKVCALLPDSLKQTCINTVNTYYDQLVELIVQGFSPEQVCQELGLCPSGRKAMMPAVANVPSKKPA---DEECDICKVVVKFVYNELQDNKTEEEVKNLLDKVCNLLPDSLKQTCTDTVNTYYDQLVQLIVQGFTPEQVCQELGLCPS-----------------VLRKPAAARPAKVANDEECTYCTTIVQYVYDALQDEKTEEEIKEVLDEVCNLFHGDRRQQCINMVN-TYFEIIVALVLQDFTPQQICQTIGMCP--SSLGGDIECTFCQY--------------ALHFIQNELVENDTEARVEAVLDRLCSKLPSDLAKECIAFVEEYGPAVMVLLAQEIDPSIVCVAIKVCPKDGLKKQSD-----LKLKLSG-----CATCKAAVGYVEQILKDTKNDQEVTKQLSNACDHVPEALQSQCKPMIRTYGPALLQAI 1137          

HSP 3 Score: 111.309 bits (277), Expect = 8.942e-21
Identity = 116/589 (19.69%), Postives = 259/589 (43.97%), Query Frame = 1
Query:  925 SEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQF---YVKVGLE-VREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLC 2679
            S V D+I     C++CK  I LLE  +       +++  +   C +F +  K  C  F       ++K +  D  P  +C ++T+C+           L   N    ++S + C  C++ ++       + +T E+++ +V+  C +F       C      YV + +  V ++  P  +CQ+L FC    +  +P+I    PK V+   +  C  CM + K   + V    + E ++  +  +C +  ++++  C+         ++N +L    P ++C+ + LC S K+ +     +  +     +KP  + C  C  ++KF      ++K+  E++  L + C++        C+   N+   +++E I++  +P++VC++L  C   + +      +  +  +K  DE+C +CK  V+F    +  +     ++  +   C +   SLK  C    NT    +++ ++       +C+ +  C        + +   +        ++++C  C + V ++ + +  E + + ++E++ E+C++ +   ++ C+   +T    ++  VL D  P   CQT  +C
Sbjct:  426 SPVVDDIYT---CSICKAFITLLEQVIPLNATVEDVKYVLDQICELFPTETKRNCRSFVDKNAAVILKFLANDVAPAVICHEITLCMS----------LPPKNIGAVLDSPD-CDYCKLTVEFFYDELKKRETEEEIKLIVEKVCQLFPSSSRDKCISTINTYVDMVISLVLQEFTPEQICQQLGFC-VSTRTSVPVIL---PKKVS---DDTCDLCMVVAKFVYDKVKDERTEEKVKEALDQVCSLLPSSLEQKCVEMVNNYYDMLVNLLLQELDPDQVCKELGLCPSTKKAK-----MPPVASVPPKKPTDEECDICKVVVKFVYNELQDNKTEEEVKNVLDKVCALLPDSLKQTCINTVNTYYDQLVELIVQGFSPEQVCQELGLCP--SGRKAMMPAVANVPSKKPADEECDICKVVVKFVYNELQDNKTEEEVKNLLDKVCNLLPDSLKQTCTDTVNTYYDQLVQLIVQGFTPEQVCQELGLCPSVLRKPAAARPAKV-------ANDEECTYCTTIVQYVYDALQDEKTEEEIKEVLDEVCNLFHGDRRQQCINMVNTYFEIIVALVLQDFTPQQICQTIGMC 979          

HSP 4 Score: 97.4413 bits (241), Expect = 1.905e-16
Identity = 111/585 (18.97%), Postives = 240/585 (41.03%), Query Frame = 1
Query:  658 CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNT--LEVINMSEVFDEISVNQKCNLCKNMIKLL--EISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQ----FYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDS 2388
            C  C+    F+   +  +   E+V+ +L   C +   + +  C  + +      +  +L   D  ++C+ L LC      P+T   ++  ++ V  +   +++C++CK ++K +  E+  NKT     ++N +   C +     K  CI        ++++ ++    P +VC++L +C              + N  +   ++E+C IC++ ++ +      +KT E+++ ++D  C +     +  C      +Y ++   + +   P  VCQ+L  C +  +K        +P  VA  +++ C  C  IV+   + +    + E I+  +  +C++++   +  CI         ++  +L   +P++ICQ I +C S      E  F                   C   + F +     + +   ++  L   CS      A  C+ +    G  ++  + ++ +P  VC  +  C +    G + Q  L L     K   C  CK  V + +  +  + N   + +++   C     +L++QC     T G  +++A+   G     CK +D C  D+
Sbjct:  618 CDLCMVVAKFVYDKVKDERTEEKVKEALDQVCSLLPSSLEQKCVEMVNNYYDMLVNLLLQELDPDQVCKELGLC------PSTKKAKMPPVASVPPKKPTDEECDICKVVVKFVYNELQDNKT--EEEVKNVLDKVCALLPDSLKQTCINTVNTYYDQLVELIVQGFSPEQVCQELGLC----PSGRKAMMPAVANVPSKKPADEECDICKVVVKFVYNELQDNKTEEEVKNLLDKVCNLLPDSLKQTCTDTVNTYYDQLVQLIVQGFTPEQVCQELGLCPSVLRKP----AAARPAKVA--NDEECTYCTTIVQYVYDALQDEKTEEEIKEVLDEVCNLFHGDRRQQCINMVNTYFEIIVALVLQDFTPQQICQTIGMCPSSLGGDIECTF-------------------CQYALHFIQNELVENDTEARVEAVLDRLCSKLPSDLAKECIAFVEEYGPAVMVLLAQEIDPSIVCVAIKVCPK---DGLKKQSDLKL-----KLSGCATCKAAVGYVEQILKDTKNDQEVTKQLSNACDHVPEALQSQCKPMIRTYGPALLQAIAQFGSGEKACKKLDICSEDA 1157          

HSP 5 Score: 86.6557 bits (213), Expect = 3.403e-13
Identity = 101/593 (17.03%), Postives = 237/593 (39.97%), Query Frame = 1
Query:  334 RVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVI--NMSEVFDEISVNQKCNLCKNMIKLL--EISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPC-----KQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQ 2085
            +V  + C++C  +       +    + + ++    Q+C        + C          ++  + +  D  ++C+ + LC       K   +  +  +   ++PT ++C  C   + F+   +      E+V++ L   C +   + +  C    +T   + ++ ++     +++CQ L LC      P+  + +   ++ V  +   +++C++CK ++K +  E+  NKT     ++N +   C +     K  C         ++++ ++    P +VC++L +C    +   + +   + N       +E+C  C   +Q +       KT E+++ V+D+ C +F+      C       F + V L V +   P+ +CQ +  C +     I                  C  C + +   +N + ++ +   ++  +  LC    + +   CI F +  G  V+  +     P  +C  I +C  D  ++Q +  L L             C +C   + + E+   ++K+  E+  +L   C    +   + C     + G  ++++I +  + +K C+KL  C +
Sbjct:  612 KVSDDTCDLCMVVAKFVYDKVKDERTEEKVKEALDQVCSLLPSSLEQKCVEMVNNYYDMLVNLLLQELDPDQVCKELGLC----PSTKKAKMPPVASVPP-KKPTDEECDICKVVVKFVYNELQDNKTEEEVKNVLDKVCALLPDSLKQTCINTVNTYYDQLVELIVQGFSPEQVCQELGLC------PSGRKAMMPAVANVPSKKPADEECDICKVVVKFVYNELQDNKT--EEEVKNLLDKVCNLLPDSLKQTCTDTVNTYYDQLVQLIVQGFTPEQVCQELGLCPSVLRKPAAARPAKVAN-------DEECTYCTTIVQYVYDALQDEKTEEEIKEVLDEVCNLFHGDRRQQCINMVNTYFEIIVAL-VLQDFTPQQICQTIGMCPSSLGGDI-----------------ECTFCQYALHFIQNELVENDTEARVEAVLDRLCSKLPSDLAKECIAFVEEYGPAVMVLLAQEIDPSIVCVAIKVCPKDGLKKQSDLKLKL-----------SGCATCKAAVGYVEQILKDTKNDQEVTKQLSNACDHVPEALQSQCKPMIRTYGPALLQAIAQFGSGEKACKKLDICSE 1155          

