Zgc:110410

Overview
NameZgc:110410
Smed IDSMED30027323
Length (bp)1123
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027323

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30027323SMESG000014372.1 Contig5851_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30027323SMESG000014372.1 Contig5851_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30027323SMESG000014372.1 Contig5851_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zgc:110410 vs. Ensembl Human
Match: GRINA (glutamate ionotropic receptor NMDA type subunit associated protein 1 [Source:HGNC Symbol;Acc:HGNC:4589])

HSP 1 Score: 97.4413 bits (241), Expect = 6.194e-22
Identity = 69/264 (26.14%), Postives = 129/264 (48.86%), Query Frame = 1
Query:  232 YLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNAD------ISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            Y   P  P  Y + PQ++        PG  P +  +G    +       +QD     +  K+ R AFI+ V+ +LT+Q+  T+  + +  FV  +K ++       +V   + F+ ++++  C   RRK P N + L   T ++  ++GM+  F  ++ +  ++ +   +     +F  Q +YD T   G L+V +VV   F +  + I   ++ ++Y  +G +L++  L V+TQL+L G     +S  E+VF  LNLY + I+
Sbjct:  104 YPQSPFPPNPYGQ-PQVF--------PGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLL-GNKQLSLSPEEYVFAALNLYTDIIN 357          
BLAST of Zgc:110410 vs. Ensembl Human
Match: GRINA (glutamate ionotropic receptor NMDA type subunit associated protein 1 [Source:HGNC Symbol;Acc:HGNC:4589])

HSP 1 Score: 97.4413 bits (241), Expect = 6.194e-22
Identity = 69/264 (26.14%), Postives = 129/264 (48.86%), Query Frame = 1
Query:  232 YLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNAD------ISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            Y   P  P  Y + PQ++        PG  P +  +G    +       +QD     +  K+ R AFI+ V+ +LT+Q+  T+  + +  FV  +K ++       +V   + F+ ++++  C   RRK P N + L   T ++  ++GM+  F  ++ +  ++ +   +     +F  Q +YD T   G L+V +VV   F +  + I   ++ ++Y  +G +L++  L V+TQL+L G     +S  E+VF  LNLY + I+
Sbjct:  104 YPQSPFPPNPYGQ-PQVF--------PGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLL-GNKQLSLSPEEYVFAALNLYTDIIN 357          
BLAST of Zgc:110410 vs. Ensembl Human
Match: FAIM2 (Fas apoptotic inhibitory molecule 2 [Source:HGNC Symbol;Acc:HGNC:17067])

HSP 1 Score: 93.5893 bits (231), Expect = 6.506e-21
Identity = 59/205 (28.78%), Postives = 111/205 (54.15%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VY +L IQ+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   + + A + +   VF FQ K+D T   G L VLL+     G I+ +LL    V  +  +Y  +G  ++++ L ++TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   99 RRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 302          
BLAST of Zgc:110410 vs. Ensembl Human
Match: FAIM2 (Fas apoptotic inhibitory molecule 2 [Source:HGNC Symbol;Acc:HGNC:17067])

HSP 1 Score: 90.1225 bits (222), Expect = 5.701e-20
Identity = 59/205 (28.78%), Postives = 111/205 (54.15%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VY +L IQ+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   + + A + +   VF FQ K+D T   G L VLL+     G I+ +LL    V  +  +Y  +G  ++++ L ++TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   53 RRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 256          
BLAST of Zgc:110410 vs. Ensembl Human
Match: FAIM2 (Fas apoptotic inhibitory molecule 2 [Source:HGNC Symbol;Acc:HGNC:17067])

HSP 1 Score: 89.3521 bits (220), Expect = 8.987e-20
Identity = 59/205 (28.78%), Postives = 111/205 (54.15%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VY +L IQ+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   + + A + +   VF FQ K+D T   G L VLL+     G I+ +LL    V  +  +Y  +G  ++++ L ++TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   57 RRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 260          
BLAST of Zgc:110410 vs. Ensembl Celegans
Match: tag-120 (pep chromosome:WBcel235:V:9706603:9709814:-1 gene:WBGene00006470.1 transcript:F40F9.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-120)

