H/ACA ribonucleoprotein complex subunit 3
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30027335 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Human
Match: NOP10 (NOP10 ribonucleoprotein [Source:HGNC Symbol;Acc:HGNC:14378]) HSP 1 Score: 72.0182 bits (175), Expect = 6.814e-17 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L+YY ++ G R+YTLK F P Q T AHPA++SP+DKYS RI +K+RFK+L TQ P+ Sbjct: 3 LQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Celegans
Match: nola-3 (Putative H/ACA ribonucleoprotein complex subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVR8]) HSP 1 Score: 70.0922 bits (170), Expect = 1.436e-16 Identity = 30/56 (53.57%), Postives = 45/56 (80.36%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQ 450 LRY+ D++ +R+YTLK P+ + T+ AHPA++SPEDK S+ RI++K+RF +LPTQ Sbjct: 3 LRYFLDENQQRVYTLKRTAPSGEQTLTAHPARFSPEDKNSKYRIIIKKRFGLLPTQ 58
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Fly
Match: CG7637 (gene:FBgn0033548 transcript:FBtr0088252) HSP 1 Score: 65.855 bits (159), Expect = 8.372e-15 Identity = 29/59 (49.15%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L Y +++G R+YTLK + +PT+ AHPA++SPEDKYS +R+ +K+RF +L TQ P+ Sbjct: 3 LMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPE 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Zebrafish
Match: nop10 (NOP10 ribonucleoprotein homolog (yeast) [Source:NCBI gene;Acc:445391]) HSP 1 Score: 70.4774 bits (171), Expect = 1.869e-16 Identity = 29/59 (49.15%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L++Y +++G+R+YTLK P+ QPT AHPA++SP+DK+S R+ +K+RF +L TQ P+ Sbjct: 3 LQFYLNENGERVYTLKKVDPSGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Xenopus
Match: nop10 (NOP10 ribonucleoprotein [Source:NCBI gene;Acc:548917]) HSP 1 Score: 70.0922 bits (170), Expect = 4.182e-16 Identity = 28/59 (47.46%), Postives = 45/59 (76.27%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L++Y ++ G+R+YT+K P+ QPT AHPA++SP+DK+S R+ +K+RF +L TQ P+ Sbjct: 3 LQFYLNEQGERVYTMKKVSPDGQPTTSAHPARFSPDDKFSRHRVSLKKRFGLLLTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Mouse
Match: Nop10 (NOP10 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1913431]) HSP 1 Score: 72.0182 bits (175), Expect = 4.678e-17 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L+YY ++ G R+YTLK F P Q T AHPA++SP+DKYS RI +K+RFK+L TQ P+ Sbjct: 3 LQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q54J26|NOP10_DICDI (H/ACA ribonucleoprotein complex subunit 3 OS=Dictyostelium discoideum OX=44689 GN=nop10 PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 5.544e-17 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1 Query: 277 LNLRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLP 456 ++L YY DKDG+R+YTLK PN + T AHPA++S +DKYS ERI +K+RF +L TQ P Sbjct: 1 MHLMYYNDKDGQRVYTLKKESPNHEATYSAHPARFSVDDKYSRERIALKKRFGLLLTQQP 60
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9CQS2|NOP10_MOUSE (H/ACA ribonucleoprotein complex subunit 3 OS=Mus musculus OX=10090 GN=Nop10 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.272e-16 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L+YY ++ G R+YTLK F P Q T AHPA++SP+DKYS RI +K+RFK+L TQ P+ Sbjct: 3 LQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9NPE3|NOP10_HUMAN (H/ACA ribonucleoprotein complex subunit 3 OS=Homo sapiens OX=9606 GN=NOP10 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.272e-16 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L+YY ++ G R+YTLK F P Q T AHPA++SP+DKYS RI +K+RFK+L TQ P+ Sbjct: 3 LQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q6DRH5|NOP10_DANRE (H/ACA ribonucleoprotein complex subunit 3 OS=Danio rerio OX=7955 GN=nop10 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.411e-15 Identity = 29/59 (49.15%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L++Y +++G+R+YTLK P+ QPT AHPA++SP+DK+S R+ +K+RF +L TQ P+ Sbjct: 3 LQFYLNENGERVYTLKKVDPSGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9XVR8|NOP10_CAEEL (Putative H/ACA ribonucleoprotein complex subunit 3 OS=Caenorhabditis elegans OX=6239 GN=nola-3 PE=3 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 1.826e-15 Identity = 30/56 (53.57%), Postives = 45/56 (80.36%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQ 450 LRY+ D++ +R+YTLK P+ + T+ AHPA++SPEDK S+ RI++K+RF +LPTQ Sbjct: 3 LRYFLDENQQRVYTLKRTAPSGEQTLTAHPARFSPEDKNSKYRIIIKKRFGLLPTQ 58
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. TrEMBL
Match: E0VPW0 (H/ACA ribonucleoprotein complex subunit, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8233476 PE=4 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 1.538e-19 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQYK 465 LRYY D+ G+R+YT PN +PT AHPAK+SPEDKYS+ERIL+K+RF ILPTQLP K Sbjct: 3 LRYYLDEKGERVYTFSKVDPNGRPTSSAHPAKFSPEDKYSKERILIKKRFGILPTQLPPIK 63
