Ras-related protein

Overview
NameRas-related protein
Smed IDSMED30027339
Length (bp)842
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein (SMED30027339) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein (SMED30027339) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein (SMED30027339) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein (SMED30027339) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027339

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30027339SMESG000078456.1 dd_Smed_v4_3698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027339SMESG000078456.1 dd_Smed_v4_3698_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein vs. Ensembl Human
Match: RAB5A (RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9783])

HSP 1 Score: 209.149 bits (531), Expect = 5.429e-67
Identity = 102/194 (52.58%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--SASNSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  +   A+++R     + E  Q     CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS 214          
BLAST of Ras-related protein vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 209.149 bits (531), Expect = 5.728e-67
Identity = 98/194 (50.52%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R ++   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A+ +   N  +   E +      CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS 215          
BLAST of Ras-related protein vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 209.149 bits (531), Expect = 5.728e-67
Identity = 98/194 (50.52%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R ++   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A+ +   N  +   E +      CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS 215          
BLAST of Ras-related protein vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 209.534 bits (532), Expect = 1.016e-66
Identity = 98/194 (50.52%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R ++   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A+ +   N  +   E +      CC+
Sbjct:   55 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS 248          
BLAST of Ras-related protein vs. Ensembl Human
Match: RAB5B (RAB5B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9784])

HSP 1 Score: 205.682 bits (522), Expect = 1.078e-65
Identity = 97/195 (49.74%), Postives = 136/195 (69.74%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE----SASNSRSNNFSIEKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L ++V +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ +F RA  W+ EL    S    I L GNK DL+  R+++   AQ +AD+N+LLF+ETSAK ++N+ ++F+ +A+K PKS  +    +A  SR  +   +  Q K+  CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS-QCCS 214          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: rab-5 (RAB family [Source:UniProtKB/TrEMBL;Acc:P91857])

HSP 1 Score: 197.208 bits (500), Expect = 8.120e-63
Identity = 94/191 (49.21%), Postives = 129/191 (67.54%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI-EKDQVKTFSCC 657
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ SF +A NW+ EL    S    + L GNK D++  R ++   A  +A++N LLF+ETSAK S+N+ +IF+ +A+K P   I  A    +    + +  Q +  SCC
Sbjct:   20 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKLP---IGPAQGEPTGTVDMNQPQQQQKGSCC 207          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 151.369 bits (381), Expect = 5.040e-45
Identity = 72/196 (36.73%), Postives = 114/196 (58.16%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLA-----RKYPKSAIESASNSRSNNFSIEKDQVKTFSCC 657
            + K++L+GDS VGK+ + L    D + E+  +T+G  +  +T+E+D    K  IWDTAGQER++++T  YYRGAH  I+VYDIT++ +F     W+ E++         +LVGNKCDL+  R +++  AQ +A +  + F+ETSAK S N+++ F+ +A     R  P      A   R       +D+ K+  CC
Sbjct:   11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRMGPVQGAGGAPGVRITGSQPVQDK-KSGGCC 205          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 142.51 bits (358), Expect = 1.449e-41
Identity = 78/196 (39.80%), Postives = 112/196 (57.14%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--------SASNSRSNNFSIEKDQVKTF 648
            + K++L+GDS VGKT +      D FN +  +T+G  +  +T+E+D    K  IWDTAGQER++++T  YYRGA   I+VYDITN  SF    NWI  + E  ++    +++GNKCD+ E R +  +  ++ A E    F+ETSAK ++NI E F  LAR   KS +E        S SN+   N      Q K+F
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARD-IKSKMEQNEMRAGGSVSNTGRVNVGGSGTQKKSF 202          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 142.51 bits (358), Expect = 1.449e-41
Identity = 78/196 (39.80%), Postives = 112/196 (57.14%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--------SASNSRSNNFSIEKDQVKTF 648
            + K++L+GDS VGKT +      D FN +  +T+G  +  +T+E+D    K  IWDTAGQER++++T  YYRGA   I+VYDITN  SF    NWI  + E  ++    +++GNKCD+ E R +  +  ++ A E    F+ETSAK ++NI E F  LAR   KS +E        S SN+   N      Q K+F
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARD-IKSKMEQNEMRAGGSVSNTGRVNVGGSGTQKKSF 202          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: rab-21 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q22045])

HSP 1 Score: 140.969 bits (354), Expect = 6.129e-41
Identity = 71/193 (36.79%), Postives = 116/193 (60.10%), Query Frame = 1
Query:   91 KVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFS---IEKDQV-KTFSCC 657
            K+VLLG+  VGK+S+ L  V+++F+    +T+ A + NKTV V++      IWDTAGQE+Y +L P+YYRG++  ++V+DIT+R SF +  NW+ E+         I++VGNK DL E R +    A+ +A+    L++ETSA+ ++ I + F  L  K  + +   ++   S N S   I+ D+  ++  CC
Sbjct:   14 KIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILIVGNKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTNRSIRLIDNDEAERSKKCC 206          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0330670)

HSP 1 Score: 197.593 bits (501), Expect = 7.847e-63
Identity = 91/168 (54.17%), Postives = 124/168 (73.81%), Query Frame = 1
Query:   73 NSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDI N+ SF RA  W+ EL++  S    I L GNK DLS  RV++ + A+++A+EN LLF+ETSAK  +N+ +IF+ +A+K PK
Sbjct:   25 NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK 192          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077796)

HSP 1 Score: 197.593 bits (501), Expect = 7.847e-63
Identity = 91/168 (54.17%), Postives = 124/168 (73.81%), Query Frame = 1
Query:   73 NSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDI N+ SF RA  W+ EL++  S    I L GNK DLS  RV++ + A+++A+EN LLF+ETSAK  +N+ +IF+ +A+K PK
Sbjct:   25 NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK 192          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077793)