HSP 6 Score: 72.0182 bits (175), Expect = 1.084e-8
Identity = 88/555 (15.86%), Postives = 215/555 (38.74%), Query Frame = 1
Query:  187 KGALKFLCQLFSENFKEVCHKNLSNDDKFTVNADIKVQLDSE-------------------ISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEV----REKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSD 1782
            K AL  +C L   + ++ C + ++N     VN  ++ +LD +                   +++    +    +C+IC+ ++    + +  + + + ++N   ++C       ++ C         +++E I +     ++CQ + LC           +   +     ++P  ++C  C   + F+   +      E+V++ L   C +   + +  C    +T   + ++ ++     +++CQ L LC   +  P             +++ +++C  C  +++ +  ++        I+  +   C +F    + +CI         ++  VL D  P ++C+ + +C                   +++  + +C  C+  +  I+     + T  +++AV+D  C          C  F  + G  V     +++ P  VC  ++ C  D  K+   +K+            GC +C   V   E I+  + + + +  ++   CD     +++ C    +  G  ++ AI    S  K C+ +++C  D
Sbjct:  642 KEALDQVCSLLPSSLEQKCVEMVNNYYDMLVNLLLQ-ELDPDQVCKELGLCPSTKKAKMPPVASVPPKKPTDEECDICKVVVKFVYNELQDNKTEEEVKNVLDKVCALLPDSLKQTCINTVNTYYDQLVELIVQGFSPEQVCQELGLC-----PSGRKAMMPAVANVPSKKPADEECDICKVVVKFVYNELQDNKTEEEVKNLLDKVCNLLPDSLKQTCTDTVNTYYDQLVQLIVQGFTPEQVCQELGLCPSVLRKPAAARPA-------KVANDEECTYCTTIVQYVYDALQDEKTEEEIKEVLDEVCNLFHGDRRQQCINMVNTYFEIIVALVLQDFTPQQICQTIGMCP------------------SSLGGDIECTFCQYALHFIQNELVENDTEARVEAVLDRLCSKLPSDLAKECIAFVEEYGPAVMVLLAQEIDPSIVCVAIKVCPKDGLKKQSDLKL---------KLSGCATCKAAVGYVEQILKDTKNDQEVTKQLSNACDHVPEALQSQCKPMIRTYGPALLQAIAQFGSGEKACKKLDICSED 1156          
BLAST of CLUMA_CG020609, isoform A vs. TrEMBL
Match: A0A1I8GSE6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.868e-24
Identity = 138/791 (17.45%), Postives = 322/791 (40.71%), Query Frame = 1
Query:  349 KCEICQGIMTRYKSAIDMSLSTKHIQNRFLQ--ICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAG----CAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTT-ICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKR 2688
            +C++C+ ++ + +  +    +   I++ F++  +C++     +  C    +  G  + + ++   D   +C+ +  C      D+      +            QC  C   +  +++ ++      +++ +L+  C +     +  C G         I+ ++     + IC  L LC      P       ++ V   +    +C +C+ +++ ++  + +      I+  +L  C+V     + +C  F Q     +I+ ++    P +VC  L +C + A  H     L      +T +S+  C +C+  +Q  + +   + T +++  +V+  C       +  CK F  + G  V + +L    PR +CQ +  C    K   P+  +V+    A      C +C ++++  E  ++++ +   I++ +  +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC   ++         +  +          C +C T++ + +     + +  EI   + + C+         C  + +  G  +I+ +L+  NP +VC+ L  C Q+  Q            RK+K           EF    ++K L+    Q ++ A     C++   +++ +C  F       +I+ +L NG S   IC ++  C        S Q   +  +    ++  +C +C   +  +++ + +  +   ++  + ++CS+L Q  ++ C  +       +I+ ++N + P   C    LC +R
Sbjct:  274 ECQVCEDLVNQARQMLRDGRTQAEIES-FVESIVCNALPSSEKDQCVKNVQQYGPILFQLLASELDPKTVCEAVGACGKTGRTDRLKPKLGV----------GPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSLLPQTVRQECDGFVQQFTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP------VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHR----LAPTPKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLC-TTTKMTPPVASLVRKPVRASPQ---CLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQ--------PVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQKKLQAA---------VRKQKQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQ-LLVNGLSPQRICTVLGLC------TASTQRPPVTPVQKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSLLPQTVRQECDNFVQQFTPTIIQLLMNGLSPQRVCSALGLCSQR 1015          

HSP 2 Score: 110.153 bits (274), Expect = 2.257e-20
Identity = 110/586 (18.77%), Postives = 242/586 (41.30%), Query Frame = 1
Query:  352 CEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEI-SVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQF---YVKVGLEVREKVL-PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNS 2094
            C++CQ +M   KS +  + + + I     ++C       +  C +F    G  +I+ + +  +  +ICQ++ LC    +      +  L+   +   P   QC  C   +  +EQ ++      +++ +L   C +     +  C G         I+ ++     + IC  L LC  +V  P       +S V  ++ + +  C+ C+ ++  ++  + +      I + V   C    +  +  C  F    G  VI+ +L D +P +VC+ L +C +        +    +     I++  +C +C   ++ +++  +++ T  +++A +   C +        C  F   Y  + +++    L P+ +C  L  C A   +R P+  + KP          C  C ++++  +  + ++ +   I+T ++ +C +   TV+  C  F Q     +I  ++   SP+++C  + LC     +R   + L        +  +   C  C T++++ +     + +  EI   +   CS         C  + N  G  +I+ +L+  NP+++C+ L  C    S
Sbjct:  560 CDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLC---TTTKMTPPVASLVRKPVRASP---QCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCT-QVQQP-------VSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQK-------KLQAAVRKQKQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTAS-TQRPPVTPVQKPV----QAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSLLPQTVRQECDNFVQQFTPTIIQLLMNGLSPQRVCSALGLC----SQRAPLHRLAPTPKSSTKSSS-TVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRS 1114          

HSP 3 Score: 109.383 bits (272), Expect = 4.198e-20
Identity = 130/694 (18.73%), Postives = 272/694 (39.19%), Query Frame = 1
Query:  313 ISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKP--APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFC 2376
            ++   +P     +C IC+ +M      +  + +   I+   LQ+C       R+ C  F +     +I+ +       ++C  + LC       +                ++  C  C   + + +  +      +++   +   C       Q  CK   +      I+ +L  ++ ++ICQ + LC    + P        S V   +  + +C  C+ +++ +E  +++    T I++ +   C++     + +C  F Q     +I+ ++    P ++C  L +C    Q   S     L  T T       C  C+  +  ++ +   + T +++   V+  C          CK F  + G  V + +L    P  VCQ L  C   +KK    ++  K K ++      C  C ++++  +  ++++ +   I+  +  +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC +  +R           +   +KP  A   C  C  +++  +K    + +  EI+  LL+ CS+  Q     C  +       II+ ++   +P++VC  L  C QR      +         K     C +C+  +++ K  + ++     I Q +   C+    + +  C  F N  G  VI+ +L +     IC+L+  C
Sbjct:  450 VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKS-----SSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPV-----ASLVRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLC-TQVQQPVSPVRAKLGATSTA------CDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLC--TQKKLQAAVR--KQKQIS--AGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP---------VTPVQKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSLLPQTVRQECDNFVQQFTPTIIQLLMNGLSPQRVCSALGLCSQRAPLHRLAPT--PKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLC 1109          

HSP 4 Score: 82.0333 bits (201), Expect = 8.247e-12
Identity = 99/528 (18.75%), Postives = 212/528 (40.15%), Query Frame = 1
Query: 1147 DPTKVCKKLTICLKHA-QHHESYQFLDL-LNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDF-CGIFNCPYEYPCK---QFYVKVGLEVREKVL-PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKP--APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVN 2703
             P +VC +  +C       H   Q + L  N    +    +C++C   +    ++    +T  ++++ V+   C       +  C    Q Y  +  ++    L P+TVC+ +  C    +        +KPK         C  C ++++  +  ++++ +   I+  ++ +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC +  +R           +   RKP  A   C  C  +++  +K    + +  EI+  LL+ CS+  Q     C  +       II+ ++   +P++VC  L  C QR      +         K     C +C+  +++ K  + ++     I Q +   C+    + +  C  F N  G  VI+ +L +     IC+L+  C                 +    ++  +C  C   +  +E+ +++  +   ++  + ++CS+L Q  ++ C  +       +I+ ++N + P   C    LC +    V+
Sbjct:  234 PPKQVCTEFRLCSSAPFAGHPVIQLMQLQTNKAIKLAEPIECQVCEDLVNQARQMLRDGRTQAEIESFVESIVCNALPSSEKDQCVKNVQQYGPILFQLLASELDPKTVCEAVGACGKTGRT-----DRLKPKL---GVGPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSLLPQTVRQECDGFVQQFTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP---------VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPT--PKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPVASL-----VRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQPVS 737          

HSP 5 Score: 73.9442 bits (180), Expect = 2.667e-9
Identity = 82/495 (16.57%), Postives = 193/495 (38.99%), Query Frame = 1
Query:  316 STADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPC----KQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKG-CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDK 1785
            S   +P     +C  C+ +M   +  +  + +   I++   Q+C       R+ C  F +     +I+ +       +IC ++ LC          V   +  +      T+  C  C   + +++  +      +++  ++   C       +  CK          I+ +L   +  ++CQ L LC  + +     +         +IS   +C LC+ +++ ++  +++    T I+  +   C++     + +C  F Q     +I+ ++    P ++C  L +C    Q         +      + +  +C IC   ++ +++   ++ T  +++  +   C +        C    +QF   +   +   + P+ VC  L  C     +R PL ++      +   +   C  C  +++  ++++ ++ + + I   V  +C       +  C +F    G  VI  +L   +PR+ICQL+ LC + +
Sbjct:  644 SLVRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLC--------TQVQQPVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQKKLQAAVRKQ-------KQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTASTQRP------PVTPVQKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSLLPQTVRQECDNFVQQFTPTIIQLLMNGLSPQRVCSALGLC----SQRAPLHRLAPTPKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSR 1113          
BLAST of CLUMA_CG020609, isoform A vs. TrEMBL
Match: A0A1I8G4W7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034575g1 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.789e-24
Identity = 143/793 (18.03%), Postives = 322/793 (40.61%), Query Frame = 1
Query:  349 KCEICQGIMTRYKSAIDMSLSTKHIQNRFLQ--ICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAG----CAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTT-ICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHS 2694
            +C++C+ ++ + +  +    +   I++ F++  +C++     +  C    +  G  + + ++   D   +C+ +  C      D+      +            QC  C   +  +++ ++      +++ +L+  C +     +  C G         I+ ++     + IC  L LC      P       ++ V   +    +C +C+ +++ ++  + +      I+  +L  C+V     + +C  F Q     +I+ ++    P +VC  L +C + A  H     L      +T +S+  C +C+  +Q  + +   + T +++  +V+  C       +  CK F  + G  V + +L    PR +CQ +  C    K   P+  +V+    A      C +C ++++  E  ++++ +   I++ +  +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC   ++         +  +          C +C T++ + +     + +  EI   + + C+         C  + +  G  +I+ +L+  NP +VC+ L  C Q+  Q            RK+K           EF    ++K L+    Q ++ A     C++   +++ +C  F       +I+ +L NG S   +C  +  C   S+    H+ L      ++  S   C +C + + + +  + +  + + + +L+  +CS L    Q  C  + +  G  +I+ +L D +P   CQ   LC    S
Sbjct:  274 ECQVCEDLVNQARQMLRDGRTQAEIES-FVESIVCNALPSSEKDQCVKNVQQYGPILFQLLASELDPKTVCEAVGACGKTGRTDRLKPKLGV----------GPQCLLCEFVMREVDKQLSQNATQAEIEAALLQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP------VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHR----LAPTPKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLC-TTTKMTPPVASLVRKPARASPQ---CLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQ--------PVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQKKLQAA---------VRKQKQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSVLPQTVRQECDGFVQQYTPIIIQ-LLVNGLSPQRVCSALGLC---SQRAPLHR-LAPTPKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRS 1019          