HSP 1 Score: 60.8474 bits (146), Expect = 2.176e-10
Identity = 62/243 (25.51%), Postives = 116/243 (47.74%), Query Frame = 1
Query:  349 NADISQDSDDVK----FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVF--SLLAFLQILI-IGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVS----FVFGFQNKYDLTYLTGSLIVLLVVALGF----IVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVF 1032
             A  +QD  D K    F S+  R AF++ V+ L+TI    T    VI       ++W+       WV+  +++ FL + I +  C   RR+FP N +LL  FT++      ++T+F+T+     S+++   I  V      +F  + K DLT   G   +L +V   F    ++  L   +  +  +Y  +  +L    L ++ QL++ G   Y +S  +++F  + ++L+ ++  +ML  +F
Sbjct:    6 GATTAQDDPDGKYNLHFSSQTVRAAFVRKVFMLVTIMFAITAAFCVIPMVSEPFQDWVKNN---FWVYFIAIIVFLVVAIALSCCGNLRRQFPVNIILLTIFTLSA----AVMTMFVTACYNVQSVLICLCITTVCSGSVIIFSMKTKSDLTSKMGIAFMLSMVLFSFGIFALIFTLAFNWQFLYSVYSGLAALLMMFYLAIDVQLLMGGRK-YELSPEDYIFAAMEIFLDILNIFLMLLNIF 240          
BLAST of Zgc:110410 vs. Ensembl Celegans
Match: tag-120 (pep chromosome:WBcel235:V:9707771:9709877:-1 gene:WBGene00006470.1 transcript:F40F9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-120)

HSP 1 Score: 60.8474 bits (146), Expect = 2.176e-10
Identity = 62/243 (25.51%), Postives = 116/243 (47.74%), Query Frame = 1
Query:  349 NADISQDSDDVK----FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVF--SLLAFLQILI-IGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVS----FVFGFQNKYDLTYLTGSLIVLLVVALGF----IVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVF 1032
             A  +QD  D K    F S+  R AF++ V+ L+TI    T    VI       ++W+       WV+  +++ FL + I +  C   RR+FP N +LL  FT++      ++T+F+T+     S+++   I  V      +F  + K DLT   G   +L +V   F    ++  L   +  +  +Y  +  +L    L ++ QL++ G   Y +S  +++F  + ++L+ ++  +ML  +F
Sbjct:    6 GATTAQDDPDGKYNLHFSSQTVRAAFVRKVFMLVTIMFAITAAFCVIPMVSEPFQDWVKNN---FWVYFIAIIVFLVVAIALSCCGNLRRQFPVNIILLTIFTLSA----AVMTMFVTACYNVQSVLICLCITTVCSGSVIIFSMKTKSDLTSKMGIAFMLSMVLFSFGIFALIFTLAFNWQFLYSVYSGLAALLMMFYLAIDVQLLMGGRK-YELSPEDYIFAAMEIFLDILNIFLMLLNIF 240          
BLAST of Zgc:110410 vs. Ensembl Celegans
Match: tmbi-4 (Transmembrane BAX inhibitor motif-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q11080])

HSP 1 Score: 60.077 bits (144), Expect = 4.307e-10
Identity = 57/248 (22.98%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  268 RDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDV--KFLSKADRY---AFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLN 996
            R+PQ+W            P ++           D+D +    + KA+R    AF++ V G++  Q+LFT+ I   +  +    N LL +  ++   +LL  + ++I     +  R+ P NY+LL +FT      +G V     +K++  + V+   ++   F +  QNK D +    S+  LL V L   +  +      +  +  V G  L+ V+L+++  +I+     Y  S  +++   ++LY++
Sbjct:   32 RNPQMW------------PMSMASSAHAEAGIVDADGILPGCVGKANRMIRIAFLRKVLGIVGFQLLFTIGICAAIYNIPN-SNQLLQKHAWIVFPNLLGSIALIIA--LHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAYTLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMIM-----YRFSPEDYICACVSLYMD 259          
BLAST of Zgc:110410 vs. Ensembl Celegans
Match: Y42H9AR.2 (pep chromosome:WBcel235:IV:8099918:8101424:1 gene:WBGene00021537.1 transcript:Y42H9AR.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42H9AR.2)