HSP 1 Score: 197.593 bits (501), Expect = 7.847e-63
Identity = 91/168 (54.17%), Postives = 124/168 (73.81%), Query Frame = 1
Query:   73 NSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDI N+ SF RA  W+ EL++  S    I L GNK DLS  RV++ + A+++A+EN LLF+ETSAK  +N+ +IF+ +A+K PK
Sbjct:   25 NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK 192          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077797)

HSP 1 Score: 197.593 bits (501), Expect = 7.847e-63
Identity = 91/168 (54.17%), Postives = 124/168 (73.81%), Query Frame = 1
Query:   73 NSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDI N+ SF RA  W+ EL++  S    I L GNK DLS  RV++ + A+++A+EN LLF+ETSAK  +N+ +IF+ +A+K PK
Sbjct:   25 NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK 192          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077795)

HSP 1 Score: 197.593 bits (501), Expect = 7.847e-63
Identity = 91/168 (54.17%), Postives = 124/168 (73.81%), Query Frame = 1
Query:   73 NSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDI N+ SF RA  W+ EL++  S    I L GNK DLS  RV++ + A+++A+EN LLF+ETSAK  +N+ +IF+ +A+K PK
Sbjct:   25 NKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPK 192          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: rab5ab (RAB5A, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040122-3])

HSP 1 Score: 211.46 bits (537), Expect = 4.375e-68
Identity = 101/194 (52.06%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  + A  + + N  +   E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVSEIFMAIAKKLPKNEPQPAGANTARNRGVDLTETAQPAKGPCCS 215          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: rab5aa (RAB5A, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-030131-139])

HSP 1 Score: 211.46 bits (537), Expect = 4.569e-68
Identity = 103/194 (53.09%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESAS--NSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PKS  ++A   + RS    + E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANSGRSRGVDLTETAQPTKAPCCS 215          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: rab5aa (RAB5A, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-030131-139])

HSP 1 Score: 211.46 bits (537), Expect = 4.569e-68
Identity = 103/194 (53.09%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESAS--NSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PKS  ++A   + RS    + E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANSGRSRGVDLTETAQPTKAPCCS 215          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 206.453 bits (524), Expect = 4.007e-66
Identity = 95/164 (57.93%), Postives = 123/164 (75.00%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKS 579
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +FTRA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PKS
Sbjct:   23 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKS 186          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 206.453 bits (524), Expect = 4.007e-66
Identity = 95/164 (57.93%), Postives = 123/164 (75.00%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKS 579
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +T+ +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +FTRA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PKS
Sbjct:   23 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKS 186          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: rab5a (RAB5A, member RAS oncogene family [Source:NCBI gene;Acc:493430])

HSP 1 Score: 208.764 bits (530), Expect = 5.916e-67
Identity = 101/194 (52.06%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNS--RSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  ++  ++  R     + E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQEAQAYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKTEPQAGGSNTIRGRGVDLTETAQPTKSQCCS 215          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: rab5b (RAB5B, member RAS oncogene family [Source:NCBI gene;Acc:448258])

HSP 1 Score: 203.756 bits (517), Expect = 5.680e-65
Identity = 96/194 (49.48%), Postives = 135/194 (69.59%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--SASNSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L ++V +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ +F RA  W+ EL    S    I L GNK DL+  R+++   AQ +AD+N+LLF+ETSAK ++N+ ++F+ +A+K PK+  +  S +  RS    + E+ Q     CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPNIVIALSGNKADLTSKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKTEPQNTSGAPGRSRGVDLHEQTQQNKSQCCS 214          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: rab5d (RAB5D, member RAS oncogene family [Source:NCBI gene;Acc:594964])

HSP 1 Score: 196.052 bits (497), Expect = 5.042e-62
Identity = 94/194 (48.45%), Postives = 131/194 (67.53%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIES---ASNSRSNNFSIEKDQVKTFSCCA 660
             K+VLLGD AVGK+S+ L  VK QF+E QE T+GA +L ++V +D+   KF+IWDTAGQERY SL PMYYRGA AAI+V+DIT   +F RA  W+ EL    S    I L GNK DL+E R+++   AQ +A++  LLF+ETSAK ++N+ E+F+ +A+K PKS  ++   A+ +R  N    + Q ++  CC 
Sbjct:   20 FKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQASPNIVIALAGNKSDLAEKRMVEYEEAQAYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKSDAQNPTHAARNRGVNVQGSEQQPRS-GCCG 212          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: ncapd2 (non-SMC condensin I complex subunit D2 [Source:Xenbase;Acc:XB-GENE-5854776])

HSP 1 Score: 160.999 bits (406), Expect = 1.376e-48
Identity = 79/191 (41.36%), Postives = 116/191 (60.73%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVK-TFSCC 657
            +KV LLGD+ VGK+SI    V+D F+ N   T+GA ++ KTV   N   KF IWDTAGQER+ SL PMYYRG+ AA+IVYDIT + +F     W+ EL E       + + GNKCDLS+ R +    A+++A+    + +ETSAK +IN++E+F  ++R+ P   ++   N  +    + +   + T  CC
Sbjct:    6 LKVCLLGDTGVGKSSIVSRFVQDHFDHNISPTIGASFMTKTVPSGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDTREVTMKDAREYAESIGAIVVETSAKNAINVEELFQGISRRIP--PLDPHENGSNGAMKLGRQSFQSTTRCC 194          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 158.688 bits (400), Expect = 1.552e-47
Identity = 77/200 (38.50%), Postives = 121/200 (60.50%), Query Frame = 1
Query:   67 MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESAS-NSRSNNFSIEKDQVKTFS--CC 657
            M  +  + K++L+GDS VGK+ + L    D + E+  +T+G  +  +T+E+D    K  IWDTAGQER++++T  YYRGAH  I+VYD+T++ SF     W+ E++   S     +LVGNKCDL+  +V+D  TA++FAD   + F+ETSAK + N+++ F+ +A +  K     A+   +  N  I+   VK  S  CC
Sbjct:    6 MPTNDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGQEKNVKIQSTPVKQSSGGCC 205          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rab5a (RAB5A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105926])