HSP 2 Score: 93.5893 bits (231), Expect = 2.828e-15
Identity = 107/598 (17.89%), Postives = 232/598 (38.80%), Query Frame = 1
Query:  313 ISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNS 2094
            ++   +P     +C IC+ +M      +  + +   I+   LQ+C       R+ C  F +     +I+ +       ++C  + LC       +                ++  C  C   + + +  +      +++   +   C       Q  CK   +      I+ +L  ++ ++ICQ + LC    + P        S V      + +C  C+ +++ +E  +++    T I++ +   C++     + +C  F Q     +I+ ++    P ++C  L +C    Q   S     L  T T       C  C+  +  ++ +   + T +++   V+  C          CK F  + G  V + +L    P  VCQ L  C   +KK    ++  K K ++      C  C ++++  +  ++++ +   I+  ++ +C +   TV+  C  F Q     +I  ++   SP+++C  + LC     +R   + L        +  +   C  C T++++ +     + +  EI   +   CS         C  + N  G  +I+ +L+  NP+++C+ L  C    S
Sbjct:  450 VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKS-----SSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPV-----ASLVRKPARASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLC-TQVQQPVSPVRAKLGATSTA------CDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLC--TQKKLQAAVR--KQKQIS--AGPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSVLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRVCSALGLC----SQRAPLHRLAPTPKSSTKSSS-TVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRS 1019          

HSP 3 Score: 84.3445 bits (207), Expect = 1.707e-12
Identity = 99/528 (18.75%), Postives = 212/528 (40.15%), Query Frame = 1
Query: 1147 DPTKVCKKLTICLKHA-QHHESYQFLDL-LNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDF-CGIFNCPYEYPCK---QFYVKVGLEVREKVL-PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKP--APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVN 2703
             P +VC +  +C       H   Q + L  N    +    +C++C   +    ++    +T  ++++ V+   C       +  C    Q Y  +  ++    L P+TVC+ +  C    +        +KPK         C  C ++++  +  ++++ +   I+  ++ +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC +  +R           +   RKP  A   C  C  +++  +K    + +  EI+  LL+ CS+  Q     C  +       II+ ++   +P++VC  L  C QR      +         K     C +C+  +++ K  + ++     I Q +   C+    + +  C  F N  G  VI+ +L +     IC+L+  C                 +    ++  +C  C   +  +E+ +++  +   ++  + ++CS+L Q  ++ C  +       +I+ ++N + P   C    LC +    V+
Sbjct:  234 PPKQVCTEFRLCSSAPFAGHPVIQLMQLQTNKAIKLAEPIECQVCEDLVNQARQMLRDGRTQAEIESFVESIVCNALPSSEKDQCVKNVQQYGPILFQLLASELDPKTVCEAVGACGKTGRT-----DRLKPKL---GVGPQCLLCEFVMREVDKQLSQNATQAEIEAALLQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP---------VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPT--PKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPVASL-----VRKPARASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQPVS 737          
BLAST of CLUMA_CG020609, isoform A vs. TrEMBL
Match: A0A267GYV9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034575g2 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 8.925e-24
Identity = 143/793 (18.03%), Postives = 322/793 (40.61%), Query Frame = 1
Query:  349 KCEICQGIMTRYKSAIDMSLSTKHIQNRFLQ--ICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAG----CAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTT-ICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHS 2694
            +C++C+ ++ + +  +    +   I++ F++  +C++     +  C    +  G  + + ++   D   +C+ +  C      D+      +            QC  C   +  +++ ++      +++ +L+  C +     +  C G         I+ ++     + IC  L LC      P       ++ V   +    +C +C+ +++ ++  + +      I+  +L  C+V     + +C  F Q     +I+ ++    P +VC  L +C + A  H     L      +T +S+  C +C+  +Q  + +   + T +++  +V+  C       +  CK F  + G  V + +L    PR +CQ +  C    K   P+  +V+    A      C +C ++++  E  ++++ +   I++ +  +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC   ++         +  +          C +C T++ + +     + +  EI   + + C+         C  + +  G  +I+ +L+  NP +VC+ L  C Q+  Q            RK+K           EF    ++K L+    Q ++ A     C++   +++ +C  F       +I+ +L NG S   +C  +  C   S+    H+ L      ++  S   C +C + + + +  + +  + + + +L+  +CS L    Q  C  + +  G  +I+ +L D +P   CQ   LC    S
Sbjct:  274 ECQVCEDLVNQARQMLRDGRTQAEIES-FVESIVCNALPSSEKDQCVKNVQQYGPILFQLLASELDPKTVCEAVGACGKTGRTDRLKPKLGV----------GPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSLLPQTVRQECDGFVQQFTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP------VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHR----LAPTPKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLC-TTTKMTPPVASLVRKPVRASPQ---CLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQ--------PVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQKKLQAA---------VRKQKQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQ-LLVNGLSPQRVCSALGLC---SQRAPLHR-LAPTPKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRS 1019          

HSP 2 Score: 92.8189 bits (229), Expect = 4.437e-15
Identity = 107/598 (17.89%), Postives = 232/598 (38.80%), Query Frame = 1
Query:  313 ISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNS 2094
            ++   +P     +C IC+ +M      +  + +   I+   LQ+C       R+ C  F +     +I+ +       ++C  + LC       +                ++  C  C   + + +  +      +++   +   C       Q  CK   +      I+ +L  ++ ++ICQ + LC    + P        S V   +  + +C  C+ +++ +E  +++    T I++ +   C++     + +C  F Q     +I+ ++    P ++C  L +C    Q   S     L  T T       C  C+  +  ++ +   + T +++   V+  C          CK F  + G  V + +L    P  VCQ L  C   +KK    ++  K K ++      C  C ++++  +  ++++ +   I+  +  +C +   TV+  C  F Q     +I  ++   SP+++C  + LC     +R   + L        +  +   C  C T++++ +     + +  EI   +   CS         C  + N  G  +I+ +L+  NP+++C+ L  C    S
Sbjct:  450 VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKS-----SSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPV-----ASLVRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLC-TQVQQPVSPVRAKLGATSTA------CDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLC--TQKKLQAAVR--KQKQIS--AGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRVCSALGLC----SQRAPLHRLAPTPKSSTKSSS-TVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRS 1019          

HSP 3 Score: 82.0333 bits (201), Expect = 8.488e-12
Identity = 99/528 (18.75%), Postives = 212/528 (40.15%), Query Frame = 1
Query: 1147 DPTKVCKKLTICLKHA-QHHESYQFLDL-LNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDF-CGIFNCPYEYPCK---QFYVKVGLEVREKVL-PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKP--APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVN 2703
             P +VC +  +C       H   Q + L  N    +    +C++C   +    ++    +T  ++++ V+   C       +  C    Q Y  +  ++    L P+TVC+ +  C    +        +KPK         C  C ++++  +  ++++ +   I+  ++ +C +   TV+  C  F Q     +I  ++   SP++IC ++ LC +  +R           +   RKP  A   C  C  +++  +K    + +  EI+  LL+ CS+  Q     C  +       II+ ++   +P++VC  L  C QR      +         K     C +C+  +++ K  + ++     I Q +   C+    + +  C  F N  G  VI+ +L +     IC+L+  C                 +    ++  +C  C   +  +E+ +++  +   ++  + ++CS+L Q  ++ C  +       +I+ ++N + P   C    LC +    V+
Sbjct:  234 PPKQVCTEFRLCSSAPFAGHPVIQLMQLQTNKAIKLAEPIECQVCEDLVNQARQMLRDGRTQAEIESFVESIVCNALPSSEKDQCVKNVQQYGPILFQLLASELDPKTVCEAVGACGKTGRT-----DRLKPKL---GVGPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSLLPQTVRQECDGFVQQFTPIIIQLLVNGLSPQRICTVLGLCTASTQRPP---------VTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPT--PKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPVASL-----VRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQPVS 737          
BLAST of CLUMA_CG020609, isoform A vs. TrEMBL
Match: A0A2T7PW46 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00216 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.234e-22
Identity = 128/651 (19.66%), Postives = 259/651 (39.78%), Query Frame = 1
Query:  205 LCQLFSENFKEVCHKNLSND--DKFTVNADIKVQLDSEISTADQPRVHRN--KCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDE--ISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLE----VREKVLPRTVCQKLEFCR----ADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDH-CQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRN-SQGEES 2109
            +C LF   FK     +   D  +   V  ++    D + S A    V  +   C+IC+  +   ++ +  + + + +     Q+C       R  C  F       +I  + +  D   IC  + LC   ++D+K      L    I     + +C  C   L  I+  ++       ++  L   C I     +  C    S      ++ +    D + +C  + LC       N  +V  + E  D+        C LC  +++L+E  + +      +   +   C+ F      +C +F      EVI  +L D + T +CKKL +C        + + L         ++   C +C+  +Q ++ +  +++T++ ++  +D  C +F       C+Q   +   +    + E++ P  +C  L  C     A E K +  I   KP          C  C  +++  ++++ K+ + + I+  +  +C ++ AT+ + C         ++I  I     P +IC L+ LC   K+ + +    +L      +KPA    C  C  +++  +     +++  +I+  L + C +F    ++ C +       +IIE I ++  P+++C  L  C Q N  QG+ S
Sbjct:  535 VCDLFLHCFKSSVEDDRGEDVVETNAVVVEVDPHADVQQSNAVSAEVKASIVDCDICRFALEVVEAIVSRNRTEQSLVEALQQVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLC--NETDNKVPETAHLQAASI----GSIECEVCELVLGAIDSVLDGNRTLAAIEKVLGEICSILPATIRAQCVSFVSEYGPAVMELLADELDPQVVCIKIGLC-------NQAQVKQLLEAEDKRRPQATPVCELCNQVMQLIETFLQQNRTEETVTKALQQVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLC--SDTRPVTGKELTTTAGDKKPSAGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNGAQETKPVATIGEEKPSA-----GPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGK----ELTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKAS 1161          