HSP 1 Score: 54.299 bits (129), Expect = 3.989e-8
Identity = 54/250 (21.60%), Postives = 105/250 (42.00%), Query Frame = 1
Query:  319 SPRTLVYGLRNADISQDSDDVK----FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGF--CPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSL----IVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCN 1038
            +P     G  + +     DD+     F  ++ R AF+  V+ L+T+    T     +  +    K W   +  +  V+  +    I  I    C   RR FP N  +L  FT +   +   +T   ++  +  S+++         +F    K DLT   G      I L++  L   +  + + +  + ++Y V+G +L    L ++ QLI+ G  V  IS  E++F   +++++ +   + + GV  N
Sbjct:    8 NPWRHRAGSDDDNEEGPKDDIAVQFGFDDRSIRAAFVAKVFALVTVMFAITAAFSAVPIYNKDFKKWCNQEDHWWCVYVAMGVFFIFYITLMCCGRARRCFPCNLFILTCFTFSAATMTMFITATYSADAVLISLLITTGCSASIILFAATTKKDLTSCLGVAFILGICLMLFGLMACIFCIFLNWQFLYIVYAVLGALLCMFYLAIDIQLIMGGRRVE-ISPEEYIFAATHVFVDILGMFLNILGVVGN 256          
BLAST of Zgc:110410 vs. Ensembl Celegans
Match: xbx-6 (X-BoX promoter element regulated [Source:UniProtKB/TrEMBL;Acc:Q8MQ56])

HSP 1 Score: 50.0618 bits (118), Expect = 1.160e-6
Identity = 50/227 (22.03%), Postives = 113/227 (49.78%), Query Frame = 1
Query:  367 DSDDVK----FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFS-LLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGF-----QNKYDLTYLTGSLIVLLVVALGF----IVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            D+ D K    F  K  R AF++ V+ L+ I +L  V  + ++ +V+     ++ ++  L++ S ++ F+  L +  C   RRKFP N ++   FT+    +  +++    +     ++VL+A  I +   F       Q K+DLT   G ++++ +  + F    ++  +      + M+Y + G ++  + L ++ Q+++ G   Y IS  E++F ++ ++++ + 
Sbjct:   64 DNPDGKYSFQFSDKTVRAAFVRKVFSLVFI-MLCIVAAVTVIPWVHDDTMRMVRRNSALYLGSYVIFFVTYLSLVCCEGVRRKFPVNLIVTGIFTLATSVMTMVISAHHDA-----NVVLLALAICIGCTFSIVIVASQTKFDLTAHMGYILIISMCFMFFGLVVVICSMFFKIKFLMMVYALGGALIMMLYLFLDVQMLMGGKK-YEISPEEYIFASVQIFIDIVQ 283          
BLAST of Zgc:110410 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0089877)

HSP 1 Score: 107.842 bits (268), Expect = 2.952e-26
Identity = 66/228 (28.95%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  322 PRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            P    YG  + D      +  F  ++ R  FI+ VY +L  Q++ T   + +  +    K +        WV   +  + +L +  C   RR+ PTN++ L  FT     ++G+       K +  ++ + A + +   +F  Q KYD T + G LI  +VV L F +  + +   +IT++Y  +G +L+SV L+ +TQL++ G H Y IS  E++F  LNLYL+ I+
Sbjct:   84 PSAGGYGAYD-DPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIIN 310          
BLAST of Zgc:110410 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0089873)

HSP 1 Score: 107.842 bits (268), Expect = 2.952e-26
Identity = 66/228 (28.95%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  322 PRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            P    YG  + D      +  F  ++ R  FI+ VY +L  Q++ T   + +  +    K +        WV   +  + +L +  C   RR+ PTN++ L  FT     ++G+       K +  ++ + A + +   +F  Q KYD T + G LI  +VV L F +  + +   +IT++Y  +G +L+SV L+ +TQL++ G H Y IS  E++F  LNLYL+ I+
Sbjct:   84 PSAGGYGAYD-DPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIIN 310          
BLAST of Zgc:110410 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0089875)

HSP 1 Score: 107.842 bits (268), Expect = 2.952e-26
Identity = 66/228 (28.95%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  322 PRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            P    YG  + D      +  F  ++ R  FI+ VY +L  Q++ T   + +  +    K +        WV   +  + +L +  C   RR+ PTN++ L  FT     ++G+       K +  ++ + A + +   +F  Q KYD T + G LI  +VV L F +  + +   +IT++Y  +G +L+SV L+ +TQL++ G H Y IS  E++F  LNLYL+ I+
Sbjct:   84 PSAGGYGAYD-DPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIIN 310          
BLAST of Zgc:110410 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0089876)