HSP 1 Score: 209.534 bits (532), Expect = 2.690e-67
Identity = 102/194 (52.58%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--SASNSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  +   A+++R     + E  Q     CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPAQPARSQCCS 214          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 207.223 bits (526), Expect = 2.214e-66
Identity = 97/194 (50.00%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R ++   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A+ +      +   E +      CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCS 215          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rab5b (RAB5B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105938])

HSP 1 Score: 205.682 bits (522), Expect = 7.401e-66
Identity = 97/195 (49.74%), Postives = 136/195 (69.74%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE----SASNSRSNNFSIEKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L ++V +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ +F RA  W+ EL    S    I L GNK DL+  R+++   AQ +AD+N+LLF+ETSAK ++N+ ++F+ +A+K PKS  +    +A  SR  +   +  Q K+  CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS-QCCS 214          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 198.364 bits (503), Expect = 1.241e-62
Identity = 98/212 (46.23%), Postives = 134/212 (63.21%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVID------------------SNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R ++                  S  AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A+ +      +   E +      CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQPCHLPCSPPTLFLTCLSQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCS 233          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rab22a (RAB22A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105072])

HSP 1 Score: 175.252 bits (443), Expect = 3.554e-54
Identity = 84/190 (44.21%), Postives = 120/190 (63.16%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCC 657
            +KV LLGD+ VGK+SI    V+D F+ N   T+GA ++ KTV+  N   KF IWDTAGQER+++L PMYYRG+ AAIIVYDIT   +F+   NW+ EL +       + + GNKCDL++ R +    A+ +AD  + +F+ETSAK +INI E+FI ++R+ P +    AS  +      +  + K  SCC
Sbjct:    6 LKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANPASGGKGFKLRRQPSEPKR-SCC 194          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|P51147|RAB5C_CANLF (Ras-related protein Rab-5C OS=Canis lupus familiaris OX=9615 GN=RAB5C PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.001e-66
Identity = 99/194 (51.03%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R ++   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A+ + S N  +   E        CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPSRNRGVDLQENSPASRSQCCS 215          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|Q98932|RAB5C_CHICK (Ras-related protein Rab-5C OS=Gallus gallus OX=9031 GN=RAB5C PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.023e-66
Identity = 100/194 (51.55%), Postives = 132/194 (68.04%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +F RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK+  ++A      N  +   E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFVRAKNWVKELQRQASPNIVIALAGNKADLATKRAVDFQDAQTYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAPGGPGRNRVVDLQESSQPSRSQCCS 215          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|P61271|RAB5A_MACFA (Ras-related protein Rab-5A OS=Macaca fascicularis OX=9541 GN=RAB5A PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.821e-66
Identity = 102/194 (52.58%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--SASNSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  +   A+++R     + E  Q     CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCS 214          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|P18066|RAB5A_CANLF (Ras-related protein Rab-5A OS=Canis lupus familiaris OX=9615 GN=RAB5A PE=1 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.821e-66
Identity = 102/194 (52.58%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--SASNSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  +   A+++R     + E  Q     CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCS 214          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|Q0IIG7|RAB5A_BOVIN (Ras-related protein Rab-5A OS=Bos taurus OX=9913 GN=RAB5A PE=1 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.861e-66
Identity = 102/194 (52.58%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIE--SASNSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  +   A+++R     + E  Q     CC+
Sbjct:   21 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSTRGRGVDLTEPTQPTRSQCCS 214          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A5N5KS34 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00125590 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 6.364e-67
Identity = 106/200 (53.00%), Postives = 135/200 (67.50%), Query Frame = 1
Query:   70 SNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
            SN     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PKS  ++A  S   N  +   E  Q     CC+
Sbjct:   17 SNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGTSAGRNRGVDLAETAQPAKGPCCS 216          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A3Q2XIQ5 (RAB5A, member RAS oncogene family, b OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 7.255e-67
Identity = 104/194 (53.61%), Postives = 136/194 (70.10%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  ++AS S   N  +   E  Q  + +CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFVRAKNWVKELQRQASPNIVIALAGNKADLASKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQAASASGGRNRGVDLTESAQPSSRTCCS 215          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A3B5K5U0 (RAB5A, member RAS oncogene family, a OS=Takifugu rubripes OX=31033 GN=LOC101071138 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.016e-66
Identity = 103/194 (53.09%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A++ PKS  ++A  S   N  +   E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAAGGSSGRNRGVDLTEAAQPAKAPCCS 215          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A3Q2DC15 (RAB5A, member RAS oncogene family, b OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.050e-66
Identity = 104/194 (53.61%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+  + A  S   N  +   E  Q  + SCC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFVRAKNWVKELQRQASPNIVIALAGNKADLASKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQPAGASSGRNRGVDLTEAAQPSSRSCCS 215          
BLAST of Ras-related protein vs. TrEMBL
Match: H3CUX2 (RAB5A, member RAS oncogene family, a OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.184e-66
Identity = 104/194 (53.61%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A++ PKS  ++A  S   N  +   E  Q    SCC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAAGGSSVRNRGVDLTEAAQPAKASCCS 215          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: rab5ab (ras-related protein Rab-5A [Source:NCBI gene;Acc:103038585])

HSP 1 Score: 216.083 bits (549), Expect = 6.011e-70
Identity = 106/200 (53.00%), Postives = 134/200 (67.00%), Query Frame = 1
Query:   70 SNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
            SN     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PKS  + A  S   N  +   E  Q     CC+
Sbjct:   17 SNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQPAGASTGRNRGVDLAETAQPAKGPCCS 216          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: rab5aa (ras-related protein Rab-5A [Source:NCBI gene;Acc:103027170])