HSP 2 Score: 106.686 bits (265), Expect = 3.157e-19
Identity = 117/616 (18.99%), Postives = 258/616 (41.88%), Query Frame = 1
Query:  892 VDPNTLEVINMSEVFDEISVN-QKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVRE----KVLPRTVCQKLEFC-RADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKP-APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXV-EFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKK------CQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSE 2697
            VDP+  +V   + V  E+  +   C++C+  ++++E  V++     ++   +   C++ T  A+ +C +F       +I+ +L + DP  +C +L +C +          L       +I S E C++C + +  I+ + + ++TL  ++ V+ + C I        C  F  + G  V E    ++ P+ VC K+  C +A  K+ +      +P+         C+ C  +++  E  + ++ + E +   +  +C  +  T+   C  F      EVIN +L   +   IC+ + LC   +    +    +L      +KP A   C  C  +++  +     +++  +I+  L   C +F    ++ C +       +IIE I ++  P+++C  L  C Q N   +E++ + T+   K          K V +     + K+     I++ +   C ++  ++ +QC          +I+ +    +   IC L+  C    +++G          LT+   E+K      C LC   +  ++  + K  +   +++ + ++C +        C +       Q+I+ +  ++ P   C    LC + + +
Sbjct:  565 VDPHA-DVQQSNAVSAEVKASIVDCDICRFALEVVEAIVSRNRTEQSLVEALQQVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLCNETDNKVPETAHLQ----AASIGSIE-CEVCELVLGAIDSVLDGNRTLAAIEKVLGEICSILPATIRAQCVSFVSEYGPAVMELLADELDPQVVCIKIGLCNQAQVKQLLEAEDKRRPQATPV-----CELCNQVMQLIETFLQQNRTEETVTKALQQVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCSDTRPVTGK----ELTTTAGDKKPSAGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNG-AQETKPVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGKE--------LTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRD 1156          

HSP 3 Score: 105.531 bits (262), Expect = 7.235e-19
Identity = 172/930 (18.49%), Postives = 360/930 (38.71%), Query Frame = 1
Query:  472 KICATFFKGKGLEMIESISRSEDSMKICQIINLCL---YEDSDDKYNVLTDLLLIDIFQQPTTKQ--------------CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLC---DMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLE--ISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDE-DPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKG--CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQ-RNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYK-----ISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEG------------SHQFLDLLQ-----ILTSGKSEKK-------------------CQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVNFFARDHEIFNKMCLFLKKVNINIEGFRFNKKIEPITNNIQRKLQYFCLAYSNGQSVSARQLYSS------SYLNDQ-------------------------CKLCKEIVYIVNQL 2955
            K C         ++ E I+   D   +C +   C     ED   +  V T+ +++++      +Q              C  C  +L+ +E  ++     + +  +L   C +  P+++  C+   +  +   I+ +L   D + IC  L LC   D +V +   L+  ++  +        +C +C+ ++  ++  +  N+TL A  I+  +   C++  +  + +C+ F    G  V++ +L DE DP  VC K+ +C   AQ  +  +  D      T      C++C   +QLIE    +++T E +   +   C  F       C+QF  +   EV   +L       +C+KL  C      R    K +      +  + G  C  C  +++  ++++ K+ + + I+  +  +C ++ AT+ + C         ++I  I     P +IC L+ LC S     QE     +  I   +  A   C  C  +++  +     +++  +I+  L + C +F    ++ C +       +IIE I  +  P+++C  L  C Q +  QG+E    LT    ++K     +C    E  +     +  N++++   I++ +   C ++  ++ +QC          +I+ +    +   IC L+  C   +  +G            S   L ++Q        SG+ E+                    C LC   +  ++  + K  +   +++ + ++C +        C +  +     LI  ++ ++ P+  C   KLC          ++ ++    +C   K+V   ++      +     ++I++ L   C  +    +   RQL          Y+ D+                         C LCKE++  V+ L
Sbjct:  509 KQCQALAAQYAPQLFEIIASELDPESVCDLFLHCFKSSVEDDRGEDVVETNAVVVEVDPHADVQQSNAVSAEVKASIVDCDICRFALEVVEAIVSRNRTEQSLVEALQQVCSLLTPSARPQCEQFINNYMPTLIRLLLQELDPEVICNELQLCNETDNKVPETAHLQAASIGSI--------ECEVCELVLGAIDSVLDGNRTLAA--IEKVLGEICSILPATIRAQCVSFVSEYGPAVME-LLADELDPQVVCIKIGLC-NQAQVKQLLEAEDKRRPQAT----PVCELCNQVMQLIETFLQQNRTEETVTKALQQVCSFFPDTISTECRQFVGRYSQEVINLLLQDLNATDICKKLGLCS---DTRPVTGKELTTTAGDKKPSAGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLC-SQGNGAQETK--PVATIGEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQGKKVQGKE----LTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDD--IEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKASDGGRQTEAISWSHLRVVQSGLDNTGQSGREEQHSGQYHEAAVGELKPSAGPICDLCKEVLQKVDTLLEKNRTVDDIEKALDQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLC----------SQSNKAAGPICDLCKQVLQTLDSLLEKNR---TVDDIEKALDQVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKPAAGPICDLCKEVLQAVDSL 1397          

HSP 4 Score: 98.2117 bits (243), Expect = 1.111e-16
Identity = 110/623 (17.66%), Postives = 241/623 (38.68%), Query Frame = 1
Query:  352 CEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQ-CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTL-------EVINMSEV----------------------FDEISVNQK-------CNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLC-QSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNS 2094
            C++C+ ++    S ++ + +   I+    Q+C          C         ++IE I+      +IC ++ LC    S  K     +L      Q+P     C  C   L  ++  +      + ++ +L   C +F     + C+ L      + I+ +      +EIC  L LC     D           E I+ S +                      + E +V +        C+LCK +++ ++  + K     +I+  +   C +F +    +C +        +I  ++ +  P ++C  L +C   +Q +++              +   C +C+  +Q ++ +  +++T++ ++  +D  C +F       C+Q   +   ++ E +     P  +C  L+ C   +KK  P    +            C  C  +++  ++++ K+ + + I+  +  +C ++ AT+ + C         ++I  I     P +IC L+ LC Q   E  +E   ++   +        + C  C T++ + E+  N   +  E++  L + C +F     + C          I++ + ++ NPK +CE +  C   NS
Sbjct:  978 CDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLC----SQGKKVQGKELTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKASDGGRQTEAISWSHLRVVQSGLDNTGQSGREEQHSGQYHEAAVGELKPSAGPICDLCKEVLQKVDTLLEKNRTVDDIEKALDQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLC---SQSNKA--------------AGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDQVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKK--PAAGPI------------CDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGHNELGRE---VETQAVAVREG---ELCLICDTLLNYVEEGLNQQATVEEVEKLLNDVCKLFPTDLTSECSLLVQQFTPLIMQLLAEEVNPKAICETIKLCPSPNS 1559          

HSP 5 Score: 97.4413 bits (241), Expect = 2.186e-16
Identity = 105/659 (15.93%), Postives = 250/659 (37.94%), Query Frame = 1
Query:  268 KFTVNADIKVQLDSEIST--ADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQ-CTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDE--ISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKH------------------------------------AQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLE----VREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQ-RNSQGEE 2106
            K  + +D +     E++T   D+       C++C+ ++    S ++ + +   I+    ++C          C         ++IE I+      +IC ++ LC   +   +   +  +      ++P+    C  C   L  ++  +      + ++ +L   C +F     + C+ L +    + I+ +      +EIC  L LC         ++   ++   DE   +    C+LCK +++ ++  + K     +I+  +   C +F +    +C +       ++I+ +  +  P ++C  L +C +                                      +   S Q+ +        ++   C +C+  +Q ++ +  +++T++ ++  +D  C +F       C+Q   +        + E++ P  +C  L+ C    K   P+                C  C  +++  ++++ K+ + + I+  +  +C ++ AT+ + C         ++I  I     P +IC L+ LC   K++       DL                C  +++  +     +++  +I+  L + C +F    ++ C +       +IIE I ++  P+++C  L  C Q  N  G E
Sbjct:  849 KLGLCSDTRPVTGKELTTTAGDKKPSAGPICDLCKQVLQTLDSLLEKNRTVDDIEKALDRVCKLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGNGAQETKPVATI----GEEKPSAGPICDLCKEVLQTVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVAQYAPQIIEYIADELKPEEICSLLGLCSQG----KKVQGKELTTATDEQKPAAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYITEELKPEEICSLLGLCSQGNRDQGKASDGGRQTEAISWSHLRVVQSGLDNTGQSGREEQHSGQYHEAAVGELKPSAGPICDLCKEVLQKVDTLLEKNRTVDDIEKALDQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLCSQSNKAAGPI----------------CDLCKQVLQTLDSLLEKNRTVDDIEKALDQVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKPAAGPICDL----------------CKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQGHNELGRE 1467          