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. TrEMBL
Match: U6JEU9 (H/ACA ribonucleoprotein complex subunit 3 OS=Echinococcus granulosus OX=6210 GN=EGR_07252 PE=4 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 2.017e-19 Identity = 36/60 (60.00%), Postives = 49/60 (81.67%), Query Frame = 1 Query: 277 LNLRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLP 456 ++LRYY D DG+R+YT+K P+ +PT AHPA+YSP+DKYSE+R+++K RF ILPTQ P Sbjct: 1 MHLRYYLDADGRRVYTMKFVDPDGKPTQSAHPARYSPDDKYSEQRVMLKMRFNILPTQQP 60
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. TrEMBL
Match: A0A068Y4H5 (H:ACA ribonucleoprotein complex subunit 3 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000535600 PE=4 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 5.891e-19 Identity = 36/60 (60.00%), Postives = 48/60 (80.00%), Query Frame = 1 Query: 277 LNLRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLP 456 ++LRYY D DG R+YT+K P+ +PT AHPA+YSP+DKYSE+R+++K RF ILPTQ P Sbjct: 1 MHLRYYLDADGHRVYTMKFVDPDGKPTQSAHPARYSPDDKYSEQRVMLKMRFNILPTQQP 60
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. TrEMBL
Match: A0A2A9LY07 (Putative structural component of H/ACA snoRNP OS=Besnoitia besnoiti OX=94643 GN=BESB_027830 PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 1.510e-18 Identity = 36/58 (62.07%), Postives = 46/58 (79.31%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLP 456 LRYY D+ GKR+YTLK P+ PT+ AHP ++SP+DKYS ER+ +KRRFK+LPTQ P Sbjct: 3 LRYYTDEQGKRVYTLKSHAPDGTPTLSAHPPRFSPDDKYSAERVALKRRFKLLPTQQP 60
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. TrEMBL
Match: A0A086Q9N6 (Putative nucleolar protein OS=Toxoplasma gondii VAND OX=933077 GN=TGVAND_278270 PE=4 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 1.510e-18 Identity = 36/58 (62.07%), Postives = 46/58 (79.31%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLP 456 LRYY D+ GKR+YTLK P+ PT+ AHP ++SP+DKYS ER+ +KRRFK+LPTQ P Sbjct: 3 LRYYTDEQGKRVYTLKTHAPDGTPTLSAHPPRFSPDDKYSAERVALKRRFKLLPTQQP 60
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Cavefish
Match: nop10 (NOP10 ribonucleoprotein [Source:NCBI gene;Acc:103030258]) HSP 1 Score: 70.0922 bits (170), Expect = 2.514e-16 Identity = 29/59 (49.15%), Postives = 45/59 (76.27%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L++Y +++G+R+YTLK P QPT AHPA++SP+DK+S R+ +K+RF +L TQ P+ Sbjct: 3 LQFYLNENGERVYTLKKVDPEGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQPR 61
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Yeast
Match: NOP10 (Subunit of box H/ACA snoRNP complex; required for pseudouridylation and processing of pre-18S rRNA [Source:SGD;Acc:S000007455]) HSP 1 Score: 63.929 bits (154), Expect = 6.787e-15 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 277 LNLRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQ 450 ++L Y DGKRIYTLK + + T AHPA++SP+DKYS +R+ +K+RF ++P Q Sbjct: 1 MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Nematostella
Match: EDO41549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U4]) HSP 1 Score: 78.9518 bits (193), Expect = 3.146e-20 Identity = 34/58 (58.62%), Postives = 45/58 (77.59%), Query Frame = 1 Query: 277 LNLRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQ 450 ++L YY D DGKR+YTLK P+ +PT AHPA++SP+DKYS R+ +K+RF ILPTQ Sbjct: 1 MHLMYYMDNDGKRVYTLKKQDPSGKPTTSAHPARFSPDDKYSRHRVTLKKRFGILPTQ 58
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Medaka
Match: nop10 (NOP10 ribonucleoprotein homolog (yeast) [Source:NCBI gene;Acc:445391]) HSP 1 Score: 75.485 bits (184), Expect = 1.680e-18 Identity = 32/59 (54.24%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 283 LRYYFDKDGKRIYTLKCFGPNQQPTICAHPAKYSPEDKYSEERILMKRRFKILPTQLPQ 459 L+YY D++G R+YTLK P+ +PT AHPA++SP+DK+S R+L+K+RF IL TQ P+ Sbjct: 3 LQYYLDQNGDRVYTLKKLNPDGEPTSSAHPARFSPDDKFSRHRVLVKKRFGILLTQQPK 61 The following BLAST results are available for this feature:
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 1
BLAST of H/ACA ribonucleoprotein complex subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30027335 ID=SMED30027335|Name=H/ACA ribonucleoprotein complex subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=513bpback to top protein sequence of SMED30027335-orf-1 >SMED30027335-orf-1 ID=SMED30027335-orf-1|Name=SMED30027335-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp MCTADKFVYPVSSHLLWSLYEFSYDHELSSRITSYIGVADWNLWVMSTIFback to top Annotated Terms
The following terms have been associated with this transcript:
|