HSP 1 Score: 209.92 bits (533), Expect = 1.540e-67
Identity = 102/194 (52.58%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESAS--NSRSNNFSI-EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A++ PKS  ++A   + RS    + E        CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAAGTNSGRSRGVDLTETAPPAKAPCCS 215          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:103045387])

HSP 1 Score: 206.068 bits (523), Expect = 5.536e-66
Identity = 95/163 (58.28%), Postives = 122/163 (74.85%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  +FTRA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK
Sbjct:   23 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPK 185          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: ENSAMXT00000046211.1 (ras-related protein Rab-5C [Source:NCBI gene;Acc:103035226])

HSP 1 Score: 205.682 bits (522), Expect = 5.582e-66
Identity = 96/163 (58.90%), Postives = 122/163 (74.85%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAIIVYDITN  +FTRA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK
Sbjct:   17 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIIVYDITNTDTFTRAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPK 179          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: rab5b (ras-related protein Rab-5B-like [Source:NCBI gene;Acc:103034209])

HSP 1 Score: 195.282 bits (495), Expect = 7.617e-62
Identity = 93/194 (47.94%), Postives = 131/194 (67.53%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNS---RSNNFSIEKDQVKTFSCCA 660
             K+VLLGD AVGK+S+ L  VK QF+E QE T+GA +L ++V +D+   KF+IWDTAGQERY SL PMYYRGA AAI+V+DIT   +F RA  W+ EL    S    I L GNK DL++ R+++   AQ +A++  LLF+ETSAK ++N+ E+F+ +A+K PK+  ++A+++   R  N   + D     SCC 
Sbjct:   21 FKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFERAKAWVKELQRQASPNIVIALAGNKADLADKRLVEYEEAQTYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKTDTQNATHAARYRGVNLQ-DPDAQSNRSCCG 213          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 208.379 bits (529), Expect = 8.247e-68
Identity = 98/196 (50.00%), Postives = 134/196 (68.37%), Query Frame = 1
Query:   70 SNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCC 657
            +N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA  W+ EL    +    I L GNK DL+  R+++   AQ +A+EN LLF+ETSAK ++N+ E+F+ +A+K PK+  ++    +SN   I+     + SCC
Sbjct:   16 TNKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVSLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNLDSFARAKTWVKELQRQANPTIVIALSGNKADLASQRMVEFEEAQGYAEENGLLFMETSAKTAMNVNEVFLAIAKKLPKNEQQN-PGGKSNVVPIDPTSQTSSSCC 210          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 205.297 bits (521), Expect = 1.378e-66
Identity = 96/197 (48.73%), Postives = 134/197 (68.02%), Query Frame = 1
Query:   70 SNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCCA 660
             N     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ SF RA NW+ EL    +    I L GNK DL+  R +D   AQ ++++N LLF+ETSAK ++N+ ++F+ +A+K PK+  + +  S + N ++E        CCA
Sbjct:   16 GNKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDSFARAKNWVKELQRQANPNIVIALAGNKTDLANQRTVDFEEAQGYSEDNGLLFMETSAKTAMNVNDVFLAIAKKLPKN--DQSMQSGNANLTVEPPPPSRSQCCA 210          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000009.1 (pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1 gene:ENSPMAG00000000008.1 transcript:ENSPMAT00000000009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.756 bits (517), Expect = 8.302e-66
Identity = 96/200 (48.00%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   70 SNSQVI-IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI--EKDQVKTFSCCA 660
            S S+++  K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ +F+RA  W+ EL    S    I L GNK DL+  R+++   AQ +AD+N LLF+ETSAK ++N+ +IF+ +A+K P+S             S+    D  +  +CC+
Sbjct:   20 STSKILQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFSRAKTWVKELQRQASPNIVIALAGNKADLASKRIVEFEEAQSYADDNGLLFMETSAKTAMNVNDIFLAIAKKLPRSEPPGTGTKAHGMVSLGPGPDSHQRRTCCS 219          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: RAB31 (RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9771])

HSP 1 Score: 165.236 bits (417), Expect = 3.599e-51
Identity = 80/190 (42.11%), Postives = 113/190 (59.47%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCC 657
            +KV LLGD+ VGK+SI    V+D F+ N   T+GA ++ KT+   N   K+ IWDTAGQER++SL PMYYRG+ AA+IVYDIT   SF    +W+ EL +       + + GNKCDL + R +    A+ +AD  + +FIETSAK +INI EIF  ++ + P  + +S+       F +         CC
Sbjct:    6 LKVCLLGDTGVGKSSIVCRFVQDNFDPNINPTIGASFMTKTMPQGNEVHKYLIWDTAGQERFRSLAPMYYRGSAAAVIVYDITKEESFQMLKSWVRELRQHGPQDIIVAIAGNKCDLDDMREVSVQDARDYADSIDAIFIETSAKSAINICEIFARISERVPPGSQDSSDRP---GFQLRGAGQPARRCC 192          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 157.147 bits (396), Expect = 9.237e-48
Identity = 76/195 (38.97%), Postives = 120/195 (61.54%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSN--NFSIEKDQVKT--FSCC 657
            + K++L+GDS VGK+ + L    D + E+  +T+G  +  +T+E+D    K  IWDTAGQER++++T  YYRGAH  I+VYD+T++ SF     W+ E++   S     +LVGNKCDL+  +V+D  TA++FAD   + F+ETSAK + N+++ F+ +A +  K     A+ + +   N  I+   VKT    CC
Sbjct:   11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATQAGAGKSNVKIDSTPVKTGGGGCC 205          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 173.711 bits (439), Expect = 2.167e-54
Identity = 90/189 (47.62%), Postives = 123/189 (65.08%), Query Frame = 1
Query:   67 MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSE---HRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYP-KSAIE--SASNSRSNN 615
            M+ S   IK+VLLG++AVGK+SI L  V + F EN+E T+GA +L + V ++    KF+IWDTAGQER+ SL PMYYR A AA++VYD+T   SF +A +W+ EL+E  S    I LVGNK D+ +    R +     +K A+E  LLF ETSAK   N+ ++F+ +  K P K+A E  SASN R +N
Sbjct:    1 MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNERESN 189          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: YPT53 (Stress-induced Rab family GTPase; required for vacuolar protein sorting and endocytosis; involved in ionic stress tolerance; similar to Vps21p and Ypt52p; functional homolog of Vps21p; mammalian Rab5 homolog; YPT53 has a paralog, VPS21, that arose from the whole genome duplication [Source:SGD;Acc:S000005037])

