G_PROTEIN_RECEP_F2_4 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F2_4 domain-containing protein
Smed IDSMED30027333
Length (bp)2077
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30027333) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30027333) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30027333) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30027333) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027333

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027333SMESG000033610.1 dd_Smed_v4_16587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027333SMESG000033610.1 dd_Smed_v4_16587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027333SMESG000033610.1 dd_Smed_v4_16587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027333SMESG000033610.1 dd_Smed_v4_16587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mth (gene:FBgn0023000 transcript:FBtr0072571)

HSP 1 Score: 62.7734 bits (151), Expect = 7.286e-10
Identity = 55/226 (24.34%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1074 SMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKEC-----RVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSE 1721
            S++C+ + I +Y      +N  G   +C   CL++   F LL  ++    SF C   G    FF +  F W++V SL L  TF   S    +      F  Y    +    +  G  ++ +  +  N  + P+ G   +CW +T   S +++++ P+  L+ +N    ++   RI+   K+      R  +K++ NS   T    +RL  + GL + L+I +  S+
Sbjct:  225 SLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLLDLWQ-ISISF-CKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVLTGITVLAD-NIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQ 447          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mth (gene:FBgn0023000 transcript:FBtr0306850)

HSP 1 Score: 62.3882 bits (150), Expect = 7.439e-10
Identity = 55/226 (24.34%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1074 SMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKEC-----RVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSE 1721
            S++C+ + I +Y      +N  G   +C   CL++   F LL  ++    SF C   G    FF +  F W++V SL L  TF   S    +      F  Y    +    +  G  ++ +  +  N  + P+ G   +CW +T   S +++++ P+  L+ +N    ++   RI+   K+      R  +K++ NS   T    +RL  + GL + L+I +  S+
Sbjct:  225 SLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLLDLWQ-ISISF-CKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVLTGITVLAD-NIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQ 447          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mth (gene:FBgn0023000 transcript:FBtr0072570)

HSP 1 Score: 62.3882 bits (150), Expect = 7.439e-10
Identity = 55/226 (24.34%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1074 SMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKEC-----RVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSE 1721
            S++C+ + I +Y      +N  G   +C   CL++   F LL  ++    SF C   G    FF +  F W++V SL L  TF   S    +      F  Y    +    +  G  ++ +  +  N  + P+ G   +CW +T   S +++++ P+  L+ +N    ++   RI+   K+      R  +K++ NS   T    +RL  + GL + L+I +  S+
Sbjct:  225 SLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLLDLWQ-ISISF-CKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVLTGITVLAD-NIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQ 447          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl11 (gene:FBgn0045443 transcript:FBtr0332552)

HSP 1 Score: 58.9214 bits (141), Expect = 9.713e-9
Identity = 62/255 (24.31%), Postives = 110/255 (43.14%), Query Frame = 3
Query: 1068 FLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFE-KSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNN--STFRPKYGGRYCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVV------QKKESNSTLW-LCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWA 1799
            F S+  + I I  Y     FR+  G        CL ++   N++  +  FE K+  C   G +  F  +  F+W++V S D+ + F  R   +  K    SF  Y I  +S   +      +V+  +  N  + + P  G   CW FTN  S   +++ P+ +L++ N  +  +    I   +K+ + V      QK   N   + +  RL  + G  + L+I A + E++ + + L++ N    C   I  F A
Sbjct:  234 FSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVA 488          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl11 (gene:FBgn0045443 transcript:FBtr0332553)

HSP 1 Score: 58.9214 bits (141), Expect = 1.146e-8
Identity = 62/255 (24.31%), Postives = 110/255 (43.14%), Query Frame = 3
Query: 1068 FLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFE-KSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNN--STFRPKYGGRYCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVV------QKKESNSTLW-LCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWA 1799
            F S+  + I I  Y     FR+  G        CL ++   N++  +  FE K+  C   G +  F  +  F+W++V S D+ + F  R   +  K    SF  Y I  +S   +      +V+  +  N  + + P  G   CW FTN  S   +++ P+ +L++ N  +  +    I   +K+ + V      QK   N   + +  RL  + G  + L+I A + E++ + + L++ N    C   I  F A
Sbjct:  217 FSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVA 471          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Match: adgrf3b (adhesion G protein-coupled receptor F3b [Source:ZFIN;Acc:ZDB-GENE-041001-207])

HSP 1 Score: 60.8474 bits (146), Expect = 4.962e-9
Identity = 62/209 (29.67%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 1233 CTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFS----CVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFT--NIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTS--KECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSE-----VDILVRIL-VVFNSLQGCFLMICF-FWAKRVR 1811
            C  + +++ +F L MF WM   SL L+    F  + IGKK        Y I GF+    C  + V     V +     +T  P Y  + CW T  +   G I  F+ PV  ++L N  + ++V   ++K S  +  +   K  + S + + + LT VFG  ++L +F  L +     +  LV  L  + NSLQG F+++   F  KRVR
Sbjct:  653 CLVLVVAKHYFFLAMFFWMLCLSLMLVHQLIFVFSRIGKK-------VYMILGFTIGYFCPTVTVA----VTYVYYEEATSIPYYSSKTCWLTYQSPMQGSIHAFLFPVGTIVLVNMCSMLVVIATVLKPSGAETNKKGDKDAAKSIIKVILFLTPVFGGTWILGLFVFLIDDSSQFITYLVNYLFTILNSLQGFFILLTGCFAEKRVR 850          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Match: adgrf3b (adhesion G protein-coupled receptor F3b [Source:ZFIN;Acc:ZDB-GENE-041001-207])

HSP 1 Score: 58.151 bits (139), Expect = 3.199e-8
Identity = 61/208 (29.33%), Postives = 97/208 (46.63%), Query Frame = 3
Query: 1233 CTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFS----CVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFT--NIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTS--KECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSE-----VDILVRIL-VVFNSLQGCFLMICF-FWAKRV 1808
            C  + +++ +F L MF WM   SL L+    F  + IGKK        Y I GF+    C  + V     V +     +T  P Y  + CW T  +   G I  F+ PV  ++L N  + ++V   ++K S  +  +   K  + S + + + LT VFG  ++L +F  L +     +  LV  L  + NSLQG F+++   F  KRV
Sbjct:  652 CLVLVVAKHYFFLAMFFWMLCLSLMLVHQLIFVFSRIGKK-------VYMILGFTIGYFCPTVTVA----VTYVYYEEATSIPYYSSKTCWLTYQSPMQGSIHAFLFPVGTIVLVNMCSMLVVIATVLKPSGAETNKKGDKDAAKSIIKVILFLTPVFGGTWILGLFVFLIDDSSQFITYLVNYLFTILNSLQGFFILLTGCFAEKRV 848          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Match: adgrf3a (adhesion G protein-coupled receptor F3a [Source:ZFIN;Acc:ZDB-GENE-131121-607])

HSP 1 Score: 55.8398 bits (133), Expect = 1.846e-7
Identity = 68/262 (25.95%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 1077 MVCLFILILLYTT--QSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCIT-GFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFT---NIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTS-KECRVVQKKE-SNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRI--------LVVFNSLQGCFLMICF-FWAKRVR 1811
            + CL I +L++    +S   NF       +S CL L++   L     +      C+ + + + FF L +F WM   S  LL    +    + K    K F    IT G++C  I    A+ V +   NN      Y    CW T    +   +  + IP+  ++  N  T  +V  +I   S  E +   +K+ + S +   V L+ V GL +VL  F +   +D+ V+           +FNSLQG F+++      K+VR
Sbjct:  743 LACLIIKVLVWDAVVKSPISNFRHVALFNISLCLLLAHCMFLTTSKPESIPPNWCSILTLIKHFFFLAVFFWMLCLSFVLLHQMIYVFDRLRK----KVFLGLSITVGYACPII----AVAVTYISFNNGAEGEYYSKSTCWLTYKGTLKGSIFAFIIPIGAIVFVNLFTLAVVIMKIATPSISEAKARDEKDVAKSMIKTIVFLSPVLGLSWVLGFFVL--GLDLTVKPWAALVNYSFTIFNSLQGLFILLTNCVGEKKVR 994          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Match: adgre15 (adhesion G protein-coupled receptor E15 [Source:ZFIN;Acc:ZDB-GENE-121214-33])

HSP 1 Score: 53.9138 bits (128), Expect = 4.914e-7
Identity = 53/195 (27.18%), Postives = 87/195 (44.62%), Query Frame = 3
Query: 1233 CTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGF--SCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKT------SKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICF 1790
            C  I     F  L  FVWM + ++ L       S    KK+ + S  F C+ G+  + V + V   ++ E            YG  +CW      G IW F+ PVC++L  N    +I+F++I+ T      +    V Q K++   ++  +    V G  ++L  F   SEV  L  + ++FNS QG F+ + +
Sbjct:  314 CVAIAGLLHFLFLSAFVWMFIEAVLLFICVKNLSQISSKKREVLSSGFLCVIGYVLAMVVVCVSIGLVPE-----------GYGSEHCWIKT-DEGFIWSFLGPVCVILALN----LILFFKIVITLNSTLKNLNAEVSQMKQTKVMVFKTLGQFVVLGCPWILGFFTNGSEV--LEIVFLIFNSQQGTFIFLIY 490          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Match: adgre5b.3 (adhesion G protein-coupled receptor E5b, duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-121214-275])