HSP 6 Score: 69.3218 bits (168), Expect = 6.927e-8
Identity = 69/401 (17.21%), Postives = 156/401 (38.90%), Query Frame = 1
Query:  352 CEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPC----KQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHH 1542
            C++C+ ++ +  + ++ + +   I+    Q+C          C          +I+ I       +IC ++ LC    S+     + DL             C   + +LD +   +      + ++ +L   C +F     + C+ L      + I+ +      +EIC  L LC      P               +    C+LCK +++ ++  + K     +I+  +   C +F +    +C +       ++I+ +  +  P ++C  L +C +   H+E  + ++       +   E C IC   +  +E   N+  T+E+++ +++D C +F       C    +QF   +   + E+V P+ +C+ ++ C +      P    + P T    +
Sbjct: 1214 CDLCKEVLQKVDTLLEKNRTVDDIEKALDQVCRLFPASIASQCRQLVAQYAPALIDLIVEELQPDEICSLLKLC--SQSNKAAGPICDL-------------CKQVLQTLDSL---LEKNRTVDDIEKALDQVCRLFPATIASQCRQLVGQYAPQIIEYIADELKPEEICSLLKLCSQGKKKP---------------AAGPICDLCKEVLQAVDSLLEKNRTVDDIEKALDQVCRLFPATISSQCRQLVGQYAPQIIEYIAEELKPEEICSLLGLCSQG--HNELGREVE--TQAVAVREGELCLICDTLLNYVEEGLNQQATVEEVEKLLNDVCKLFPTDLTSECSLLVQQFTPLIMQLLAEEVNPKAICETIKLCPSPNSTSHPKFLGLDPCTFGPAY 1577          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Nematostella
Match: EDO31455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX5])

HSP 1 Score: 73.9442 bits (180), Expect = 1.814e-13
Identity = 79/402 (19.65%), Postives = 176/402 (43.78%), Query Frame = 1
Query:  943 ISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVD-EDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTI----NSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLP-----RTVCQKLEFCRADEKKRIPLIK-------MVKPK------TVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            +S   +C  CK ++K +    +       I + +  ACT F  P   +C    +  G  +I+ +L    +P +VCK++ +C    +  +      L  T  T     +  ++C  C+  +  + +  +     +++ A++   C  F    +  C+      G ++ + ++      + +C ++  C A++ K + L++       M  PK      T     +  C  C +++K  +++++K+ + + I   V  +C I  +T+K+ C  F Q  G  +I  +    SP+ +C  + LC +++E R        L+I  +     + C+ C T++ + +   NN+ +  EI   L + C+    + A+ C    +  G  +++ I+   +P  +C+++  C
Sbjct:   19 VSPKDECTTCKELVKTIYTMASDPTAQNQILSLIKDACT-FLGPEASECKSLVETYGKAIIQLILSQLSNPDQVCKEIGLCTSKTEMLKKIVMRHLHKTPITKPVLRSPKDECITCQEAVNTVYKFVSNPAIEDEIVALLSKVCSEFG-AEKATCEAVVNTFGKQIVQTLVSLLSDGKKLCTEIGLCTANKVKAM-LVQAAASHKVMFTPKKHVLKATYPVKTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVEKVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLC-ANREHRIAMRRSHKLVIGSN-----ETCEICTTVMTYLKAFLNNNATDEEIVNFLEKVCNYLPSQIASECNAIVSEYGSTVLQ-IIANTDPTTLCKEIGLC 410          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Nematostella
Match: EDO39178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT7])

HSP 1 Score: 60.077 bits (144), Expect = 2.853e-9
Identity = 46/218 (21.10%), Postives = 97/218 (44.50%), Query Frame = 1
Query: 1144 EDPTKVCKKLTICLKHAQHHESYQFLD-LLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQF---YVKVGLEVREKVL--PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQS 1779
            +D  +VC +L +C+   +       +  +L +  +++++E C IC + +  I  +   +    +++ V++D C      Y   CK     Y  + +   +K++   + VC  L  C AD        + V P+         C  C +++K  + ++ K  + + I+  ++ +C I   T++N C  F       +++ +L    P K+C +I LC S
Sbjct:  156 QDSKQVCTELGLCIAGNRKAMMDNLIQHVLRSLPSVHNSEVCSICELAVDKIRDVIGDNSIQAEIKGVLEDACVKEGGAYAGVCKALVDQYFPIIISHLDKLVQNSKQVCTALGLCSAD--------RWVCPRP---DDAPQCVLCEFVMKEIKQLLAKDTTQQGIEKALMMVCSIMPETIRNNCDKFVTEYTPIIMSLLLEEVDPAKVCSMIGLCNS 362          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Medaka
Match: sftpbb (prosaposin-like [Source:NCBI gene;Acc:101161410])

HSP 1 Score: 53.5286 bits (127), Expect = 7.239e-7
Identity = 36/177 (20.34%), Postives = 75/177 (42.37%), Query Frame = 1
Query: 1552 CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C  C+ ++++ E ++ K++S + I   +  +CD+  A+ K  C  F    G ++   + +S +P  IC +++LC       +E    ++LL        P  C+SC T+      +   + +  +    L   CSI        C  +  + G ++   +  + +    CE+   C 
Sbjct:  129 CALCLMVIRKLETMLPKNISEDAILKIMEEVCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLC-----LFKEQPVPEVLL--------PSDCESCRTLAALHRVHLGLNATGAQTSAFLQSVCSIHPNAIPK-CDAFTRAYGSQLHRVLGNQMDISHTCERADLCQ 291          
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Medaka
Match: sftpbb (prosaposin-like [Source:NCBI gene;Acc:101161410])

HSP 1 Score: 53.5286 bits (127), Expect = 9.576e-7
Identity = 36/177 (20.34%), Postives = 75/177 (42.37%), Query Frame = 1
Query: 1552 CKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCH 2082
            C  C+ ++++ E ++ K++S + I   +  +CD+  A+ K  C  F    G ++   + +S +P  IC +++LC       +E    ++LL        P  C+SC T+      +   + +  +    L   CSI        C  +  + G ++   +  + +    CE+   C 
Sbjct:  153 CALCLMVIRKLETMLPKNISEDAILKIMEEVCDLVPASYKQQCDDFVNKYGADIAEFLFSSAAPHTICMVLHLC-----LFKEQPVPEVLL--------PSDCESCRTLAALHRVHLGLNATGAQTSAFLQSVCSIHPNAIPK-CDAFTRAYGSQLHRVLGNQMDISHTCERADLCQ 315          
BLAST of CLUMA_CG020609, isoform A vs. Planmine SMEST
Match: SMESG000019986.1 (SMESG000019986.1)

HSP 1 Score: 1909.42 bits (4945), Expect = 0.000e+0
Identity = 954/962 (99.17%), Postives = 957/962 (99.48%), Query Frame = 1
Query:   91 MNIKIFSRFLFLLSAIFSSAESNEISQFSVSTKGALKFLCQLFSENFKEVCHKNLSNDDKFTVNADIKVQLDSEISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYXXXXXXXXXXXXXXVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVNFFARDHEIFNKMCLFLKKVNINIEGFRFNKKIEPITNNIQRKLQYFCLAYSNGQSVSARQLYSSSYLNDQCKLCKEIVYIVNQLAIPFKDE 2976
            MNIKIFSRFLFLLSAIFSSAESNEISQFSVSTKGALKFLCQLFSENFKEVCHKNLSNDDKFTVNADIKVQLDSEISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYRKEKDEDCKLCKKRVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKT CVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQ+LTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQR+CVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVN FARDHEIFNK+CLFLKKVNINIEGFRFNKKIEPI NNIQRKLQYFCLAYSNGQSVS RQLYSS YLNDQCKLCKEIVYIVNQLAIPFKDE
Sbjct:    1 MNIKIFSRFLFLLSAIFSSAESNEISQFSVSTKGALKFLCQLFSENFKEVCHKNLSNDDKFTVNADIKVQLDSEISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYRKEKDEDCKLCKKRVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTLCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQMLTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRMCVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVNVFARDHEIFNKLCLFLKKVNINIEGFRFNKKIEPIANNIQRKLQYFCLAYSNGQSVSVRQLYSSPYLNDQCKLCKEIVYIVNQLAIPFKDE 962          

HSP 2 Score: 212.616 bits (540), Expect = 5.806e-56
Identity = 143/538 (26.58%), Postives = 250/538 (46.47%), Query Frame = 1
Query:  334 RVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLE-----------FCRADE----------------------KKRIPLIKMVKPKT-------------------VARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQS 1779
            R H   C+ C  I+ RY++ ++ SLS ++IQ + + +CD  +   + +C TF++GKGLE+I +I  SE   KICQ+INLC  +    + N   DLLLI   ++P    C +C+  + F E++ N   +  ++Q  L+ YC IF+      C   F++   + I+ +L + + K++C+ L  C  R  +    E  ++  +F     ++ C LCK  ++  +IS+NK+LN   IQ +++  C ++    K  C+ FY   G +VIK+VL + + T +CK +  CL  ++   S+QFLDLL   T+  S +KC++C   +  +E   N+  + + +Q ++ + C +    Y+  C +++   GL++ + VL    P   CQ  +           F R  E                      KK  P+   ++ K                     + + N  CK C  IV     +       E ++     +C     ++ + C+ F     + +I   L   S  +ICQ I LC S
Sbjct:  482 RHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQR--NSQGEESQDLLTLFYRKEKDEDCKLCKKRVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTLCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQMLTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRMCVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVNVFARDHEIFNKLCLFLKKVNINIEGFRFNKKIEPIANNIQRKLQYFCLAYSNGQSVSVRQLYSSPYLNDQCKLCKEIVYIVNQLAIPFKDEESLKRAFKVVCKHLPTSLHSECVAFVNRYQVRIIKLFLQKVSFEEICQKIKLCLS 1017          

HSP 3 Score: 125.561 bits (314), Expect = 1.139e-28
Identity = 60/179 (33.52%), Postives = 104/179 (58.10%), Query Frame = 2
Query: 3221 SKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMML-VQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVC 3754
            +KGC  C  +V+ YE ++N  L   YI  K++ +CD+ N  +K  C  FY+G G +V+ AIL  E+   +C+L+N+C ++ E  Q   F+ L+++   +    D C  C+  I + E N N       +Q   L+YCSI +  + ++C  +++ TG+++I+ ILKK +P +VC+ L+ C
Sbjct:  485 NKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 663          