HSP 1 Score: 167.548 bits (423), Expect = 7.563e-52
Identity = 83/170 (48.82%), Postives = 107/170 (62.94%), Query Frame = 1
Query:   82 VIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDL------SEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYP 573
            + IKVVLLG+SAVGK+SI L  V D F E++E T+GA +L K +  D    KF+IWDTAGQER+  L PMYYR A AA++V+D+TN  SF +A NW+ EL+E       I LVGNK DL      +E+R + +   Q   +  NLL+ E SAK   NI +IF  L  K P
Sbjct:   11 LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVP 180          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 151.754 bits (382), Expect = 7.748e-46
Identity = 68/165 (41.21%), Postives = 110/165 (66.67%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKS 579
            + K++L+G+S VGK+ + L    D +  +  +T+G  +  KTVE+D    K  IWDTAGQER++++T  YYRG+H  IIVYD+T++ SF     W+ E++   ++    +LVGNKCDL + RV++ + A++FAD N + F+ETSA  S N+++ F+ +AR+  +S
Sbjct:    8 LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKES 172          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: YPT52 (Endosomal Rab family GTPase; required for vacuolar protein sorting, endocytosis and multivesicular body (MVB) biogenesis and sorting; required for localization of the CORVET complex to endosomes; involved in autophagy and ionic stress tolerance; similar to Vps21p and Ypt53p; mammalian Rab5 homolog; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001722])

HSP 1 Score: 151.754 bits (382), Expect = 1.452e-45
Identity = 82/189 (43.39%), Postives = 112/189 (59.26%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTV--------EVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAEL-NEITSTVKTIILVGNKCDLSEH--------------------RVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARK 567
             K+VLLGDS+VGK+SI    VKD F+E +E+T+GA +L++++        E  ++  KF+IWDTAGQERYKSL PMYYR A+AA++VYDIT   S  +A NW+ EL N++      I L+GNK DL +                     R I +  A+++A E  LLF E SAK    +KEIF  +  K
Sbjct:    4 FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEK 192          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 145.206 bits (365), Expect = 3.399e-43
Identity = 68/156 (43.59%), Postives = 103/156 (66.03%), Query Frame = 1
Query:   82 VIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIF 549
            ++ K+VL+GDS VGK+++     K++FN + ++T+G  +  +T+E+D    K  IWDTAGQERY+++T  YYRGA  A+IVYDI+  SS+   N+W++EL E       + L+GNK DL+  R + +  ++ FA EN LLF ETSA  S N+ + F
Sbjct:   12 LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAF 167          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO49482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG79])

HSP 1 Score: 199.904 bits (507), Expect = 4.438e-64
Identity = 91/164 (55.49%), Postives = 122/164 (74.39%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKS 579
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN+ +F RA  W+ EL    S    I L GNK DL+  R+++   AQ +A++N LLF+ETSAK ++N+ +IF+ +A+K PKS
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFARAKTWVKELQRQASPNIVIALSGNKADLASKRMVEYEDAQSYAEDNGLLFMETSAKTAMNVNDIFLAIAKKLPKS 185          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO40557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S718])

HSP 1 Score: 154.451 bits (389), Expect = 1.980e-46
Identity = 79/192 (41.15%), Postives = 112/192 (58.33%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRS-NNFSIEKDQVKTFSCCA 660
            +KV LLGD+ VGK+ +    V D FN +   T+GA ++ K + V++  +KF+IWDTAGQER+KSL P+YYR A AAI+VYDIT  S+F     WI EL         I + GNKCD ++ R +    AQ FA   + +F ETSA  S N+  +F  L +K P   +E   + +    F  E+   K+ +CC+
Sbjct:   13 LKVCLLGDAGVGKSCLVHRFVSDIFNASSPPTIGAAFMTKMMIVNDKAYKFNIWDTAGQERFKSLAPLYYRDAAAAILVYDITIESTFHSLRPWIRELQRYGPQDIVIAVAGNKCDKADQRDVQVQDAQDFAGSVDAIFAETSALTSKNVHWLFEELCKKLPHENMEVPYHHKKIGTFRPEERPNKSGNCCS 204          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO43129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN1])