HSP 1 Score: 53.5286 bits (127), Expect = 6.632e-7
Identity = 66/261 (25.29%), Postives = 114/261 (43.68%), Query Frame = 3
Query: 1053 TEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCIT-GFSCVAINVGSAIIVEFTLPNNSTFRPK-YG-GRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIK--TSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSE-VDILVRILVVFNSLQGC--FLMICFFWAKRVR 1811
            T V   LS++CL + IL +      +     + + LS CL++++    L          AC  +     FF L  F WM +  + L     +R   +    TLK    Y +  G   V +++ SAI V           PK YG  R+CW +     ++ +FIPVC++++ N    +I  +++    +S    + +  +  S L   V    V G  +V   F       ++++ + ++ NSLQG   F+M C   +K+VR
Sbjct:  331 TRVGLVLSLICLILCILTFRFCRSIQGTRNSIHLHLSVCLFIADLV-FLCGISSTHNQVACAIVAGLLHFFFLSAFCWMLLEGVQL-----YRMVVLVFHTTLKHLYMYAVGYGVPLVIVSI-SAIAV-----------PKGYGTDRHCWLSLEGYLILSFFIPVCIIVILNITVFIITVWKLALKFSSLNPDLSKLHKIRSFLATAVAQLCVLGGSWVFGFFLFQKNGTEVMLYLFIILNSLQGALIFIMHCLL-SKQVR 572          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: tbc1d9b (TBC1 domain family member 9B [Source:Xenbase;Acc:XB-GENE-989754])

HSP 1 Score: 57.7658 bits (138), Expect = 5.821e-8
Identity = 63/249 (25.30%), Postives = 106/249 (42.57%), Query Frame = 3
Query: 1071 LSMVCLFILILLY---TTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL----LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY-CWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            LS+ CL I ++ +   ++ S  RN   ++   LS  + ++    LL+ ++    +  C  I I   FF L  F WM V  L L    ++ FG   +        K F +Y I   S + I      IV  T   +S     YG R  CW + +  G IW F+   L ++  ++  +I   RII           +++N+   T      L  + G  +V  + A+  +  +   +  +FNSLQG F+ +
Sbjct:  580 LSIFCLAITLVTFAILSSVSTIRNQRYHIHANLSFAILVAQIL-LLISFRFVSGTLPCKIIAILLHFFFLSAFAWMLVEGLHLYSMVIKVFGSEES--------KHFYYYGIGWGSSLVI-----CIVSVTSALDS-----YGERANCWLS-LEKGAIWAFVAPALFVIVVNIGILIAVTRIISRISADNYKVHRDANAFKLTAKAVAVLLPILGSSWVFGVLAVNEQAIVFQYMFAIFNSLQGFFIFL 808          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: tbc1d9b (TBC1 domain family member 9B [Source:Xenbase;Acc:XB-GENE-989754])

HSP 1 Score: 57.3806 bits (137), Expect = 6.938e-8
Identity = 63/249 (25.30%), Postives = 106/249 (42.57%), Query Frame = 3
Query: 1071 LSMVCLFILILLY---TTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL----LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY-CWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            LS+ CL I ++ +   ++ S  RN   ++   LS  + ++    LL+ ++    +  C  I I   FF L  F WM V  L L    ++ FG   +        K F +Y I   S + I      IV  T   +S     YG R  CW + +  G IW F+   L ++  ++  +I   RII           +++N+   T      L  + G  +V  + A+  +  +   +  +FNSLQG F+ +
Sbjct:  510 LSIFCLAITLVTFAILSSVSTIRNQRYHIHANLSFAILVAQIL-LLISFRFVSGTLPCKIIAILLHFFFLSAFAWMLVEGLHLYSMVIKVFGSEES--------KHFYYYGIGWGSSLVI-----CIVSVTSALDS-----YGERANCWLS-LEKGAIWAFVAPALFVIVVNIGILIAVTRIISRISADNYKVHRDANAFKLTAKAVAVLLPILGSSWVFGVLAVNEQAIVFQYMFAIFNSLQGFFIFL 738          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: tbc1d9b (TBC1 domain family member 9B [Source:Xenbase;Acc:XB-GENE-989754])

HSP 1 Score: 57.3806 bits (137), Expect = 7.588e-8
Identity = 63/249 (25.30%), Postives = 106/249 (42.57%), Query Frame = 3
Query: 1071 LSMVCLFILILLY---TTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL----LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY-CWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            LS+ CL I ++ +   ++ S  RN   ++   LS  + ++    LL+ ++    +  C  I I   FF L  F WM V  L L    ++ FG   +        K F +Y I   S + I      IV  T   +S     YG R  CW + +  G IW F+   L ++  ++  +I   RII           +++N+   T      L  + G  +V  + A+  +  +   +  +FNSLQG F+ +
Sbjct:  483 LSIFCLAITLVTFAILSSVSTIRNQRYHIHANLSFAILVAQIL-LLISFRFVSGTLPCKIIAILLHFFFLSAFAWMLVEGLHLYSMVIKVFGSEES--------KHFYYYGIGWGSSLVI-----CIVSVTSALDS-----YGERANCWLS-LEKGAIWAFVAPALFVIVVNIGILIAVTRIISRISADNYKVHRDANAFKLTAKAVAVLLPILGSSWVFGVLAVNEQAIVFQYMFAIFNSLQGFFIFL 711          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: tbc1d9b (TBC1 domain family member 9B [Source:Xenbase;Acc:XB-GENE-989754])

HSP 1 Score: 57.3806 bits (137), Expect = 7.628e-8
Identity = 63/249 (25.30%), Postives = 106/249 (42.57%), Query Frame = 3
Query: 1071 LSMVCLFILILLY---TTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL----LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY-CWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            LS+ CL I ++ +   ++ S  RN   ++   LS  + ++    LL+ ++    +  C  I I   FF L  F WM V  L L    ++ FG   +        K F +Y I   S + I      IV  T   +S     YG R  CW + +  G IW F+   L ++  ++  +I   RII           +++N+   T      L  + G  +V  + A+  +  +   +  +FNSLQG F+ +
Sbjct:  571 LSIFCLAITLVTFAILSSVSTIRNQRYHIHANLSFAILVAQIL-LLISFRFVSGTLPCKIIAILLHFFFLSAFAWMLVEGLHLYSMVIKVFGSEES--------KHFYYYGIGWGSSLVI-----CIVSVTSALDS-----YGERANCWLS-LEKGAIWAFVAPALFVIVVNIGILIAVTRIISRISADNYKVHRDANAFKLTAKAVAVLLPILGSSWVFGVLAVNEQAIVFQYMFAIFNSLQGFFIFL 799          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: tbc1d9b (TBC1 domain family member 9B [Source:Xenbase;Acc:XB-GENE-989754])

HSP 1 Score: 57.3806 bits (137), Expect = 7.855e-8
Identity = 63/249 (25.30%), Postives = 106/249 (42.57%), Query Frame = 3
Query: 1071 LSMVCLFILILLY---TTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL----LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY-CWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            LS+ CL I ++ +   ++ S  RN   ++   LS  + ++    LL+ ++    +  C  I I   FF L  F WM V  L L    ++ FG   +        K F +Y I   S + I      IV  T   +S     YG R  CW + +  G IW F+   L ++  ++  +I   RII           +++N+   T      L  + G  +V  + A+  +  +   +  +FNSLQG F+ +
Sbjct:  653 LSIFCLAITLVTFAILSSVSTIRNQRYHIHANLSFAILVAQIL-LLISFRFVSGTLPCKIIAILLHFFFLSAFAWMLVEGLHLYSMVIKVFGSEES--------KHFYYYGIGWGSSLVI-----CIVSVTSALDS-----YGERANCWLS-LEKGAIWAFVAPALFVIVVNIGILIAVTRIISRISADNYKVHRDANAFKLTAKAVAVLLPILGSSWVFGVLAVNEQAIVFQYMFAIFNSLQGFFIFL 881          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Mouse
Match: Adgre1 (adhesion G protein-coupled receptor E1 [Source:MGI Symbol;Acc:MGI:106912])

HSP 1 Score: 58.9214 bits (141), Expect = 2.268e-8
Identity = 63/252 (25.00%), Postives = 110/252 (43.65%), Query Frame = 3
Query: 1053 TEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY--CWFTNIPSGLIWYFI-PVCLLLLWNSV----TCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            + V T +S+VCL + I  +      +N   Y+ + L  CL+L+     L      +   AC  I     +  L  F WM V ++ L L     +  N    + +K     C  G+       G  ++V      +++ +P+  G +  CW  N  +G IW F+ PVC+++  NSV    T  ++  ++   S E  V + K++    +  +    + G  +VL IF I     I+  +  + NSLQG F+ +
Sbjct:  651 SHVGTVISLVCLALAIATFLLCRAVQNHNTYMHLHLCVCLFLAKIL-FLTGIDKTDNQTACAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKML-HLCAFGY-------GLPVLVVII---SASVQPRGYGMHNRCWL-NTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSE--VSKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFL 887          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Mouse
Match: Adgre1 (adhesion G protein-coupled receptor E1 [Source:MGI Symbol;Acc:MGI:106912])