HSP 4 Score: 109.768 bits (273), Expect = 7.771e-24
Identity = 56/186 (30.11%), Postives = 97/186 (52.15%), Query Frame = 2
Query: 3224 KGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY*SRNNI 3781
            + C +C+K VE Y+  IN  L    I  K++  C +    +K  C  FY   G+ V+KA+L    ST +C+LM+ C+ ++E++   +F+ L+ ++   ++   C  C+ ++ W E N+N  N  + VQ    + CS++   Y  +C  ++S  G Q+IK +L   DP   CQ   +C    S  N+
Sbjct:  687 EDCKLCKKRVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTLCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQMLTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRMCVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHSEVNV 872          

HSP 5 Score: 106.686 bits (265), Expect = 7.298e-23
Identity = 61/216 (28.24%), Postives = 113/216 (52.31%), Query Frame = 2
Query: 3116 VQAD-NIRLLKDVKTFDKPVEQPNKDLYQESSIGNASKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMM--LVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVC 3754
            V AD  ++L  ++ T D+P    NK              C+IC+ ++  Y++ I+  L  ++I  + LQ+CD  +   ++ C  F++G G +++++I   E+S  +C+++N+C+ E   D++     L++  + QQP T   CT CV ++ + E +IN    PE+VQ   + YC I +      C   +S    + IK +L ++D   +CQ L +C
Sbjct:   63 VNADIKVQLDSEISTADQPRVHRNK--------------CEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQP-TTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLC 263          

HSP 6 Score: 89.3521 bits (220), Expect = 1.433e-17
Identity = 60/235 (25.53%), Postives = 111/235 (47.23%), Query Frame = 2
Query: 3113 FVQADNIRLLKDVKTFDKPVEQPN-------KDLYQESSIGNASKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY*SRNNIRKFLP 3796
              ++D   + +++   D  V  PN        +++ E S+    + C++C+ +++  E  +N  L    I  ++L  C +     K +C +FY+G+G +V+K++L  E+ T VC+ + IC+   +  + ++F+ L+       + + C  C   I   E   N     E++Q    D+C I  CPY   C  FY   G +V + +L +T    VCQ L  C     R + +K +P
Sbjct:  248 LARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVN---QKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPRT----VCQKLEFC-----RADEKKRIP 470          

HSP 7 Score: 75.8702 bits (185), Expect = 1.966e-13
Identity = 55/207 (26.57%), Postives = 93/207 (44.93%), Query Frame = 2
Query: 3188 DLYQESSIGNASKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTI-----DACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY*SRNNIRKFL 3793
            DL    +  N+++ C ICR  ++  E + N    +  +   +   C + N   +  C +FY  VG +V + +L +     VC+ +  C  + +     K + L+ +V+ P+T+       C  C+  +  YE  +N     E +QT  +  C I      +LC  FY G G +VI  IL    P ++CQ +N+C S   R     FL
Sbjct:  378 DLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPR----TVCQKLEFCRADEK-----KRIPLIKMVK-PKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFL 574          

HSP 8 Score: 69.3218 bits (168), Expect = 1.674e-11
Identity = 44/202 (21.78%), Postives = 87/202 (43.07%), Query Frame = 2
Query: 3188 DLYQESSIGNASKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY*SRNNIRKFL 3793
            D++Q+ +    +K C  C   ++  E  IN  L    +   ++  C++   + +  C   +     K +K +L + ++  +C+ + +C          + + +  +  +      C  C + I   EI++N       +Q   L  C++   P  D C  FY G G +VIK +L   DP +VC+ L +C  +   +   +FL
Sbjct:  180 DIFQQPT----TKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFL 377          
BLAST of CLUMA_CG020609, isoform A vs. Planmine SMEST
Match: SMESG000019984.1 (SMESG000019984.1)

HSP 1 Score: 472.626 bits (1215), Expect = 9.638e-158
Identity = 229/232 (98.71%), Postives = 229/232 (98.71%), Query Frame = 2
Query: 3068 MRSIYFAGIFVLCYSFVQADNIRLLKDVKTFDKPVEQPNKDLYQESSIGNASKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY 3763
            MRSIYFAGIFVLCYSFVQADNIRLLKDVKTFDKPVEQPNKDLYQESSIGNASK CDICRKVVENYEAVINNDLPIRYILIKILQ CDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSI RCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY
Sbjct:    1 MRSIYFAGIFVLCYSFVQADNIRLLKDVKTFDKPVEQPNKDLYQESSIGNASKACDICRKVVENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY 232          

HSP 2 Score: 125.176 bits (313), Expect = 8.452e-32
Identity = 60/179 (33.52%), Postives = 103/179 (57.54%), Query Frame = 1
Query: 1543 NKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            +K C  C  +V+ YE ++N  L   YI  K++  CD+ N  +K  C  FY+G G +V+ AIL  E+   +C+L+N+C ++ E  Q   F+ L+++   +    D C  C+  I + E N N       +Q   L+YCSIF+  + ++C  +++ TG+++I+ ILKK +P +VC+ L+ C
Sbjct:   52 SKACDICRKVVENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMML-VQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVC 229          

HSP 3 Score: 107.842 bits (268), Expect = 7.230e-26
Identity = 62/216 (28.70%), Postives = 113/216 (52.31%), Query Frame = 1
Query:  277 VNADIKVQLDSEISTADQPRVHRNK--------------CEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQP-TTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLC 879
            V AD  ++L  ++ T D+P    NK              C+IC+ ++  Y++ I+  L  ++I  + LQ CD  +   ++ C  F++G G +++++I   E+S  +C+++N+C+ E   D++     L++  + QQP T   CT CV ++ + E +IN    PE+VQ   + YC IF+      C   +S    + IK +L ++D   +CQ L +C
Sbjct:   17 VQAD-NIRLLKDVKTFDKPVEQPNKDLYQESSIGNASKACDICRKVVENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMM--LVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVC 229          

HSP 4 Score: 105.145 bits (261), Expect = 7.402e-25
Identity = 52/168 (30.95%), Postives = 88/168 (52.38%), Query Frame = 1
Query: 2176 VEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLC 2679
            VE Y+  IN  L    I  K++  C +    +K QC  FY   G+ V+KA+L    ST +C+LM+ C+ ++E++   +F+ L+ ++   ++   C  C+ ++ W E N+N  N  + VQ    + CS+    Y  +C  ++S  G Q+IK +L   DP   CQ   +C
Sbjct:   62 VENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVC 229          

HSP 5 Score: 93.9745 bits (232), Expect = 4.636e-21
Identity = 59/221 (26.70%), Postives = 107/221 (48.42%), Query Frame = 1
Query:  832 LARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVN---QKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPRT----VCQKLEFC 1473
              ++D   + +++   D  V  PN        +++ E S+    + C++C+ +++  E  +N  L    I  ++L AC +     K +C +FY+G+G +V+K++L  E+ T VC+ + IC+   +  + ++F+ L+       + + C  C   I   E   N     E++Q    D+C IF CPY   C  FY   G +V + +L +T    VCQ L  C
Sbjct:   16 FVQADNIRLLKDVKTFDKPVEQPN-------KDLYQESSIGNASKACDICRKVVENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVC 229          

HSP 6 Score: 75.8702 bits (185), Expect = 8.572e-15
Identity = 52/196 (26.53%), Postives = 91/196 (46.43%), Query Frame = 1
Query: 1222 DLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPR----TVCQKLEFCRADEK-----KRIPLIKMVK-PKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQS 1779
            DL    +  N+++ C ICR  ++  E + N    +  +   +   C + N   +  C +FY  VG +V + +L +     VC+ +  C  + +     K + L+ +V+ P+T+       C  C+  +  YE  +N     E +QT  +  C I+     +LC  FY G G +VI  IL    P ++CQ +N+C S
Sbjct:   41 DLYQESSIGNASKACDICRKVVENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTI-----DACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCPS 231          
BLAST of CLUMA_CG020609, isoform A vs. Planmine SMEST
Match: SMESG000043279.1 (SMESG000043279.1)

HSP 1 Score: 68.9366 bits (167), Expect = 7.324e-13
Identity = 41/182 (22.53%), Postives = 92/182 (50.55%), Query Frame = 1
Query:  931 VFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLE-VREKVLPRTVCQKLEFC 1473
            + DE  ++  C+ C+N++  +  +++K+L+A  I N ++  C VF     +KC  ++   G+++++S+L +E  T VC+K+  C ++   H            + ++ + +C  C++ I+ +E        + +M+  ++ FC ++  P +  C+Q      ++ V + +     CQ L FC
Sbjct:   14 LLDEFIID--CDTCENLVDYIGNTIDKSLSAIQILNTLIDVCFVFKRIIHEKCCSYFYWKGMDIVESMLKNETSTFVCEKIIQCTRNVNIH------------SIVSISSRCSQCKMVIKWLENSLRTDGPITEMKNTLNKFCHLWTEPRD--CRQLISTANIQAVFDGISSVIACQYLSFC 179          