HSP 1 Score: 107.071 bits (266), Expect = 4.607e-26
Identity = 66/228 (28.95%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  322 PRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            P    YG  + D      +  F  ++ R  FI+ VY +L  Q++ T   + +  +    K +        WV   +  + +L +  C   RR+ PTN++ L  FT     ++G+       K +  ++ + A + +   +F  Q KYD T + G LI  +VV L F +  + +   +IT++Y  +G +L+SV L+ +TQL++ G H Y IS  E++F  LNLYL+ I+
Sbjct:   73 PSAGGYGAYD-DPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIIN 299          
BLAST of Zgc:110410 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0309295)

HSP 1 Score: 107.071 bits (266), Expect = 4.607e-26
Identity = 66/228 (28.95%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  322 PRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            P    YG  + D      +  F  ++ R  FI+ VY +L  Q++ T   + +  +    K +        WV   +  + +L +  C   RR+ PTN++ L  FT     ++G+       K +  ++ + A + +   +F  Q KYD T + G LI  +VV L F +  + +   +IT++Y  +G +L+SV L+ +TQL++ G H Y IS  E++F  LNLYL+ I+
Sbjct:   73 PSAGGYGAYD-DPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIIN 299          
BLAST of Zgc:110410 vs. Ensembl Zebrafish
Match: zgc:110410 (zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465])

HSP 1 Score: 115.161 bits (287), Expect = 3.005e-28
Identity = 69/241 (28.63%), Postives = 122/241 (50.62%), Query Frame = 1
Query:  298 TMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
             M  P  +P     G  N +   D+        A R  FI+ VY  L IQ+L TV II    +   + +W+     F +    + F  ++++  C   RRK P N++ L  FTI  GC+LG V V+ +++ + +++   A + +   +F  Q+K+D T  +G +  +      F +   ++    + + Y  +G +++SV L+++TQLIL G H Y IS  E++F  LNLY++ +   ++L
Sbjct:  165 NMGNPDDAPPEYTLGFENENCFSDA--------AIRRGFIRKVYLTLMIQLLITVGIICAFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPEEYIFAALNLYIDIVTIFLLL 397          
BLAST of Zgc:110410 vs. Ensembl Zebrafish
Match: zgc:110410 (zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465])

HSP 1 Score: 110.538 bits (275), Expect = 1.084e-27
Identity = 69/240 (28.75%), Postives = 122/240 (50.83%), Query Frame = 1
Query:  301 MTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
            M  P  +P     G  N +   D+        A R  FI+ VY  L IQ+L TV II    +   + +W+     F +    + F  ++++  C   RRK P N++ L  FTI  GC+LG V V+ +++ + +++   A + +   +F  Q+K+D T  +G +  +      F +   ++    + + Y  +G +++SV L+++TQLIL G H Y IS  E++F  LNLY++ +   ++L
Sbjct:   17 MGNPDDAPPEYTLGFENENCFSDA--------AIRRGFIRKVYLTLMIQLLITVGIICAFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPEEYIFAALNLYIDIVTIFLLL 248          
BLAST of Zgc:110410 vs. Ensembl Zebrafish
Match: zgc:110410 (zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465])

HSP 1 Score: 110.538 bits (275), Expect = 1.084e-27
Identity = 69/240 (28.75%), Postives = 122/240 (50.83%), Query Frame = 1
Query:  301 MTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
            M  P  +P     G  N +   D+        A R  FI+ VY  L IQ+L TV II    +   + +W+     F +    + F  ++++  C   RRK P N++ L  FTI  GC+LG V V+ +++ + +++   A + +   +F  Q+K+D T  +G +  +      F +   ++    + + Y  +G +++SV L+++TQLIL G H Y IS  E++F  LNLY++ +   ++L
Sbjct:   17 MGNPDDAPPEYTLGFENENCFSDA--------AIRRGFIRKVYLTLMIQLLITVGIICAFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPEEYIFAALNLYIDIVTIFLLL 248          
BLAST of Zgc:110410 vs. Ensembl Zebrafish
Match: zgc:110410 (zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465])