HSP 1 Score: 58.9214 bits (141), Expect = 2.268e-8
Identity = 63/252 (25.00%), Postives = 110/252 (43.65%), Query Frame = 3
Query: 1053 TEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRY--CWFTNIPSGLIWYFI-PVCLLLLWNSV----TCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            + V T +S+VCL + I  +      +N   Y+ + L  CL+L+     L      +   AC  I     +  L  F WM V ++ L L     +  N    + +K     C  G+       G  ++V      +++ +P+  G +  CW  N  +G IW F+ PVC+++  NSV    T  ++  ++   S E  V + K++    +  +    + G  +VL IF I     I+  +  + NSLQG F+ +
Sbjct:  651 SHVGTVISLVCLALAIATFLLCRAVQNHNTYMHLHLCVCLFLAKIL-FLTGIDKTDNQTACAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKML-HLCAFGY-------GLPVLVVII---SASVQPRGYGMHNRCWL-NTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSE--VSKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFL 887          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P83120|MTH_DROSI (G-protein coupled receptor Mth OS=Drosophila simulans OX=7240 GN=mth PE=3 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 4.174e-9
Identity = 54/226 (23.89%), Postives = 104/226 (46.02%), Query Frame = 3
Query: 1074 SMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKEC-----RVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSE 1721
            S++C+ + I +Y      +N  G   +C   CL++   F L   ++    SF C   G+   FF +  F+W++V SL L  TF   S    +  +   F  Y    +    +  G  ++ +  +  +  + P+ G   +CW +T   S +++++ P+  L+ +N    ++   RII   K+      R  +K++ NS   T    +RL  + GL + L+I + +S+
Sbjct:  225 SLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLFDLWQ-ISISF-CKPAGVLGYFFVMAAFLWLSVISLHLWNTFRGSSHKASRFFSEHRFLAYNTYAWGMSMVLTGITVLAD-NVVEDQDWNPRVGEEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTARRIIGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYISQ 447          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|O97148|MTH_DROME (G-protein coupled receptor Mth OS=Drosophila melanogaster OX=7227 GN=mth PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 7.457e-9
Identity = 55/226 (24.34%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1074 SMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKEC-----RVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSE 1721
            S++C+ + I +Y      +N  G   +C   CL++   F LL  ++    SF C   G    FF +  F W++V SL L  TF   S    +      F  Y    +    +  G  ++ +  +  N  + P+ G   +CW +T   S +++++ P+  L+ +N    ++   RI+   K+      R  +K++ NS   T    +RL  + GL + L+I +  S+
Sbjct:  225 SLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLLDLWQ-ISISF-CKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVLTGITVLAD-NIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQ 447          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9GT50|MTH_DROYA (G-protein coupled receptor Mth OS=Drosophila yakuba OX=7245 GN=mth PE=3 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.341e-8
Identity = 57/231 (24.68%), Postives = 106/231 (45.89%), Query Frame = 3
Query: 1059 VFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWF-TNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKEC-----RVVQKKESNS---TLWLCVRLTTVFGLGYVLQIFAILSE 1721
            V    S+VC+ + I +Y      +N  G   +C   CL+++    LL  ++   ++F C   G    FF +  F+W++V SL L  TF   + N  +  +   F  Y    +    +  G   + +  +  N  + P+ G G +CW  T   S +++++ P+  L+ +N    ++   RII   K+      R  +K++ NS   T    +RL  + GL + L+I + +S+
Sbjct:  223 VVMITSLVCMVLTITVYLFVKKLQNLHGKCFMCYMVCLFMAYLLLLLNLWQ-MSQNF-CITAGFLGYFFVMAAFLWLSVISLHLWNTFSGSAHNANRFLSEHRFLAYNTYAWGMAVVLTGITYLAD-KVVENEDWNPRMGFGGHCWICTQSWSAMLYFYGPMVFLIAFNITMFILTANRIIGVKKDIQKFAHRQERKQKLNSDKQTYTFFLRLFIIMGLTWSLEIGSYISQ 450          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95NT6|MTH2_DROYA (G-protein coupled receptor Mth2 OS=Drosophila yakuba OX=7245 GN=mth2 PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.684e-8
Identity = 48/211 (22.75%), Postives = 98/211 (46.45%), Query Frame = 3
Query: 1230 ACTYIGISQQFFNLGMFVWMAVYSLDLLQTF-GFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIP-SGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKE-CRVVQKKESNSTL-------WLCVRLTTVFGLGYVLQIFAILSEVD----ILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
            AC   G +  FF +G ++W++V S DL   F G R  N  ++K  K F FY +  +    + +    I +      +  +P  G G YCW      + +I+++ P+ ++++ N++  ++   +I    +E  R++  + S   L        L +RL  + G+ ++ ++ +     D     L  I  + N++QG  + + F   K+V+ +
Sbjct:  270 ACKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIAVVFLAFTYIAQELTNLPAYLKPGIGDGVYCWLDMSNWAAMIYFYGPILVIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHL 478          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P83118|MTH11_DROME (Probable G-protein coupled receptor Mth-like 11 OS=Drosophila melanogaster OX=7227 GN=mthl11 PE=3 SV=3)

HSP 1 Score: 58.9214 bits (141), Expect = 9.736e-8
Identity = 62/255 (24.31%), Postives = 110/255 (43.14%), Query Frame = 3
Query: 1068 FLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFE-KSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNN--STFRPKYGGRYCW-FTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVV------QKKESNSTLW-LCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWA 1799
            F S+  + I I  Y     FR+  G        CL ++   N++  +  FE K+  C   G +  F  +  F+W++V S D+ + F  R   +  K    SF  Y I  +S   +      +V+  +  N  + + P  G   CW FTN  S   +++ P+ +L++ N  +  +    I   +K+ + V      QK   N   + +  RL  + G  + L+I A + E++ + + L++ N    C   I  F A
Sbjct:  234 FSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVA 488          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: R7URJ0 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_216805 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 4.582e-25
Identity = 79/252 (31.35%), Postives = 131/252 (51.98%), Query Frame = 3
Query: 1071 LSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFA-CTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVV--QKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
            +S+VCL + +L+Y+     RN  G   + LS CL ++    L +F      S++ C  IG+   +F L  F+WM V + D+ +TF   S    +   L+ F  YC+  F    + V SAI+  FTL  +S +RP YG   CW  N  + ++++  PV +++  N V   I  + I K+ +  ++    KK      WL V+L+T+ GL +V    A + +VD+L  + ++FNSLQG  +   F   K+V ++
Sbjct:  457 ISIVCLSVHLLVYSMFRKLRNLAGLNIMSLSGCLLIAQL--LFLFAGSASASYSWCFSIGVLVHYFFLASFLWMNVMAFDICRTFVKFSKPSARDDFLQKFLRYCVYCFLVALLIVLSAIVANFTL-GDSLYRPAYGEDICWIKNRKALIVFFAAPVAVIVTSNLVYFFITLWSIQKSMEASKMATNNKKGDRDRFWLYVKLSTIMGLTWVFGFVAAIFDVDVLWYLFIIFNSLQGAMICFAFVMTKQVLSL 705          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: R7TZV2 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_208644 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.138e-22
Identity = 85/283 (30.04%), Postives = 140/283 (49.47%), Query Frame = 3
Query:  999 KYFTHNVYEIIYKIFDKTTEVFTFL----SMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFA-CTYIGISQQFFNLGMFVWMAVYSLDLLQTF-GFRSTNIGKKKTLK--SFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVV--QKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
            K  T  + E I   F  T  + + +    S+VCL + +L+Y+     RN  G   + LS CL ++    L +F      S++ C  IG+   +F L  F+WM V + D+ +TF  F   ++    + K   +C YCI       + V SAI+  FTL  +S +RP YG   CW  N  + L ++  PV +++  N V   I  + I K+ +  ++    KK      WL V+L+T+ GL +V    A + +V++L  + ++FNSLQG  +   F   K+V ++
Sbjct:  428 KVLTSRLREAIDPKFSSTQTIVSVIGQVISIVCLSLHLLVYSMFRKLRNLPGLNIMSLSACLLIAQL--LFLFAGSVSVSYSWCFTIGVLVHYFFLASFLWMNVMAFDICRTFVKFSKPSLRDDYSSKFIRYCAYCIL---VALVIVLSAIVANFTL-GDSLYRPGYGEGICWIKNRKALLAFFAAPVAVIVTSNLVYFFITLWSIQKSMEASKMAAGNKKGERDRFWLYVKLSTIMGLTWVFGFVAAIFDVEVLWYLFIIFNSLQGAMICFAFVMTKQVLSL 704          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: A0A3M6T4U7 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005188 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 4.377e-19
Identity = 78/254 (30.71%), Postives = 117/254 (46.06%), Query Frame = 3
Query: 1068 FLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKK--KTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWL-CVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
              S+  L +L+++Y +    +N  G   + LS  L L      L   K  E    C  + I   FF L  F WM++ + D   TF  + T   ++   T K F  YCI G+   A+ VG   +++ T     TF   YG   YCW ++  +      IPV   L++N V      Y I        +     SN++L L CV+LTTV GL ++L++ A   + + L     V NSLQG F+ +CF   K+VR +
Sbjct: 1133 LFSIFSLCLLLIVYVSFKDLKNLPGRCVISLSAALLLYQI-TFLSAKKSTEVDVLCKAVAILLHFFILSTFAWMSIMAFDAANTFSIKVTVRRRQPSDTRKIFIKYCIVGWGLPAVIVGLCSVLDHT----GTFHIGYGNLVYCWISDSKALTFAMVIPVSATLVFNIVCFTKNIYVIHHLQMAANMAVSNRSNASLTLICVKLTTVMGLTWILELAANWKQTNFLRYPSTVLNSLQGFFITLCFVTTKKVRGL 1381          