HSP 1 Score: 150.599 bits (379), Expect = 5.194e-45
Identity = 70/160 (43.75%), Postives = 104/160 (65.00%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLAR 564
            + K++L+GDS VGK+ + L  V D   E+ + T+G  +  KT+ VD    K  IWDTAGQER++++T  YYRGAH  +IVYDIT R S+   + W+ E+    S    +ILVGNK DL   R +  + AQ++A  +++ F+ETSAK + N+KE F++L+R
Sbjct:   16 LFKILLIGDSGVGKSCLLLRFVDDSHRESYQTTIGVDFKIKTMRVDGKVVKLQIWDTAGQERFRTITSSYYRGAHGVMIVYDITKRESYNNLHKWLMEVETYASEGVHMILVGNKIDLDTDREVQPDAAQEWAALHDMPFVETSAKGAKNVKEAFLVLSR 175          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 149.828 bits (377), Expect = 9.874e-45
Identity = 73/196 (37.24%), Postives = 117/196 (59.69%), Query Frame = 1
Query:   85 IIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLA-----RKYPKSAIESASNSRSNNFSIEKDQVKTFSCC 657
            + K++L+GDS VGK+ + L    D + E+  +T+G  +  +T+E+D    K  IWDTAGQER++++T  YYRGAH  I+VYD+T++ SF     W+ E++         +LVGNKCDL+  +V+D  TA+++A+   + F+ETSAK + N+++ F+ +A     R  P  A + A ++   N S    Q     CC
Sbjct:   11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRMGPSPAPQGAGSNVKINSSTPVKQ-GGGGCC 205          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO49117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU7])

HSP 1 Score: 146.362 bits (368), Expect = 5.874e-43
Identity = 68/159 (42.77%), Postives = 103/159 (64.78%), Query Frame = 1
Query:   73 NSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIF 549
            N   + K+VL+GDS VGK+++     K++F+   +AT+G    ++ VE++    +  IWDTAGQERY+++T  YYRGA  A++VYDI   +SF   N W+ EL +  S   +IIL+GNK DL   R+I++   ++FA E+ +LF+ETSA  S N+ E F
Sbjct:   14 NYDYLFKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDTAGQERYRAITSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLKHLRMIENRRGKQFAAEHGMLFMETSALDSTNVAEAF 172          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: rab5ab (ras-related protein Rab-5A-like [Source:NCBI gene;Acc:101157247])

HSP 1 Score: 213.386 bits (542), Expect = 6.831e-69
Identity = 103/194 (53.09%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A+K PK+   +A  S + N  +   E  Q  +  CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFVRAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPAAAGASGARNRGVDLTETAQPASRPCCS 215          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: rab5aa (ras-related protein Rab-5A [Source:NCBI gene;Acc:101159835])

HSP 1 Score: 211.075 bits (536), Expect = 5.692e-68
Identity = 100/194 (51.55%), Postives = 132/194 (68.04%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSI---EKDQVKTFSCCA 660
             K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+VYDITN  SF RA NW+ EL    S    I L GNK DL+  R ++   AQ +AD+N+LLF+ETSAK S+N+ EIF+ +A++ PKS  ++   +   N  +   E  Q     CC+
Sbjct:   22 FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRAVEFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAPGATSGRNRGVDLTEAAQPAKAPCCS 215          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:101162840])

HSP 1 Score: 203.756 bits (517), Expect = 3.984e-65
Identity = 96/169 (56.80%), Postives = 124/169 (73.37%), Query Frame = 1
Query:   70 SNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            SN     K+VLLG+SAVGK+S+ L  VK QF+E QE+T+GA +L +TV +D+   KF+IWDTAGQERY SL PMYYRGA AAI+V+DITN  +FTRA NW+ EL    S    I L GNK DL+  R +D   AQ +AD+N+LLF+ETSAK ++N+ EIF+ +A+K PK
Sbjct:   16 SNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLTNKRNVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPK 184          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: rab22a (RAB22A, member RAS oncogene family [Source:NCBI gene;Acc:101174498])

HSP 1 Score: 168.703 bits (426), Expect = 1.067e-51
Identity = 81/190 (42.63%), Postives = 119/190 (62.63%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCC 657
            +KV LLGD+ VGKTSI    V+D F+ N   T+GA ++ KTV+  N   KF IWDTAGQER+++L PMYYRG+ AA+IVYDIT   SF    NW+ EL +       + + GNKCDLS+ R +    A+ +A+  + +F+ETSAK +INI E+F  ++++ P       S+++S     +  + +  +CC
Sbjct:    6 LKVCLLGDTGVGKTSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAVIVYDITKEDSFQTLKNWVKELRQHGPPNIVVAIAGNKCDLSDAREVSEKDAKDYAESIHAIFVETSAKNAININEVFTEISKRIPVVDAAGGSSAKSIKLGRQVSESRK-TCC 194          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: RAB31 (RAB31, member RAS oncogene family [Source:NCBI gene;Acc:101173252])

HSP 1 Score: 159.458 bits (402), Expect = 3.486e-48
Identity = 80/191 (41.88%), Postives = 116/191 (60.73%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVK-TFSCC 657
            +KV LLGD+ VGK+SI    V+D F+ N   T+GA +L KTV   N   KF IWDTAGQER+ SL PMYYRG+ AA+IVYDIT   SF     W+ EL E       + + GNK DL + R +    A++FA+    +FIETSA+ ++N++E+F  ++++ P   +E+     +++F + +     T  CC
Sbjct:    7 LKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFLTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDLGDIREVPMKEAKEFAESIAAIFIETSARNAVNVEELFQKISKQIP--PLENPEADSNDSFKLNRQPTPSTRRCC 195          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000078456.1 (SMESG000078456.1)

HSP 1 Score: 405.601 bits (1041), Expect = 4.077e-145
Identity = 198/198 (100.00%), Postives = 198/198 (100.00%), Query Frame = 1
Query:   67 MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCCA 660
            MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCCA
Sbjct:    1 MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCCA 198          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000064914.1 (SMESG000064914.1)

HSP 1 Score: 202.216 bits (513), Expect = 3.390e-65
Identity = 96/162 (59.26%), Postives = 119/162 (73.46%), Query Frame = 1
Query:   67 MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFI 552
            M N QV  K+VLLG+SAVGK+S+ +  VK QF+E QE+TVGA +L +TV V++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDIT++ SF RA NWI EL E  ++VK I L GNK DLS  R +  +    +A EN LLF+ETSAK S N+ EIF+
Sbjct:    1 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFL 162          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000057525.1 (SMESG000057525.1)