HSP 2 Score: 50.0618 bits (118), Expect = 1.678e-6
Identity = 24/74 (32.43%), Postives = 40/74 (54.05%), Query Frame = 1
Query: 1858 CQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYC 2079
            C +C  ++ +     + S SA++I   L++ C +F++     C  YF   G +I+ES+LK E    VCEK+  C
Sbjct:   22 CDTCENLVDYIGNTIDKSLSAIQILNTLIDVCFVFKRIIHEKCCSYFYWKGMDIVESMLKNETSTFVCEKIIQC 95          
BLAST of CLUMA_CG020609, isoform A vs. Planmine SMEST
Match: SMESG000020046.1 (SMESG000020046.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.134e-10
Identity = 64/252 (25.40%), Postives = 112/252 (44.44%), Query Frame = 1
Query:  205 LCQLFSENFKEVCHKNLSNDDKFTVNADIKV--QLDSEISTADQPRVH-RNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLC-----LYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTF-CKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEV 933
            +C+L  + F+  C   L  ++    N  IKV  QLD E+S   + R   + KC  C   +   +  I+ SL++  +QN  L +C     P ++    F K +G ++I  I + +  +KICQ+ N C     ++E+ D   N               +K C+ C +  + +      KL+ E++   + + C  F P +Q   CK   S    K I  ++    T  +C++L LC  +    +TL  + M E+
Sbjct:   33 ICRLLPKAFQLQCSSLLHENN----NKHIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPIKICQMENFCHKIEVIFENDDKVPN--------------PSKYCSICQSVSNQLGSLRKLKLSKEKINQVVGTACS-FGPTAQANECKAFLSIFQDKIISFMITEDKTVSLCESLRLCSTQKKSSDTLFGLPMLEL 265          

HSP 2 Score: 53.1434 bits (126), Expect = 5.358e-7
Identity = 50/212 (23.58%), Postives = 91/212 (42.92%), Query Frame = 1
Query: 1504 IKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDH----CQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTL 2127
            ++M K K       + C  C+  V   E  +N SL+++ +Q  ++ LC I ++  K   I F + +G ++I  IL  + P KICQ+ N C            ++++  +  + P P      CQS    +    K   + +   ++ G     CS      AN C  + +    +II  ++ ++    +CE L  C   ++Q + S  L  L
Sbjct:   65 LEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPIKICQMENFCHK----------IEVIFENDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQVVG---TACSFGPTAQANECKAFLSIFQDKIISFMITEDKTVSLCESLRLC---STQKKSSDTLFGL 260          

HSP 3 Score: 49.2914 bits (116), Expect = 9.011e-6
Identity = 38/149 (25.50%), Postives = 64/149 (42.95%), Query Frame = 1
Query:  955 QKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQF 1401
            +KC  C   + +LE  +N +L +  +QN +L  C + +SP K+K I F +  G ++I  +L  + P K+C+    C K     E        N     N ++ C IC+     +  +     + E++  VV   C          CK F
Sbjct:   79 RKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPIKICQMENFCHKIEVIFE--------NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQVVGTACSFGPTAQANECKAF 219          
BLAST of CLUMA_CG020609, isoform A vs. Planmine SMEST
Match: SMESG000019975.1 (SMESG000019975.1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.095e-9
Identity = 57/258 (22.09%), Postives = 108/258 (41.86%), Query Frame = 1
Query:  118 LFLLSAIFSSAES-NEISQFSVSTKGALKFLCQLFSENFKEVCHKNLSNDDKFTVNADIKVQLDSEISTADQPRVHRNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMR 888
            +FLLS+I    E  N IS       G  K LC LF E F+E C +            +I  Q+  +++ +++ +     C++C+ ++ +   AI  + S   ++    ++CD     ++ +C          +++ I ++  + KICQ I LC            + L  I   ++ +   C  C   ++ I + I  +   E+++ +L   C IF    +  C        ++ +K +L       IC  L LC+ R
Sbjct:    9 IFLLSSIHCVYEKINPISP------GEKKLLCTLFPETFREKCSEYSPTKPIGISEIEIHAQIKIKMTNSEENKSF--GCDVCKKLIQQVIDAIGSNHSKDVVRKELEKVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLC------------SSLAAISPPREKSV-LCWICSQIIEEIFKQIGERRVAEEIKRALEGVCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLCETR 245          

HSP 2 Score: 50.0618 bits (118), Expect = 4.628e-6
Identity = 48/205 (23.41%), Postives = 87/205 (42.44%), Query Frame = 1
Query: 1513 VKPKTVARHHNK--GCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLL 2121
            +K K      NK  GC  C  ++++  + +  + S + ++ ++  +CD      K +C          +++ I+ +    KICQ I LC S            L  I   R+ +   C  C  +I+   K     + A EI+  L   C+IF   + + C E+ +    EI++ IL+ +    +C  L  C  RN    +S+D +
Sbjct:   65 IKIKMTNSEENKSFGCDVCKKLIQQVIDAIGSNHSKDVVRKELEKVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLCSS------------LAAISPPREKS-VLCWICSQIIEEIFKQIGERRVAEEIKRALEGVCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLCETRNYPTIKSKDTM 256          
The following BLAST results are available for this feature:
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PSAPL11.691e-918.62prosaposin like 1 (gene/pseudogene) [Source:HGNC S... [more]
PSAP3.355e-921.47prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
PSAP3.805e-921.47prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sap-r6.390e-1419.05gene:FBgn0000416 transcript:FBtr0085714[more]
Sap-r7.166e-1419.05gene:FBgn0000416 transcript:FBtr0085713[more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psap2.982e-819.18prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
psap4.184e-819.09prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psap3.850e-1118.48prosaposin (variant Gaucher disease and variant me... [more]
psap2.274e-817.66prosaposin (variant Gaucher disease and variant me... [more]
psap6.134e-817.41prosaposin (variant Gaucher disease and variant me... [more]
psap7.987e-817.41prosaposin (variant Gaucher disease and variant me... [more]
psap1.086e-717.41prosaposin (variant Gaucher disease and variant me... [more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Psapl12.059e-719.19prosaposin-like 1 [Source:MGI Symbol;Acc:MGI:19241... [more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O13035|SAP_CHICK1.400e-922.12Prosaposin OS=Gallus gallus OX=9031 GN=PSAP PE=1 S... [more]
sp|Q6NUJ1|SAPL1_HUMAN8.119e-918.62Proactivator polypeptide-like 1 OS=Homo sapiens OX... [more]
sp|P07602|SAP_HUMAN1.611e-821.47Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV... [more]
sp|Q8C1C1|SAPL1_MOUSE1.316e-618.96Proactivator polypeptide-like 1 OS=Mus musculus OX... [more]
sp|P26779|SAP_BOVIN2.048e-618.24Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1 SV=3[more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131XQS93.374e-2819.65Putative saposin (Fragment) OS=Hyalomma excavatum ... [more]
A0A1I8GSE61.868e-2417.45Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G4W74.789e-2418.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GYV98.925e-2418.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7PW463.234e-2219.66Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO314551.814e-1319.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391782.853e-921.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sftpbb7.239e-720.34prosaposin-like [Source:NCBI gene;Acc:101161410][more]
sftpbb9.576e-720.34prosaposin-like [Source:NCBI gene;Acc:101161410][more]
back to top
BLAST of CLUMA_CG020609, isoform A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019986.15.806e-5699.17SMESG000019986.1[more]
SMESG000019984.19.638e-15898.71SMESG000019984.1[more]
SMESG000043279.17.324e-1322.53SMESG000043279.1[more]
SMESG000020046.11.134e-1025.40SMESG000020046.1[more]
SMESG000019975.12.095e-922.09SMESG000019975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027349 ID=SMED30027349|Name=CLUMA_CG020609, isoform A|organism=Schmidtea mediterranea sexual|type=transcript|length=3945bp
GGAACAGTCTGGCTCATTTATAAACATTTATGCTTGAATTTATCAACAGT
ATAAATAGTGATATCATAGTTGAAAATTCAGAGTGACAAAATGAATATTA
AAATATTTTCGAGATTTCTGTTTTTATTATCTGCAATTTTCAGCTCTGCC
GAATCAAATGAAATTTCTCAATTTTCCGTGAGTACAAAAGGAGCCTTGAA
ATTTTTGTGTCAACTATTTTCGGAAAATTTCAAAGAAGTTTGCCATAAAA
ACCTTTCAAATGACGACAAATTTACGGTGAATGCAGATATCAAGGTGCAG
CTGGATTCAGAGATCTCCACGGCCGATCAACCGAGAGTCCACAGAAACAA
ATGCGAAATATGCCAAGGAATAATGACTCGATATAAAAGCGCCATTGACA
TGTCACTATCAACTAAGCACATTCAAAATCGATTTCTGCAAATCTGTGAC
AGTGCCGATGTCCCTTTCAGAAAGATATGCGCGACTTTCTTCAAAGGAAA
AGGCTTGGAAATGATTGAATCTATAAGTCGGTCTGAAGACTCAATGAAAA
TTTGTCAGATTATTAATTTGTGCCTATATGAAGATAGCGATGACAAATAT
AACGTATTAACGGATCTGTTACTCATTGATATCTTTCAACAGCCGACCAC
AAAGCAGTGCACAAACTGTGTCGCATCATTGGATTTCATAGAACAGCACA
TTAACCCCAAGTTGAACCCGGAACAAGTCCAACACTCCTTGGTGAGTTAT
TGTGAAATATTCAAACCAAACTCTCAAACGTTTTGTAAAGGACTTTTCTC
CACCAATATCCTCAAAACAATCAAAGGAGTTTTGGCAAGATCTGATACGA
AAGAAATATGCCAGAATTTGACATTGTGTGATATGAGAGTCGTTGACCCG
AATACACTTGAAGTGATAAATATGTCTGAAGTGTTTGACGAAATCTCTGT
CAATCAGAAGTGCAATTTGTGTAAGAATATGATTAAATTATTGGAAATAT
CCGTTAATAAAACTCTCAATGCGACAAACATTCAAAACCGAGTCCTTTAC
GCGTGCACTGTGTTTACTTCACCTGCGAAAGACAAGTGCATAAAGTTTTA
TCAAGGGTTGGGATTAGAAGTGATCAAATCAGTTCTTGTTGACGAGGATC
CGACTAAGGTTTGCAAAAAACTGACTATATGCTTAAAACATGCCCAACAT
CATGAATCTTATCAGTTTCTTGATTTATTGAACACATTCACAACAATCAA
TTCGAATGAGAAGTGCAAAATATGCAGAATCCATATTCAATTGATTGAAA
GAATCTATAATCGTTCGAAGACATTGGAACAAATGCAAGCAGTAGTCGAT
GATTTCTGTGGCATATTCAACTGTCCATATGAATATCCCTGTAAGCAGTT
TTATGTCAAAGTCGGACTTGAAGTCCGTGAAAAGGTGCTTCCTCGGACTG
TCTGTCAGAAATTGGAATTTTGTCGTGCTGACGAAAAAAAACGAATCCCC
CTCATAAAAATGGTAAAACCTAAAACTGTAGCGAGGCACCATAACAAAGG
GTGCAAAAGTTGTATGTGGATCGTGAAAAGATATGAGAATATTGTTAACA
AGTCATTGAGTGCGGAATACATTCAAACAAAAGTCATTGGATTGTGTGAC
ATATATAATGCGACCGTGAAAAATCTATGCATCACATTTTATCAAGGAAA
AGGCCTCGAGGTAATAAATGCTATATTAGCATCTGAAAGTCCAAGGAAAA
TCTGTCAACTCATCAATTTGTGTCAAAGTGACAAGGAAAGGAGACAGGAA
AACAATTTTCTCGATTTATTACTGATCCATTTCCACCGGAAGCCAGCACC
GGATCACTGCCAGTCATGCATTACAATGATCAAATTTGAGGAGAAAAATT
TTAACAATTCCAAATCAGCGGTCGAAATTCAAGGAAAACTTCTCGAATAT
TGTTCAATTTTCCAACAGAAATTCGCCAATATTTGTGTAGAATATTTTAA
CTCAACGGGCTTTGAGATTATTGAGAGCATTTTAAAAAAAGAAAATCCTA
AAAAAGTCTGTGAAAAACTCCATTACTGCCACCAAAGAAATTCTCAGGGT
GAAGAAAGTCAAGATTTACTAACATTATTCTATCGAAAAGAGAAAGACGA
AGATTGCAAATTGTGCAAAAAGAGGGTCGAATTCTATAAAATCTCCATAA
ACAAATCTCTGAATCCGGCAGTTATCCAACAGAAAATGATTGCCGGATGC
GCTATTTACAAATTGTCCTTGAAAACCCAATGTGTTTTCTTTTACAATAC
TGCTGGGTTTGACGTCATTAAGGCGGTGTTGACAAATGGCGAGTCTACGA
CAATATGCAAATTAATGGACTTCTGTTTGGTGGATTCCGAGATCGAAGGC
TCTCATCAATTTTTGGATTTATTACAAATTCTTACATCCGGAAAGTCCGA
GAAAAAGTGTCAACTTTGCATTTCATCCGTTACGTGGTTAGAGGAAAATG
TAAACAAGGAGAATAGCTCAAAATTCGTGCAAGAACTGATGTTTGAAATT
TGCAGCGTCCTTTACCAACGATATCAGCGCATATGCGTCAAATACTTCTC
GACTAGAGGCCTTCAGCTCATCAAGGACGTCCTGAATGATGTCGATCCCA
ACGTGAGTTGTCAAACCCAGAAACTGTGTCGGAAAAGACATTCTGAAGTG
AACTTTTTTGCCAGAGATCATGAAATTTTCAACAAAATGTGTTTATTTCT
GAAAAAAGTAAACATAAACATTGAAGGTTTTCGATTTAACAAGAAAATTG
AGCCAATAACCAATAATATTCAAAGAAAATTACAATATTTTTGCCTTGCC
TATTCCAATGGGCAAAGTGTGAGTGCAAGGCAATTATATAGCAGTTCTTA
TCTCAATGACCAGTGCAAACTGTGCAAAGAAATCGTCTACATCGTCAACC
AGTTGGCCATTCCATTCAAGGATGAGACTGGATGGATCAATGTTCACAAT
ATTAATTATGATCTTGTGACATAGAAATAAGTATAAATTGCACTGTGATG
CACATACAAAATCAATAATGAGATCCATTTACTTCGCGGGAATATTTGTT
TTGTGCTATTCATTTGTCCAGGCGGATAATATCAGGCTTTTGAAAGACGT
GAAAACATTTGACAAACCTGTCGAACAACCGAATAAAGATTTATACCAAG
AATCATCAATTGGAAACGCCAGCAAAGGCTGCGACATTTGTCGAAAGGTT
GTTGAAAATTATGAGGCCGTGATTAATAATGACCTCCCAATACGCTATAT
CTTGATTAAAATCTTACAAGTTTGTGACCTTTTGAACTATGATATAAAGA
GACAATGCCACGAATTCTATAGAGGCGTGGGATATAAGGTCCTTAAAGCC
ATTCTTCACAAAGAGAACTCAACTGCAGTTTGTAGATTAATGAATATTTG
TGTCAATGAAACTGAATTAGACCAACATTTTAAATTCATGGGTCTAATGA
TGCTGGTTCAACAACCTCAAACAATTGACGCGTGTACATATTGTGTTGAT
ACAATTGCTTGGTATGAAATAAATATAAATTATTATAATAGACCAGAACG
TGTACAAACTGGTTTTCTTGATTATTGCTCAATTGTTAGATGTCCTTATA
ATGACCTTTGCTCGGTCTTTTATTCAGGAACTGGTTACCAAGTTATAAAG
TATATCCTCAAGAAAACTGACCCCATTCGAGTGTGTCAGTATCTCAATGT
CTGTCCATCATACTAATCTCGAAATAACATTCGAAAGTTCTTACCGAAAA
TCAATTACTAATTTAATTGAAATATTATTAACATTTATTTATTTGGATTA
CATAATCATTATTGAAATTAAATTAATATATTTATTTTGTAATTTATATA
AATAAATATTGTTTACTTGTTAATAAATTTAAAGTGAATTTGTTT
back to top