HSP 2 Score: 99.3673 bits (246), Expect = 1.561e-17
Identity = 86/288 (29.86%), Postives = 127/288 (44.10%), Query Frame = 3
Query:  966 TKPVPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKK--KTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG-RYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWL-CVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
             +P P   LT KY   N+  + +      T     LS+V L  L+ +Y +    RN  G   + LS  L     F  L   K  E    C  + I   FF L  F WMAV + D   TF     +  ++   T K F  YCI G+   A+ VG  I+++ T     TF   YG   +CW ++  +  +    PV   L++N +      Y I    +   +     S ++L L C++LTTV GL ++LQ+ A     + L     V NS+QG F+  CF   K+VR +
Sbjct:  427 AQPGPLDALT-KYENDNLVLVHF------TFAAMILSIVSLCFLLAVYLSFKELRNLPGRCVINLSGALLCYQAF-FLSAKKSTEVPILCQAVAILIHFFALSAFSWMAVMAFDTASTFTPTVADTSRQPSDTRKIFIKYCILGWGLPAVIVGFCIVLDLT----GTFHVGYGNFLFCWISDNTALTVVMVTPVSAALIFNVICFAKSVYAIRHLQQAAALAASNSSKASLILICIKLTTVMGLTWILQLAAKWRHTEFLQYPSAVLNSMQGLFITSCFVTTKKVRGL 702          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: A0A3M6T4V7 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005184 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.418e-18
Identity = 75/261 (28.74%), Postives = 123/261 (47.13%), Query Frame = 3
Query: 1053 TEVFTFLSMVCLFILILLYTTQSMFRNFGG--YLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKT--LKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIV-FYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
            T + T LS++ L  L+ +Y      RN  G   + +C +   +   FF +    K  E    C  + IS  FF L  F WM++ + +    F  ++ N  ++ +   K+F  YCI G+    I VG   +++FT     +F   YG   YCW     + ++    PV L L++N +TC+    Y I +  K   +       S   +C++LTTV GL ++L + A   + + L     V N +QG F+ +CF  +KRVR +
Sbjct:  421 TVIGTTLSIISLCFLLFIYLFFKELRNLPGKCLINICGALLCYQIIFFTV---EKANEVDALCKAVAISLHFFILAAFSWMSIMAFNTANAFTVKAGNARRQSSNQRKTFIKYCILGWGLPVIVVGLFTVLDFT----GSFHVGYGKSNYCWIFGNTAMIVAMVTPVSLALVFN-ITCLAKNLYGIHQLQKGASLAANNSKASLTLICIKLTTVMGLTWILGLAANWKQTEFLHYPSTVLNCMQGFFIALCFTTSKRVRGL 673          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: A0A087UWI6 (Putative G-protein coupled receptor Mth-like 3 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01041 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.094e-17
Identity = 68/246 (27.64%), Postives = 122/246 (49.59%), Query Frame = 3
Query: 1071 LSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRV 1808
            +S++CL + + +Y      RN  G + + LS  L L     LL+  +  E  + C    +   F  L  F WM+V + D+ +TF    +   + +  K+F  Y +  +   A  +  +I V+  L  N+ FRP+YG   CWF +    L+++ +PV  LL+ N +   +  + + + S++ R V      +  +L ++LTT+ GL + L IFA ++ +D +    ++ N LQG F+ I F   K +
Sbjct:   94 ISVICLTLHLAVYAILKKLRNCPGKILMSLSASL-LCGHLFLLLGPRFMEIYWLCYLNAVFTYFGYLSAFHWMSVMAFDIHKTFSMTQS---RNRNSKTFIKYSLCSWISSASILLISITVDNVLKENNEFRPRYGQPICWFNHRKGLLVFFVVPVTTLLMANVILFAVTAFYVRRISRQARSVSNFTDKTRYFLYMKLTTILGLTWFLGIFAAITRIDAVWYAFIILNGLQGAFIFIAFTLKKSI 335          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Match: adgrf3b (adhesion G-protein coupled receptor F3-like [Source:NCBI gene;Acc:103029590])

HSP 1 Score: 61.6178 bits (148), Expect = 2.118e-9
Identity = 67/260 (25.77%), Postives = 122/260 (46.92%), Query Frame = 3
Query: 1068 FLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCIT-GFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFT-NIP-SGLIWYFI-PVCLLLLWNSVTCVIVFYRIIK--TSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILV-----VFNSLQGCFLMICF-FWAKRVR 1811
            F+++  L    ++ T  S FR+      + +S CL L++   +   +++      C  + ++Q FF L MF WM   S+ LL    F    + K    K F    +T G++C  + VG+     +   +  T    Y    CW T + P  G I  F+ P+  ++  N  + V+V   ++K   ++  +   K+ + S + + + LT VFG  ++L +F  L + +  ++ L+     + NSLQG F+++   F  KRVR
Sbjct:  734 FITIEALVWHAVVKTNLSHFRHTA---LINISLCLLLADCSFVAATFQNILTDTLCILLTVAQHFFYLAMFFWMLCLSIMLLHQLIFVFHPLRK----KVFMILSMTIGYACPTLTVGAT----YMYYDKRTDVHYYSRSTCWLTYDSPMKGSIHAFLFPLGTIIFINMFSMVVVIVTLLKPAAAESNKKDDKEAAKSIIKVIIFLTPVFGGTWILGLFVFLMDDNKSIKPLIHYSFTIVNSLQGLFILLTGCFGEKRVR 982          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Match: adgrf3b (adhesion G-protein coupled receptor F3-like [Source:NCBI gene;Acc:103029590])

HSP 1 Score: 61.6178 bits (148), Expect = 2.318e-9
Identity = 67/260 (25.77%), Postives = 122/260 (46.92%), Query Frame = 3
Query: 1068 FLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCIT-GFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFT-NIP-SGLIWYFI-PVCLLLLWNSVTCVIVFYRIIK--TSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILV-----VFNSLQGCFLMICF-FWAKRVR 1811
            F+++  L    ++ T  S FR+      + +S CL L++   +   +++      C  + ++Q FF L MF WM   S+ LL    F    + K    K F    +T G++C  + VG+     +   +  T    Y    CW T + P  G I  F+ P+  ++  N  + V+V   ++K   ++  +   K+ + S + + + LT VFG  ++L +F  L + +  ++ L+     + NSLQG F+++   F  KRVR
Sbjct:  721 FITIEALVWHAVVKTNLSHFRHTA---LINISLCLLLADCSFVAATFQNILTDTLCILLTVAQHFFYLAMFFWMLCLSIMLLHQLIFVFHPLRK----KVFMILSMTIGYACPTLTVGAT----YMYYDKRTDVHYYSRSTCWLTYDSPMKGSIHAFLFPLGTIIFINMFSMVVVIVTLLKPAAAESNKKDDKEAAKSIIKVIIFLTPVFGGTWILGLFVFLMDDNKSIKPLIHYSFTIVNSLQGLFILLTGCFGEKRVR 969          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Match: adgrl2b.1 (adhesion G protein-coupled receptor L2-like [Source:NCBI gene;Acc:103021546])

HSP 1 Score: 57.7658 bits (138), Expect = 4.099e-8
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 3
Query: 1014 NVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGG-----YLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWL--CVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI--CFFWAKRVR 1811
            +V+E++  +  +   +   +S+VCL I I  +     FR         +  +C++  L+++  F  LV     E    C+ I     FF L  F WM + S+ L L       +   ++K      +Y   G+   A+ VG +  +++           YG  R CW   + +  IW FI PV  +++ N V  V+  Y+++K S   +    +  +   W+     L  + GL +   +F  L+E  ++  +  +FN+LQG F+ I  C    K+VR
Sbjct:  836 SVHELLLNVIKR---MGIAVSLVCLAISIFTFC---FFRGLQSDRNTIHKNLCIN--LFIAELF-FLVGIDMTEPPIVCSVIAGVLHFFFLAAFAWMCLESVQLYLMLVEVFESEFSRRK------YYYAAGYLFPAVVVGISAAIDYR---------SYGTARACWL-RVDNHFIWSFIGPVAFIIMLNLVFLVVTMYKMVKHSTSVKPDSSRLESIRSWVLGAFALLCLLGLTWSFGLF-FLNESSMMAYLFTIFNTLQGMFIFIFHCLL-QKKVR 1086          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Match: adgrl2b.1 (adhesion G protein-coupled receptor L2-like [Source:NCBI gene;Acc:103021546])

HSP 1 Score: 57.7658 bits (138), Expect = 4.245e-8
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 3
Query: 1014 NVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGG-----YLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWL--CVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI--CFFWAKRVR 1811
            +V+E++  +  +   +   +S+VCL I I  +     FR         +  +C++  L+++  F  LV     E    C+ I     FF L  F WM + S+ L L       +   ++K      +Y   G+   A+ VG +  +++           YG  R CW   + +  IW FI PV  +++ N V  V+  Y+++K S   +    +  +   W+     L  + GL +   +F  L+E  ++  +  +FN+LQG F+ I  C    K+VR
Sbjct:  844 SVHELLLNVIKR---MGIAVSLVCLAISIFTFC---FFRGLQSDRNTIHKNLCIN--LFIAELF-FLVGIDMTEPPIVCSVIAGVLHFFFLAAFAWMCLESVQLYLMLVEVFESEFSRRK------YYYAAGYLFPAVVVGISAAIDYR---------SYGTARACWL-RVDNHFIWSFIGPVAFIIMLNLVFLVVTMYKMVKHSTSVKPDSSRLESIRSWVLGAFALLCLLGLTWSFGLF-FLNESSMMAYLFTIFNTLQGMFIFIFHCLL-QKKVR 1094          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Match: adgrl2b.1 (adhesion G protein-coupled receptor L2-like [Source:NCBI gene;Acc:103021546])