HSP 1 Score: 187.578 bits (475), Expect = 3.118e-59
Identity = 88/162 (54.32%), Postives = 122/162 (75.31%), Query Frame = 1
Query:   91 KVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
            KVVLLG+++VGK+S++L  VKD FNE QE T+GA +L+K V ++++  K +IWDTAGQERY+SL PMYYRGAH A+++YDITN  SF RA  WI EL E  +TV  I LVGNK DLS  R ++   A+ +A+E NL+F+ETS+K ++N++E+F  L+ +  K
Sbjct:    8 KVVLLGETSVGKSSLSLRFVKDYFNEVQEITIGAAFLSKIVIIEDVKIKLEIWDTAGQERYRSLAPMYYRGAHGALVMYDITNLESFHRAKLWIQELKERAATVAVIALVGNKIDLSHGREVNETEAKLYAEEQNLIFMETSSKTNLNVQEVFTELSCELSK 169          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000057525.1 (SMESG000057525.1)

HSP 1 Score: 187.578 bits (475), Expect = 3.441e-59
Identity = 88/163 (53.99%), Postives = 122/163 (74.85%), Query Frame = 1
Query:   88 IKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPK 576
             KVVLLG+++VGK+S++L  VKD FNE QE T+GA +L+K V ++++  K +IWDTAGQERY+SL PMYYRGAH A+++YDITN  SF RA  WI EL E  +TV  I LVGNK DLS  R ++   A+ +A+E NL+F+ETS+K ++N++E+F  L+ +  K
Sbjct:    6 FKVVLLGETSVGKSSLSLRFVKDYFNEVQEITIGAAFLSKIVIIEDVKIKLEIWDTAGQERYRSLAPMYYRGAHGALVMYDITNLESFHRAKLWIQELKERAATVAVIALVGNKIDLSHGREVNETEAKLYAEEQNLIFMETSSKTNLNVQEVFTELSCELSK 168          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000065500.1 (SMESG000065500.1)