protein sequence of SMED30027349-orf-1

>SMED30027349-orf-1 ID=SMED30027349-orf-1|Name=SMED30027349-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=978bp
MNIKIFSRFLFLLSAIFSSAESNEISQFSVSTKGALKFLCQLFSENFKEV
CHKNLSNDDKFTVNADIKVQLDSEISTADQPRVHRNKCEICQGIMTRYKS
AIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSED
SMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFI
EQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLAR
SDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKL
LEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLV
DEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQ
LIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL
PRTVCQKLEFCRADEKKRIPLIKMVKPKTVARHHNKGCKSCMWIVKRYEN
IVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASES
PRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFE
EKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKK
ENPKKVCEKLHYCHQRNSQGEESQDLLTLFYRKEKDEDCKLCKKRVEFYK
ISINKSLNPAVIQQKMIAGCAIYKLSLKTQCVFFYNTAGFDVIKAVLTNG
ESTTICKLMDFCLVDSEIEGSHQFLDLLQILTSGKSEKKCQLCISSVTWL
EENVNKENSSKFVQELMFEICSVLYQRYQRICVKYFSTRGLQLIKDVLND
VDPNVSCQTQKLCRKRHSEVNFFARDHEIFNKMCLFLKKVNINIEGFRFN
KKIEPITNNIQRKLQYFCLAYSNGQSVSARQLYSSSYLNDQCKLCKEIVY
IVNQLAIPFKDETGWINVHNINYDLVT*
back to top

protein sequence of SMED30027349-orf-2

>SMED30027349-orf-2 ID=SMED30027349-orf-2|Name=SMED30027349-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MRSIYFAGIFVLCYSFVQADNIRLLKDVKTFDKPVEQPNKDLYQESSIGN
ASKGCDICRKVVENYEAVINNDLPIRYILIKILQVCDLLNYDIKRQCHEF
YRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQP
QTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIVRCPYNDLCSV
FYSGTGYQVIKYILKKTDPIRVCQYLNVCPSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008138SapB_2
IPR008373Saposin
IPR008139SaposinB_dom
IPR011001Saposin-like
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
Vocabulary: biological process
TermDefinition
GO:0006665sphingolipid metabolic process
GO:0006629lipid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 976..977
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 287..374
e-value: 4.5E-9
score: 38.7
coord: 587..670
e-value: 4.0E-11
score: 45.3
coord: 483..570
e-value: 1.2E-9
score: 40.6
coord: 186..267
e-value: 3.6E-6
score: 29.4
coord: 386..469
e-value: 3.9E-6
score: 29.3
coord: 82..168
e-value: 6.1E-9
score: 38.3
coord: 785..870
e-value: 2.9E-9
score: 39.3
NoneNo IPR availablePANTHERPTHR11480:SF68SAPOSIN A-RELATEDcoord: 683..767
coord: 478..567
coord: 586..669
NoneNo IPR availablePANTHERPTHR11480:SF68SAPOSIN A-RELATEDcoord: 286..464
NoneNo IPR availablePANTHERPTHR11480:SF68SAPOSIN A-RELATEDcoord: 78..264
coord: 785..895
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 78..264
coord: 683..767
coord: 785..895
coord: 478..567
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 286..464
coord: 586..669
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.819
IPR008139Saposin B type domainSMARTSM00741sapb_4coord: 788..863
e-value: 0.025
score: 23.7
coord: 188..263
e-value: 0.039
score: 23.1
coord: 390..461
e-value: 1.4
score: 6.5
coord: 687..762
e-value: 0.014
score: 24.6
coord: 289..364
e-value: 3.8E-6
score: 36.4
coord: 86..161
e-value: 0.0025
score: 27.0
coord: 588..663
e-value: 3.7E-7
score: 39.8
coord: 486..561
e-value: 1.3E-5
score: 34.7
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 388..465
score: 10.157
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 586..667
score: 13.215
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 186..267
score: 10.703
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 287..368
score: 12.435
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 84..165
score: 12.622
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 484..565
score: 14.478
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 786..867
score: 13.698
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 685..766
score: 10.22
IPR008138Saposin B type, region 2PFAMPF03489SapB_2coord: 632..663
e-value: 2.2E-4
score: 21.2
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 588..665
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 485..563
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 789..865
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 390..462
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 688..762
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 189..264
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 290..364
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 87..161