HSP 1 Score: 57.7658 bits (138), Expect = 4.284e-8
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 3
Query: 1014 NVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGG-----YLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWL--CVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI--CFFWAKRVR 1811
            +V+E++  +  +   +   +S+VCL I I  +     FR         +  +C++  L+++  F  LV     E    C+ I     FF L  F WM + S+ L L       +   ++K      +Y   G+   A+ VG +  +++           YG  R CW   + +  IW FI PV  +++ N V  V+  Y+++K S   +    +  +   W+     L  + GL +   +F  L+E  ++  +  +FN+LQG F+ I  C    K+VR
Sbjct:  849 SVHELLLNVIKR---MGIAVSLVCLAISIFTFC---FFRGLQSDRNTIHKNLCIN--LFIAELF-FLVGIDMTEPPIVCSVIAGVLHFFFLAAFAWMCLESVQLYLMLVEVFESEFSRRK------YYYAAGYLFPAVVVGISAAIDYR---------SYGTARACWL-RVDNHFIWSFIGPVAFIIMLNLVFLVVTMYKMVKHSTSVKPDSSRLESIRSWVLGAFALLCLLGLTWSFGLF-FLNESSMMAYLFTIFNTLQGMFIFIFHCLL-QKKVR 1099          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004568.1 (pep scaffold:Pmarinus_7.0:GL476439:3807:37035:1 gene:ENSPMAG00000004154.1 transcript:ENSPMAT00000004568.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 3.721e-7
Identity = 55/202 (27.23%), Postives = 90/202 (44.55%), Query Frame = 3
Query: 1221 KSFACTYIGISQQFFNLGMFVWMAVYS-LDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG-RYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRIL-VVFNSLQGCFLMICF-FWAKRVR 1811
            K+F CT I     FF L  F W+   +    L   G + + I +K+ L   C     G   + +    AI V FT          YG  +YCW + +  GL++ F+ P   ++L N   C++VF +++          K  + ++LW    +  +  L ++  + AI      L +IL  VF+SLQG  +M+   F  K V+
Sbjct:  305 KAF-CTAIAAFLHFFFLASFCWVLTEAWQSYLAVTGQQRSKIVRKRFL---CLGWDAGLPALIV----AISVGFTKTKG------YGTIQYCWLS-LDGGLLYAFVGPAAGVVLVNMAICILVFNKLVSKEGIPDKKLKHTARASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLQGIVIMVVHSFLRKEVQ 491          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002352.1 (pep scaffold:Pmarinus_7.0:GL476883:4338:91444:1 gene:ENSPMAG00000002137.1 transcript:ENSPMAT00000002352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.106e-6
Identity = 63/245 (25.71%), Postives = 109/245 (44.49%), Query Frame = 3
Query: 1071 LSMVCLFILILLYTTQSMFRNFGGYLTV-----CLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYS-LDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRIL-VVFNSLQGCFL 1778
            +S + L +LI +YT   ++R+     +V     CLS    +S+   +LV     +    CT I +   F  L  F W+   +    +   G     I +K+      F C+ G+   A+ V ++  V FT  +       YG   YCW + +  GL++ F+ P   ++L N V  ++VF +++          K  + S+LW    +  +  L ++  + AI      L +IL  VF+SLQGC +
Sbjct:  488 ISSLALMLLIFIYTL--IWRSIKSDRSVILINFCLSI---ISSNILILVGQTQTQNKGVCTMIAVFLHFSFLATFCWVLTEAWQSYMAVRGVTMKRIIRKR------FLCM-GWGLPALVVATS--VGFTKASG------YGTANYCWLS-LEGGLLYSFVGPAAAVVLVNMVLGILVFNKLVSKEGIPDKELKHRAGSSLWSSCVVLPLLALTWMSAVLAITDPRSSLFQILFSVFDSLQGCVI 711          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO34420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE2])

HSP 1 Score: 90.8929 bits (224), Expect = 5.960e-19
Identity = 67/251 (26.69%), Postives = 118/251 (47.01%), Query Frame = 3
Query: 1071 LSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTL-KSFCFYCITGFSCVAINVGSAII-VEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLW-LCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRV 1808
            LSM+ L +LI  Y      RN  G + + L+  + L +    LV   D      C  + +S  F  L  F WM V + D+  TF    T  G+++T  +  C      ++  +  +  AI+ + F++  + ++R  YG G YC+  N PS +++ F+ PV ++LL+N +      + I    K+      ++    L  +C ++T+  G+ +VL  FA       L    V+ NSLQG  +++ +   +RV
Sbjct:  421 LSMISLVVLIFSYAVLPELRNLPGRVVLSLAITMLLYHLLYFLVNQSDTRA--LCVAVAVSLHFALLSAFCWMNVLAFDVHHTF----TKPGQRRTASRGHCPGTYAIYAAYSWGIPLAIVTISFSVDLSGSWRIGYGRGEYCFIEN-PSAMLYLFLLPVAIILLYNFIALFHTMWHIRAVRKKTSKASNQQRKPNLPIICFKMTSAMGITWVLAYFASTQATSFLWYAFVILNSLQGFLILLSYVLNRRV 664          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO36509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH3])

HSP 1 Score: 82.0333 bits (201), Expect = 3.995e-16
Identity = 66/268 (24.63%), Postives = 120/268 (44.78%), Query Frame = 3
Query: 1044 DKTTEVFTFLSMVCLFI-------LILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAII---VEFTLPNNSTFRPKYGGR-YCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECR-VVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVR 1811
            +K +EV   ++ VCL I       +++ Y+  S  R   G   + LST + LS  F L    +  +++ ACT + I   +F L  F+W A+ + D  + F  RS    K    ++     I    C+A+    A++   +   +  +      YG    CW TN    L+ + +PV ++L++NS+   +    I  T+K+ R         +  W+ +R+  + G  +V    A +  +  L  + V+ N LQG ++ + F   +R R
Sbjct:  748 EKGSEVLRMVTFVCLLISVIALGFVLVTYSLFSELRTTPGKNLMNLSTAILLSQIFWLSGSGQVHDRT-ACTVVAILLHYFFLASFIWTAIIAWDTWRAFSHRSHRSAKTMKRENL----IGTLRCMAVGWLPALLFVAITTAIDLSGAVAIGYGSDVACWITNGTPLLVVFGLPVVVILVFNSIFYALTIIAIRATAKQARFASSDSRQKAHFWIYLRIAAIMGFTWVFGFIAAVG-ITALWYVFVILNCLQGVYIALAFALTERAR 1009          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO37470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFI6])

HSP 1 Score: 79.337 bits (194), Expect = 2.495e-15
Identity = 66/236 (27.97%), Postives = 114/236 (48.31%), Query Frame = 3
Query: 1104 LYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFA-CTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFIPVCLLLLWN--SVTCVIVFYRII-KTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRIL-VVFNSLQGCFLMICFF 1793
            +Y      RN  G + + LS  L     F++L F      S A C  I I   +F L  F WMAV + D+ +TF  ++  I + +  +S   Y    +   A  VG+ ++++ T+P        YG G +C+ T+    +  + +PV L+L WN  S+   + + R+  K ++  R     ++N    +C++LT+V GL +   + A L    + + I+   FNSLQG F+++ F 
Sbjct:  706 IYARFPELRNLPGKIQMNLSVALLA---FHVLFFMVAMSTSGALCKAIAIGIHYFLLVGFAWMAVMAYDVHRTFTGQTEAILQPQ--RSMLVYSCLSWLLPAAFVGAIVVIDLTVPGAI----DYGKGEFCYITSRFGLIFAFLVPVSLVLSWNILSLARTLFYIRLARKAARGLRTSSGNQNNILPIMCMKLTSVLGLPWTFGVLASLFPSCLALWIVYTAFNSLQGFFMLLSFL 932          

HSP 2 Score: 57.7658 bits (138), Expect = 1.454e-8
Identity = 47/185 (25.41%), Postives = 83/185 (44.86%), Query Frame = 3
Query: 1104 LYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFA-CTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYG-GRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLW 1652
            +Y      RN  G + + LS  L     F++L F      S A C  I I   +F    F WMAV + D+ +TF  ++  I + +  +S   Y    +   A  VG++++++ T+P        YG G +C+ T+    +  + +PV L+L WN ++     + I    K     Q++ +   +W
Sbjct:  360 IYARFPELRNLPGKIQMNLSVALLA---FHVLFFMVAMSTSGALCKAIAIGIHYFLFVGFAWMAVMAYDVHRTFTGQTEAILQPQ--RSMLVYSCLSWLLPAAFVGASVVIDLTVPGAI----DYGKGEFCYITSRFGLIFAFLVPVSLVLSWNILSLARTLFYIRLARKYSDDNQRRTALKIMW 535          

HSP 3 Score: 48.9062 bits (115), Expect = 7.063e-6
Identity = 41/163 (25.15%), Postives = 67/163 (41.10%), Query Frame = 3
Query:  285 DQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVND-NHYYSKYCTKE----LMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIK-SPYSCSILPLIDSELQRTCFINLTRLCQE 755
            +  C CD IC+Q GDCC  + K  +   L      K    N Y    V N C    + Y    C++     L  P   +++      +  + Y N +CARCN  +   Y++ +  C      N   + + ++     +C+IL      + +T  I   RLC+E
Sbjct:   55 ETLCYCDSICLQIGDCCHDYRKVCK-AKLSEKPQVKQVCSNHYI---VTNSCPKGTDQYLDGLCSETHGEILRRPYDLLRNLHVFDHDKNISYRNVFCARCNGARNTSYWTTTADC--STTANLSSIKDNLLSFVRNNCTIL----MGMPKTSGIIEGRLCKE 207          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO31226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYI9])

HSP 1 Score: 64.6994 bits (156), Expect = 8.039e-12
Identity = 50/197 (25.38%), Postives = 87/197 (44.16%), Query Frame = 3
Query: 1230 ACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNI---GKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG-RYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECR-VVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKR 1805
             C +I I   F  L  F WM++ + D  + F F   +     K K  +        G+  V + V    I+   L  +  F  +YGG + CW  N  + L  + IPV L L+WN+V  V+    I    ++ R  V + +    + +  ++ ++ G  +V  I A     + L+   V+F + QG F+ + F + +R
Sbjct:   27 GCVFIAIVLHFAFLASFSWMSIIAFDTWRAFSFSGQSAMRSDKAKQRQRIMKRLAIGYLSVFVLV----IILTALDQSGAFAIRYGGSKGCWINNGDANLYIFVIPVSLALVWNAVFFVLTVKAIRVAKQQSRAAVNEGDQKRDIVVYAKIASLMGFAWVFGILAAFIS-EYLMFPFVIFTTAQGVFIAVSFVFTRR 218          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO47499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX7])