HSP 1 Score: 179.489 bits (454), Expect = 5.433e-56
Identity = 89/192 (46.35%), Postives = 123/192 (64.06%), Query Frame = 1
Query:   91 KVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKS----AIESASNSRSNNFSIEKDQVKTFSC 654
            K+VLLG++ VGK+S+ L  V+ QFNE  E+TVGA ++ +TV       KF+IWDTAGQERY+SL PMYYRGA AAI++YDITN  SF  A +WI EL     +V+ I+LVGNK DL + R + S   ++ A +N L+F+E S K S+N+ E+FI +A++ P S      E+A     NN  ++        C
Sbjct:    9 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSSVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGC 200          
The following BLAST results are available for this feature:
BLAST of Ras-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB5A5.429e-6752.58RAB5A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C5.728e-6750.52RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C5.728e-6750.52RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C1.016e-6650.52RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5B1.078e-6549.74RAB5B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-58.120e-6349.21RAB family [Source:UniProtKB/TrEMBL;Acc:P91857][more]
rab-15.040e-4536.73RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
rab-81.449e-4139.80RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-81.449e-4139.80RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-216.129e-4136.79RAB family [Source:UniProtKB/TrEMBL;Acc:Q22045][more]
back to top
BLAST of Ras-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab57.847e-6354.17gene:FBgn0014010 transcript:FBtr0330670[more]
Rab57.847e-6354.17gene:FBgn0014010 transcript:FBtr0077796[more]
Rab57.847e-6354.17gene:FBgn0014010 transcript:FBtr0077793[more]
Rab57.847e-6354.17gene:FBgn0014010 transcript:FBtr0077797[more]
Rab57.847e-6354.17gene:FBgn0014010 transcript:FBtr0077795[more]
back to top
BLAST of Ras-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5ab4.375e-6852.06RAB5A, member RAS oncogene family, b [Source:ZFIN;... [more]
rab5aa4.569e-6853.09RAB5A, member RAS oncogene family, a [Source:ZFIN;... [more]
rab5aa4.569e-6853.09RAB5A, member RAS oncogene family, a [Source:ZFIN;... [more]
rab5c4.007e-6657.93RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c4.007e-6657.93RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5a5.916e-6752.06RAB5A, member RAS oncogene family [Source:NCBI gen... [more]
rab5b5.680e-6549.48RAB5B, member RAS oncogene family [Source:NCBI gen... [more]
rab5d5.042e-6248.45RAB5D, member RAS oncogene family [Source:NCBI gen... [more]
ncapd21.376e-4841.36non-SMC condensin I complex subunit D2 [Source:Xen... [more]
rab1a1.552e-4738.50RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab5a2.690e-6752.58RAB5A, member RAS oncogene family [Source:MGI Symb... [more]
Rab5c2.214e-6650.00RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab5b7.401e-6649.74RAB5B, member RAS oncogene family [Source:MGI Symb... [more]
Rab5c1.241e-6246.23RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab22a3.554e-5444.21RAB22A, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51147|RAB5C_CANLF1.001e-6651.03Ras-related protein Rab-5C OS=Canis lupus familiar... [more]
sp|Q98932|RAB5C_CHICK1.023e-6651.55Ras-related protein Rab-5C OS=Gallus gallus OX=903... [more]
sp|P61271|RAB5A_MACFA1.821e-6652.58Ras-related protein Rab-5A OS=Macaca fascicularis ... [more]
sp|P18066|RAB5A_CANLF1.821e-6652.58Ras-related protein Rab-5A OS=Canis lupus familiar... [more]
sp|Q0IIG7|RAB5A_BOVIN1.861e-6652.58Ras-related protein Rab-5A OS=Bos taurus OX=9913 G... [more]
back to top
BLAST of Ras-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N5KS346.364e-6753.00Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A3Q2XIQ57.255e-6753.61RAB5A, member RAS oncogene family, b OS=Hippocampu... [more]
A0A3B5K5U01.016e-6653.09RAB5A, member RAS oncogene family, a OS=Takifugu r... [more]
A0A3Q2DC151.050e-6653.61RAB5A, member RAS oncogene family, b OS=Cyprinodon... [more]
H3CUX21.184e-6653.61RAB5A, member RAS oncogene family, a OS=Tetraodon ... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5ab6.011e-7053.00ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5aa1.540e-6752.58ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5c5.536e-6658.28RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
ENSAMXT00000046211.15.582e-6658.90ras-related protein Rab-5C [Source:NCBI gene;Acc:1... [more]
rab5b7.617e-6247.94ras-related protein Rab-5B-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5c8.247e-6850.00RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c1.378e-6648.73RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000000009.18.302e-6648.00pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1... [more]
RAB313.599e-5142.11RAB31, member RAS oncogene family [Source:HGNC Sym... [more]
rab1aa9.237e-4838.97RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VPS212.167e-5447.62Endosomal Rab family GTPase; required for endocyti... [more]
YPT537.563e-5248.82Stress-induced Rab family GTPase; required for vac... [more]
YPT17.748e-4641.21Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT521.452e-4543.39Endosomal Rab family GTPase; required for vacuolar... [more]
YPT313.399e-4343.59Rab family GTPase; involved in the exocytic pathwa... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494824.438e-6455.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405571.980e-4641.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431295.194e-4543.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401679.874e-4537.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491175.874e-4342.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5ab6.831e-6953.09ras-related protein Rab-5A-like [Source:NCBI gene;... [more]
rab5aa5.692e-6851.55ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5c3.984e-6556.80RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
rab22a1.067e-5142.63RAB22A, member RAS oncogene family [Source:NCBI ge... [more]
RAB313.486e-4841.88RAB31, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078456.14.077e-145100.00SMESG000078456.1[more]
SMESG000064914.13.390e-6559.26SMESG000064914.1[more]
SMESG000057525.13.118e-5954.32SMESG000057525.1[more]
SMESG000057525.13.441e-5953.99SMESG000057525.1[more]
SMESG000065500.15.433e-5646.35SMESG000065500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027339 ID=SMED30027339|Name=Ras-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=842bp
CAATTTTGAAATTCAAATTATAAACTTAACAATTTAATTTTGATAATAAT
TATAATATGATTAAAAATGTCTAATTCACAAGTAATCATAAAAGTAGTTT
TGCTTGGTGATTCTGCTGTCGGTAAAACTAGTATAGCTTTGAATATAGTT
AAAGACCAATTTAATGAAAATCAAGAAGCAACTGTTGGAGCTCTTTATTT
GAATAAAACAGTCGAAGTCGATAATATGTGTTTCAAATTCGATATTTGGG
ATACTGCAGGACAGGAGAGATACAAGAGTCTGACTCCAATGTATTATAGA
GGAGCTCATGCTGCAATTATTGTTTATGACATTACTAACAGGTCGTCTTT
TACCAGGGCTAATAACTGGATAGCGGAGCTCAATGAAATCACGTCTACGG
TGAAAACGATAATCTTAGTTGGCAACAAATGTGATTTAAGCGAACACCGA
GTAATAGATTCAAACACAGCTCAGAAATTCGCAGATGAAAACAATTTGCT
TTTCATTGAAACTTCGGCAAAACTGTCAATCAATATCAAAGAAATTTTTA
TTCTACTTGCAAGAAAATATCCAAAGAGTGCAATCGAATCGGCTTCCAAT
TCCAGATCAAATAATTTTAGTATTGAAAAGGATCAAGTTAAAACATTTTC
ATGTTGTGCGTAATGAAGCACTGCAGTTCCATGAAACAGATCAAATAATC
ACCAGTATAATTTTTTTTTCTACGTGAAATAAAGTTTCATTGTCTATATT
AATGCCATGACAAATTAAAAGTTTTACATTAATATTTAAAATTAATATAA
AATTACAAAGTGAGTGTGTTTGATTGCAGTTTGCATTAGAGC
back to top

protein sequence of SMED30027339-orf-1

>SMED30027339-orf-1 ID=SMED30027339-orf-1|Name=SMED30027339-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVE
VDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANN
WIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETS
AKLSINIKEIFILLARKYPKSAIESASNSRSNNFSIEKDQVKTFSCCA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0019003GDP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0015031protein transport
GO:0030100regulation of endocytosis
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0005769early endosome
GO:0005886plasma membrane
GO:0016020membrane
GO:0030139endocytic vesicle
GO:0031901early endosome membrane
GO:0042470melanosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 31..47
score: 24.72
coord: 111..124
score: 50.44
coord: 49..71
score: 47.41
coord: 8..29
score: 40.71
coord: 146..168
score: 39.2
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 10..179
e-value: 3.9E-12
score: 35.7
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 8..171
e-value: 2.5E-72
score: 256.3
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 13..196
e-value: 3.4E-5
score: 24.7
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 9..171
e-value: 8.5E-30
score: 115.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..197
e-value: 1.7E-62
score: 212.3
NoneNo IPR availablePANTHERPTHR24073:SF366RAS-RELATED PROTEIN RAB-5Ccoord: 7..189
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 7..189
NoneNo IPR availablePROSITEPS51419RABcoord: 3..198
score: 31.888
NoneNo IPR availableCDDcd01860Rab5_relatedcoord: 9..169
e-value: 1.72228E-87
score: 252.473
IPR001806Small GTPasePFAMPF00071Rascoord: 9..168
e-value: 9.6E-57
score: 191.1
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 7..162
e-value: 2.4E-29
score: 100.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..175