HSP 1 Score: 62.3882 bits (150), Expect = 1.155e-10
Identity = 54/230 (23.48%), Postives = 103/230 (44.78%), Query Frame = 3
Query: 1146 LTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFG----FRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGR-YCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRV-VQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEV--DILVRILVVFNSLQGCFLMICFFWAKRVR 1811
            L++ L+   WL+            ++   CT +    QFF L  F+W ++ + D  + F     FR + +  ++  K    +   G+  + ++VG  I    +L  + T    YG R  CW +N  + +  + IP+ + L+WN+   V+    I + + + R+  +  ++     + VRL  V G  +V   F  L+E+    L  + +  N LQG +L   F  +++ R
Sbjct:   44 LSILLAQATWLAGI-------NQTDQPITCTVVAALIQFFYLVSFMWTSIIAFDTWRAFSSKTHFRGSELNARRR-KRILQHIAVGWIPITLHVGICI----SLDQSETVLIGYGSRNACWISNGMATVYTFAIPIAIALIWNATFYVMTVKAIKEITGQARMAAENSQARRHFAIYVRLAAVMGFTWV---FGFLAELLWTPLWYVFISLNCLQGAYLAGSFALSEQAR 258          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Match: adgre5b.3 (adhesion G protein-coupled receptor E5 [Source:NCBI gene;Acc:101162663])

HSP 1 Score: 52.7582 bits (125), Expect = 1.098e-6
Identity = 58/260 (22.31%), Postives = 113/260 (43.46%), Query Frame = 3
Query: 1053 TEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG--RYCWFTNIPSGLIW-YFIPVCLLLLWNSVTCVIVFYRIIK--TSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGC--FLMICFFWAKRVR 1811
            T++   +S++CL + I  +      +     + + L  CL++++ F  L      +    C ++     FF L +F WM +  + L     +R   +    T++    Y        A+  G+ +++      ++  RPK  G  ++CW + +  GLIW +F PVC ++L N V  +   +++ +  +S    +    +  +     +    + GL +V   F       ++  I  V NSLQG   F+M C   +K+VR
Sbjct:  432 TKIGLGVSLLCLALSIFTFRFCRSIQGTRTTIHLHLCICLFMADLF-FLAGISQVKPEAGCRFVAAMLHFFFLAVFTWMLLEGVQL-----YRMVVLVFNATMRPLYMY--------AMGYGTPLLIVLV---SACSRPKGYGTEQHCWLS-LEDGLIWSFFGPVCFIILVNVVFFIFTVWKLAQKFSSLNPDLSSLHKIRAFTVTAIAQMCILGLMWVFGAFLFQEGTAVVAYIFTVLNSLQGALIFVMHCLL-SKQVR 672          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Match: adgrl4 (adhesion G protein-coupled receptor L4 [Source:NCBI gene;Acc:101174580])

HSP 1 Score: 51.9878 bits (123), Expect = 1.933e-6
Identity = 64/267 (23.97%), Postives = 110/267 (41.20%), Query Frame = 3
Query: 1032 YKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-------LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG--RYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESN--STLWLCVR----LTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            + I  + T++   +S++CLF+ I  +   S  ++    +   L   L+++ F  L+    +  K F     G+   FF L  F WM +  + L       +   GF   N           FY I G+   A+ V  +          +T   KY G  R CW +   +  IW FI P CL++L N +   ++ Y++ + +     V+K E +    +  C R    L  V G  +   +  IL E  +   +  + N+ QG F+ I
Sbjct:  434 HTILTRITQLGMIISLICLFLCIFTFWFFSEIQSTRTTIHKNLCCSLFMAEFIFLVGINMNTHKLFCSVIAGLLHYFF-LAAFAWMCIEGIHLYLIVVGVIYNKGFLHRN-----------FY-IFGYGSPAVVVAIS----------ATLGSKYYGTDRVCWLST-ENHFIWSFIGPACLIILVNLLAFGVIIYKVYRHT----AVKKPEISHYENIRSCARGAFALLFVLGATWTFGVLHILHETTLTAYLFTITNAFQGMFIFI 672          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Match: adgrl4 (adhesion G protein-coupled receptor L4 [Source:NCBI gene;Acc:101174580])

HSP 1 Score: 51.9878 bits (123), Expect = 2.186e-6
Identity = 64/267 (23.97%), Postives = 110/267 (41.20%), Query Frame = 3
Query: 1032 YKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-------LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG--RYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESN--STLWLCVR----LTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            + I  + T++   +S++CLF+ I  +   S  ++    +   L   L+++ F  L+    +  K F     G+   FF L  F WM +  + L       +   GF   N           FY I G+   A+ V  +          +T   KY G  R CW +   +  IW FI P CL++L N +   ++ Y++ + +     V+K E +    +  C R    L  V G  +   +  IL E  +   +  + N+ QG F+ I
Sbjct:  472 HTILTRITQLGMIISLICLFLCIFTFWFFSEIQSTRTTIHKNLCCSLFMAEFIFLVGINMNTHKLFCSVIAGLLHYFF-LAAFAWMCIEGIHLYLIVVGVIYNKGFLHRN-----------FY-IFGYGSPAVVVAIS----------ATLGSKYYGTDRVCWLST-ENHFIWSFIGPACLIILVNLLAFGVIIYKVYRHT----AVKKPEISHYENIRSCARGAFALLFVLGATWTFGVLHILHETTLTAYLFTITNAFQGMFIFI 710          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Match: adgrl4 (adhesion G protein-coupled receptor L4 [Source:NCBI gene;Acc:101174580])

HSP 1 Score: 51.9878 bits (123), Expect = 2.220e-6
Identity = 66/267 (24.72%), Postives = 112/267 (41.95%), Query Frame = 3
Query: 1032 YKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDL-------LQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGG--RYCWFTNIPSGLIWYFI-PVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESN--STLWLCVR----LTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMI 1784
            + I  + T++   +S++CLF+ I  +   S  ++    +   L   L+++ F  L+    +  K F     G+   FF L  F WM +  + L       +   GF   N           FY I G+   A+ V  AI        ++T   KY G  R CW +   +  IW FI P CL++L N +   ++ Y++ + +     V+K E +    +  C R    L  V G  +   +  IL E  +   +  + N+ QG F+ I
Sbjct:  436 HTILTRITQLGMIISLICLFLCIFTFWFFSEIQSTRTTIHKNLCCSLFMAEFIFLVGINMNTHKLFCSVIAGLLHYFF-LAAFAWMCIEGIHLYLIVVGVIYNKGFLHRN-----------FY-IFGYGSPAVVV--AI--------SATLGSKYYGTDRVCWLST-ENHFIWSFIGPACLIILVNLLAFGVIIYKVYRHT----AVKKPEISHYENIRSCARGAFALLFVLGATWTFGVLHILHETTLTAYLFTITNAFQGMFIFI 674          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036793.1 (pep primary_assembly:ASM223467v1:22:433884:440537:1 gene:ENSORLG00000027158.1 transcript:ENSORLT00000036793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.728e-6
Identity = 56/203 (27.59%), Postives = 97/203 (47.78%), Query Frame = 3
Query: 1218 EKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFT-LPNNSTFRPKY-GGRYCW--FTNIPSGLIWYF-IPVCLLLLWNSVTCVIVFYRIIKTSK--ECRVVQKKESNST-LWLCVRLTTVFGL----GYVLQIFAILS-EVDILVR-ILVVFNSLQGCFLMI 1784
            + S  C    + + FF L MF WM   S  LL    F    + KK  L+   F  + G+ C        +IV  T L NN+     Y     CW  +  +  G I+ F IPV +++ +N+ + ++V  ++++  K  + ++ ++K +  T +   V LT +FGL    G ++ I  + S +V   V  I V+ N+ QG F+++
Sbjct:   97 QTSVWCRIFAVLKHFFYLAMFFWMLALSSTLLHQAVFLFHKVSKKTYLR---FSILLGYVC------PLLIVFITFLANNAGEEGSYFSSDTCWLVYNGLLKGSIFTFIIPVGVIVFFNTFSMLVVIMKLLEHHKNDDTQIDKEKAAAKTVIRSVVLLTPIFGLTWAFGLMIMILDLTSGDVAYAVNYIFVILNAFQGFFILL 290          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033610.1 (SMESG000033610.1)

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 566/568 (99.65%), Postives = 567/568 (99.82%), Query Frame = 3
Query:  255 GQCTENCRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYRNDHCCSCRNISCFKQIPLALDVXXXXXXXXXXXXXWENEVQTKPVPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAIXXXXXXXXXXXXXXXXXXXXXXXXXXXDINDDTVCTKLELKTNVHNK 1958
            GQCTENCRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYRNDHCCSCRNISCFKQIPLALDVASSAFSFSLNFAAWENEVQTKPVPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILS+VDILVRILVVFNSLQGCFLMICFFWAKRVRAILTSTFLSLSNNLSKSSKTEKSSRTHTTDINDDTVC KLELKTNVHNK
Sbjct:   14 GQCTENCRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYRNDHCCSCRNISCFKQIPLALDVASSAFSFSLNFAAWENEVQTKPVPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSKVDILVRILVVFNSLQGCFLMICFFWAKRVRAILTSTFLSLSNNLSKSSKTEKSSRTHTTDINDDTVCPKLELKTNVHNK 581          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033611.1 (SMESG000033611.1)

HSP 1 Score: 452.595 bits (1163), Expect = 9.309e-152
Identity = 240/528 (45.45%), Postives = 319/528 (60.42%), Query Frame = 3
Query:  264 TENCRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDN-HYYSKYCTKELMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYRNDHCCSCRNISCFK-QI--PLALDVXXXXXXXXXXXXXWENEVQTKPVPQSN------LTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
            ++ C K+ +YC CD  C  +GDCC GHE F +TGSL +I  CK+F  +  E++ V++KC N+  H  SK C KE++  K+P+KSF  V+ EN +I+EN +CA+CNN   Y Y ++S+SC   NIT+    N+ + KS  SC I P I+S ++R C   L   C        +N++  C NG       G   YRN  CC C  I C + Q+  P ++   S+           E+E +     Q+N      + +K   + VY I +         FT LSM+ L +LI+LY TQ +F NFGGYLT+CLS CLWL NF  LLV   +   S  C Y+GI Q F  +  F+WMA+Y+LDLLQTFG +S N  KKKT K+FCFYC+ GFSC  + V  + ++EFTL  N T RP YGG +CWFTN   G +WYFIP+C+LLLWN   C++VFYRIIKTSKEC++V   +S S LWLC+RLT+VFG GY+ QI AIL+    L+      N LQGC L  CF W KRVR I
Sbjct:   19 SDKCEKNSEYCNCDDKCTLYGDCCSGHESFNKTGSLRNILKCKLFKPSVAESIYVVDKCKNNTKHILSKLCRKEVIFSKIPVKSFIPVINENGVIFENSFCAKCNNEDLYSYLNISISCPDVNITDIYDANQAIAKSRDSCEIQPEIESNIKRICKTKLIDFCSNSFEDIGENITGKCTNGPESFEVHGEILYRNTFCCKCWKIHCRRLQVMKPTSILDMSTFSYLLNFNDWVESEDEVYKPEQNNTEFDEIIKSKNLKYFVYYISF--------TFTCLSMISLTVLIVLYITQKVFHNFGGYLTICLSICLWLINFCTLLVQSPNIVNSSFCQYLGIFQHFITICNFIWMAIYALDLLQTFGVKSFNSSKKKTWKTFCFYCLVGFSCSGLIVTLSTVLEFTLETNCTIRPNYGGTHCWFTNKLGGTVWYFIPICILLLWNFGACILVFYRIIKTSKECQLVSNDQSYSILWLCIRLTSVFGFGYIFQIIAILTHFQPLIVFGSFVNCLQGCLLACCFIWTKRVRII 538          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033614.1 (SMESG000033614.1)

HSP 1 Score: 408.683 bits (1049), Expect = 7.623e-135
Identity = 229/527 (43.45%), Postives = 313/527 (59.39%), Query Frame = 3
Query:  270 NCRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYRNDHCCSCRNISCFKQIPLALDVXXXXXXXXXXXXXWENEVQTKPVPQSNLTNK------------YFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRA 1814
            N  +SD+ C  D  C  +GDCC GH+   + G L+ + SCK + K     M +INKC N NH  S +CTK++  PK P+KS+  V+   K+IY+N +CA+CN    + Y  + V+C    I ++   N+ +I +P  C I P  +  LQR+C   +   C      +   V D C NG+ D        Y+N  CC C N +CF +  L  ++ +S FS+ LNF  WE +   + V + N T +            Y T     +IY I    +  FT LS+V LF LI+LY T  +F+N GGYLT+CLS CLWL NF +LLV      KS +C Y+ I   F  L  FVWMAVY+LDLLQTFG +S +I K +  K+FC Y I  F+     VG ++I+E+    NST RP+YGG +CWFT+   GLIWYFIPVCLLLLWN +TC  VFY++ KT+KECR++   + NSTLWLC+RLT VFG+GYVLQI AI ++++IL+ +  + N LQG  L +CF   KRVR+
Sbjct:   18 NGSQSDRICHSDPQCPLYGDCCYGHQDHGKPGLLKDVLSCKPYNKLFPSAMWLINKCKNLNHPLSDFCTKKIFYPKAPLKSWIPVISNRKIIYDNLFCAKCNEEIDFTYLPVKVNCGPLEIYDYASANQAVIDNPNHCEIFPYFNRTLQRSCEGEIITNCTNTKLIQNKFVIDKCENGEKDYFVFRLQKYKNVFCCKCWNKNCFGRRKLP-NIRNSPFSYLLNFNDWEKQENKETVKEKNFTQENNSSNNTNSTLDYSTGMGETVIYHI----SFAFTCLSLVSLFFLIILYLTHQVFKNLGGYLTICLSICLWLINFMSLLVTNTQIVKSASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKSASINKNRGWKTFCIYFICVFAVSGCVVGISVIIEYFDKTNSTLRPQYGGPHCWFTSKFGGLIWYFIPVCLLLLWNIITCGFVFYQLFKTAKECRIINNNDLNSTLWLCMRLTAVFGVGYVLQIIAIFTQLNILISLGSMVNCLQGFMLTLCFVCTKRVRS 539          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033615.1 (SMESG000033615.1)

HSP 1 Score: 303.908 bits (777), Expect = 3.057e-96
Identity = 177/390 (45.38%), Postives = 232/390 (59.49%), Query Frame = 3
Query:  681 CSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYR-NDHCCSCRNISCFKQIPLALDVXXXXXXXXXXXXXWENEVQTKP----------VPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSEVDILVRILVVFNSLQGCFLMICFFWAKRVRAI 1817
            C++LP  D  LQR C I          +K   N+S M +  + D +      Y  N   CS    +     P     + + FS+  N+  WE +   K            P +N T  Y T     +IY I    +  FT LS+V LF LI+LY T  +F+NFGGYLT+CLS CLWL NF +LLV      +S +C Y+ I   F  L  FVWMAVY+LDLLQTFG +  N  KK+ LKSF  YC+ GFS     VG ++I E+    NST RP+YGG YCWFT+   GLI+YFIPVCLLLLWN + C  VFY++ KT+KECR+V+KK++NSTLWLC+RLT VFG+GYVLQIFAI ++++IL+ +  + N LQG  L +CF   KR R++
Sbjct:    8 CNVLPYFDKRLQRNCSIK---------TKDVSNISSM-IEDEDDRMGMNYIVYNCNIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDNNQKNFTPYTNSTFDYSTGMGETVIYHI----SFAFTCLSLVSLFFLIILYLTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLIGFSTSGSVVGISVITEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSL 383          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000067292.1 (SMESG000067292.1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.496e-20
Identity = 117/502 (23.31%), Postives = 209/502 (41.63%), Query Frame = 3
Query:  273 CRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSFAAVMG-----------EN-KLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNF----YRNDHCCSCRNISCFKQIPLALDVXXXXXXXXXXXXXWENEVQTKPVPQSNLTNKYFTHNVYEII------YKIFDKT-TEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTL---KSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKK--ESNSTLWLCVRLTTVFGLGYV 1694
            C  S+ +C CD  C  FGDCC  H++       E I+SC       ++   VI+KC+    Y S   T   +  K   KS  +V             EN  L ++N +CA CN   ++++  +      H  +  ++ +    KS Y  +       E QR C  N+   C +      D +  +C N     V++ R      YRN +C  C   S        L V +   +   N     N  +   + Q N T   F ++   I       ++ F+K  T  F  +SM+ L  ++L++   +  RN    +T+ L+  +      N++    +      C Y  I+  F  L  F WM +++LD+ ++       I K  +L   +   FY + G+    +   +A+ ++    + +   P +G   C+   +  GL+W+FIP+C+ LL N + C +++  I K +++   V            LC++L+ +FG  ++
Sbjct:   29 CVGSETHCYCDDQCSMFGDCCHKHQQHH-----EPIASC-------HDGYYVIDKCL----YKS---TDGNLKDKCERKSEISVNNLLYHVPTYGNYENVSLTFKNAFCAVCNGKNQFEFARVE----KHKTSLKRKKDNTTEKSNYKYT----FPKEFQRICHENVIITCDDDSE---DALKLLCRNQPTFYVTENRGMVQKIYRNAYCFLCNTNSLQWSYKYRLVVPTEIKALDFNEWCLNNCNELLKLYQINQTT--FRNHSDSISCTENKNFQFFEKVLTVTFRIVSMISLLFMVLVFGCTNDHRNQASKITLFLTISVLSLCVTNIIFSVVENPSKRFCLYFSIAYHFCFLSSFFWMTIFALDVYKSITSPRLRINKTISLIKSRKLKFYFLGGYGLPLLLTITAVCIQ-KFDSENILNPSFGEIQCFINQLIGGLVWFFIPLCICLLTNIIICCVLYRFIYKINQQTVEVGHSLNVEKKNFILCIKLSILFGATWL 497          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mth7.286e-1024.34gene:FBgn0023000 transcript:FBtr0072571[more]
mth7.439e-1024.34gene:FBgn0023000 transcript:FBtr0306850[more]
mth7.439e-1024.34gene:FBgn0023000 transcript:FBtr0072570[more]
mthl119.713e-924.31gene:FBgn0045443 transcript:FBtr0332552[more]
mthl111.146e-824.31gene:FBgn0045443 transcript:FBtr0332553[more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adgrf3b4.962e-929.67adhesion G protein-coupled receptor F3b [Source:ZF... [more]
adgrf3b3.199e-829.33adhesion G protein-coupled receptor F3b [Source:ZF... [more]
adgrf3a1.846e-725.95adhesion G protein-coupled receptor F3a [Source:ZF... [more]
adgre154.914e-727.18adhesion G protein-coupled receptor E15 [Source:ZF... [more]
adgre5b.36.632e-725.29adhesion G protein-coupled receptor E5b, duplicate... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d9b5.821e-825.30TBC1 domain family member 9B [Source:Xenbase;Acc:X... [more]
tbc1d9b6.938e-825.30TBC1 domain family member 9B [Source:Xenbase;Acc:X... [more]
tbc1d9b7.588e-825.30TBC1 domain family member 9B [Source:Xenbase;Acc:X... [more]
tbc1d9b7.628e-825.30TBC1 domain family member 9B [Source:Xenbase;Acc:X... [more]
tbc1d9b7.855e-825.30TBC1 domain family member 9B [Source:Xenbase;Acc:X... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Adgre12.268e-825.00adhesion G protein-coupled receptor E1 [Source:MGI... [more]
Adgre12.268e-825.00adhesion G protein-coupled receptor E1 [Source:MGI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P83120|MTH_DROSI4.174e-923.89G-protein coupled receptor Mth OS=Drosophila simul... [more]
sp|O97148|MTH_DROME7.457e-924.34G-protein coupled receptor Mth OS=Drosophila melan... [more]
sp|Q9GT50|MTH_DROYA1.341e-824.68G-protein coupled receptor Mth OS=Drosophila yakub... [more]
sp|Q95NT6|MTH2_DROYA7.684e-822.75G-protein coupled receptor Mth2 OS=Drosophila yaku... [more]
sp|P83118|MTH11_DROME9.736e-824.31Probable G-protein coupled receptor Mth-like 11 OS... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7URJ04.582e-2531.35G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
R7TZV21.138e-2230.04G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A3M6T4U74.377e-1930.71Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A3M6T4V75.418e-1828.74Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A087UWI61.094e-1727.64Putative G-protein coupled receptor Mth-like 3 (Fr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adgrf3b2.118e-925.77adhesion G-protein coupled receptor F3-like [Sourc... [more]
adgrf3b2.318e-925.77adhesion G-protein coupled receptor F3-like [Sourc... [more]
adgrl2b.14.099e-824.46adhesion G protein-coupled receptor L2-like [Sourc... [more]
adgrl2b.14.245e-824.46adhesion G protein-coupled receptor L2-like [Sourc... [more]
adgrl2b.14.284e-824.46adhesion G protein-coupled receptor L2-like [Sourc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004568.13.721e-727.23pep scaffold:Pmarinus_7.0:GL476439:3807:37035:1 ge... [more]
ENSPMAT00000002352.11.106e-625.71pep scaffold:Pmarinus_7.0:GL476883:4338:91444:1 ge... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344205.960e-1926.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365093.995e-1624.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374702.495e-1527.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312268.039e-1225.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474991.155e-1023.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adgre5b.31.098e-622.31adhesion G protein-coupled receptor E5 [Source:NCB... [more]
adgrl41.933e-623.97adhesion G protein-coupled receptor L4 [Source:NCB... [more]
adgrl42.186e-623.97adhesion G protein-coupled receptor L4 [Source:NCB... [more]
adgrl42.220e-624.72adhesion G protein-coupled receptor L4 [Source:NCB... [more]
ENSORLT00000036793.12.728e-627.59pep primary_assembly:ASM223467v1:22:433884:440537:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033610.10.000e+099.65SMESG000033610.1[more]
SMESG000033611.19.309e-15245.45SMESG000033611.1[more]
SMESG000033614.17.623e-13543.45SMESG000033614.1[more]
SMESG000033615.13.057e-9645.38SMESG000033615.1[more]
SMESG000067292.15.496e-2023.31SMESG000067292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027333 ID=SMED30027333|Name=G_PROTEIN_RECEP_F2_4 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2077bp
GGGAAATATTTCTCCTTTATCTTTCAGTGTTTGATCTGGGAAATTATTTA
CATTTCAGTCAGCCTAAGTGCGATCAAAAACAGCGCAGCAAATCCAATCG
ATAAATAGTGCAATTATCAATTTCAATTATTGAGAGATCCCAAAGAGGCA
TTATCAAAATAAATATTTTCTTTGACATTTATTTTAGTTGCTAATTTTTT
TTCACTTTATCGACAATGATTTTGGTTTTGTTTATTTTTTTTATTTTTTA
CCTGGGTCAATGCACAGAGAATTGTAGAAAATCCGATCAGTATTGTCAAT
GCGATAAGATCTGCGTCCAATTCGGTGATTGTTGTCCCGGACATGAGAAA
TTCCAACAAACCGGAAGTTTGGAAAGTATTTCCAGTTGTAAAGTATTTGC
AAAGAATTCCTATGAAAACATGCGCGTTATTAATAAATGTGTCAATGATA
ATCATTATTATTCCAAGTATTGCACAAAAGAATTGATGGATCCTAAATTG
CCAATAAAATCGTTTGCAGCCGTCATGGGGGAAAATAAATTAATTTACGA
AAATTACTATTGTGCCAGGTGCAACAATATCAAACGATACCAATACTTTA
GTTTGTCTGTTTCTTGTTTTGGTCACAATATCACCAATTTTAAACAAGTA
AATGAGATAATGATCAAATCTCCTTACAGTTGTTCGATTTTACCTTTGAT
AGATTCAGAGCTTCAAAGAACTTGTTTCATAAATCTCACCCGATTGTGTC
AAGAACCTCTGTCGAAACGGTTTGATAATGTGTCGGACATGTGTTTGAAT
GGAAAATTGGATATCGTATCAGATGGAAGGAATTTTTATAGAAATGATCA
TTGTTGCTCTTGTAGAAATATATCTTGTTTCAAACAAATTCCACTCGCGC
TTGATGTTGCAAGCAGTGCATTTTCATTTAGCCTTAATTTTGCAGCGTGG
GAAAATGAAGTTCAAACTAAGCCGGTTCCTCAATCGAATTTAACAAACAA
ATATTTTACACACAATGTTTATGAAATTATATATAAAATATTTGACAAAA
CTACAGAAGTCTTTACTTTTTTATCAATGGTTTGTTTATTCATATTAATC
CTTCTATACACAACTCAAAGTATGTTTCGAAATTTCGGAGGTTACCTTAC
CGTCTGTTTAAGTACATGTCTTTGGTTGTCGAATTTTTTTAATTTGTTGG
TATTCTATAAGGATTTTGAGAAATCTTTCGCTTGTACATATATTGGTATA
TCTCAGCAATTTTTCAATCTCGGTATGTTTGTTTGGATGGCGGTATATTC
TCTTGATTTGTTGCAAACATTCGGATTTCGATCCACGAATATTGGGAAGA
AGAAAACTTTGAAAAGTTTTTGTTTTTATTGTATTACTGGGTTCAGTTGT
GTGGCAATAAATGTTGGTTCCGCCATAATTGTTGAGTTTACATTGCCAAA
CAATTCCACATTTCGACCGAAATATGGAGGACGATACTGTTGGTTTACCA
ATATTCCAAGTGGACTAATTTGGTACTTTATACCTGTATGCTTATTGCTG
CTATGGAACAGTGTTACGTGCGTTATTGTATTCTATCGAATTATAAAAAC
GTCGAAAGAATGTCGTGTTGTACAGAAAAAGGAATCTAATTCAACTCTTT
GGCTTTGTGTTAGACTTACAACCGTTTTTGGATTGGGTTATGTGCTTCAA
ATATTTGCAATTCTTTCCGAAGTAGACATACTGGTTAGAATTTTAGTAGT
GTTTAACAGTCTTCAAGGTTGTTTTCTAATGATTTGTTTCTTTTGGGCAA
AACGTGTAAGGGCAATACTTACGAGCACATTTCTATCCTTGTCTAACAAT
TTATCCAAATCCTCAAAAACTGAAAAATCATCTCGTACTCATACAACTGA
TATAAATGATGACACCGTTTGTACGAAATTAGAATTGAAAACAAACGTTC
ATAATAAATGAAACTTATAATAAGTCACTGGATGATTTAAACAAAAAAAT
GAGCTCTTAAATTAAATTAAAATATAATTTTGGTTCTTTCAAAGTGATGA
TAAAAATAATTTTATATTTCTCATTCA
back to top

protein sequence of SMED30027333-orf-1

>SMED30027333-orf-1 ID=SMED30027333-orf-1|Name=SMED30027333-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=582bp
MILVLFIFFIFYLGQCTENCRKSDQYCQCDKICVQFGDCCPGHEKFQQTG
SLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSF
AAVMGENKLIYENYYCARCNNIKRYQYFSLSVSCFGHNITNFKQVNEIMI
KSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDI
VSDGRNFYRNDHCCSCRNISCFKQIPLALDVASSAFSFSLNFAAWENEVQ
TKPVPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTT
QSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFF
NLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINV
GSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSV
TCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAIL
SEVDILVRILVVFNSLQGCFLMICFFWAKRVRAILTSTFLSLSNNLSKSS
KTEKSSRTHTTDINDDTVCTKLELKTNVHNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000832GPCR_2_secretin-like
IPR017981GPCR_2-like
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 265..564
e-value: 1.0E-34
score: 121.8
NoneNo IPR availablePANTHERPTHR45902FAMILY NOT NAMEDcoord: 14..223
coord: 277..563
NoneNo IPR availableCDDcd150397tmB3_Methuselah-likecoord: 282..539
e-value: 4.3563E-48
score: 166.631
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.874
NoneNo IPR availableTMHMMTMhelixcoord: 435..457
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 505..527
NoneNo IPR availableTMHMMTMhelixcoord: 282..300
NoneNo IPR availableTMHMMTMhelixcoord: 349..371
NoneNo IPR availableTMHMMTMhelixcoord: 478..500
NoneNo IPR availableTMHMMTMhelixcoord: 384..406
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 280..520
e-value: 4.4E-10
score: 39.3
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 276..529
score: 13.001