HSP 1 Score: 108.612 bits (270), Expect = 2.962e-26
Identity = 70/248 (28.23%), Postives = 124/248 (50.00%), Query Frame = 1
Query:  298 TMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIV-------IMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
             M  P  +P     G  N +   D+        A R  FI+ VY  L IQ+L TV II        I+ +   + +W+     F +    + F  ++++  C   RRK P N++ L  FTI  GC+LG V V+ +++ + +++   A + +   +F  Q+K+D T  +G +  +      F +   ++    + + Y  +G +++SV L+++TQLIL G H Y IS  E++F  LNLY++ +   ++L
Sbjct:  110 NMGNPDDAPPEYTLGFENENCFSDA--------AIRRGFIRKVYLTLMIQLLITVGIICAFLYWFFIIFYRETLSDWVKDTYWFTYTMMGVTFALVIVLVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPEEYIFAALNLYIDIVTIFLLL 349          
BLAST of Zgc:110410 vs. Ensembl Zebrafish
Match: faim2b (Fas apoptotic inhibitory molecule 2b [Source:ZFIN;Acc:ZDB-GENE-120426-3])

HSP 1 Score: 93.5893 bits (231), Expect = 1.886e-21
Identity = 61/207 (29.47%), Postives = 114/207 (55.07%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVV------ALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  FI+ VY +L +Q+  TV +I +  F   ++ ++ T        +LL  +  + +  C   RR+FP N +LL  FT+++ C+LG ++ F  +K +   I + A + +   +F FQ+K D+T   G L +L +V       +GF+V    + +  +  +Y  +G +++++ L  +TQL++ G   Y +S  E+VF TL+LYL+ ++
Sbjct:   46 RRIFIRKVYSILMLQLFSTVAVIALFTFHAPVRMYIQTHPILYSASNLLFLITYISLACCGDLRRQFPWNLILLTVFTLSMACMLGFISSFYNTKAVVLCIGITAVVCLCVTLFSFQSKIDITSYQGLLFILCMVMFFCAIVMGFVVPFGYVPW--LHAVYSSIGAVVFTMFLAFDTQLLM-GNKQYTLSPEEYVFATLSLYLDIVY 249          
BLAST of Zgc:110410 vs. Ensembl Xenopus
Match: grina (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) [Source:NCBI gene;Acc:100145094])

HSP 1 Score: 108.612 bits (270), Expect = 2.179e-26
Identity = 84/315 (26.67%), Postives = 143/315 (45.40%), Query Frame = 1
Query:  142 ESQNPSHSLKKGGIGAPRNL----QMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSD------------DVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVA--LGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVF 1032
            E    + S  +   G P+N      MG    V  Y+  P  P    +DP   +          +P + ++   N+    D++               F   A R AFI+ VY  L +Q+  TV +I +  F   +KNW+      ++       +  L++  C   RRK P N++ L  FT   GC+LG +     +  + ++      + +   +F  Q K+D T L+G L V L+V    G + G+L   Y  + ++Y  +G  ++ + L+V+TQLI+ G H Y +S  E++F  LN+YL+ I+  +ML  +F
Sbjct:    2 EKSGENFSSTQPNYGYPQNPLYPPAMGGGPSVPVYMPPP--PSYSEQDPAALNAQIN------NPSSQIFLEANSYPEHDAEAGPPEYTFGVVGSSPFSESAIRRAFIRKVYLTLAMQLALTVGLICMFIFWKRLKNWVQEYPYIVYALCPAIIILALVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGATIVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMY--LNIVYASIGTFIFGMYLVVDTQLIVGGKHRYAVSPEEYIFAALNIYLDIINLFLMLLQIF 306          
BLAST of Zgc:110410 vs. Ensembl Xenopus
Match: grina (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) [Source:NCBI gene;Acc:100145094])

HSP 1 Score: 108.612 bits (270), Expect = 2.179e-26
Identity = 84/315 (26.67%), Postives = 143/315 (45.40%), Query Frame = 1
Query:  142 ESQNPSHSLKKGGIGAPRNL----QMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSD------------DVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVA--LGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVF 1032
            E    + S  +   G P+N      MG    V  Y+  P  P    +DP   +          +P + ++   N+    D++               F   A R AFI+ VY  L +Q+  TV +I +  F   +KNW+      ++       +  L++  C   RRK P N++ L  FT   GC+LG +     +  + ++      + +   +F  Q K+D T L+G L V L+V    G + G+L   Y  + ++Y  +G  ++ + L+V+TQLI+ G H Y +S  E++F  LN+YL+ I+  +ML  +F
Sbjct:    2 EKSGENFSSTQPNYGYPQNPLYPPAMGGGPSVPVYMPPP--PSYSEQDPAALNAQIN------NPSSQIFLEANSYPEHDAEAGPPEYTFGVVGSSPFSESAIRRAFIRKVYLTLAMQLALTVGLICMFIFWKRLKNWVQEYPYIVYALCPAIIILALVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGATIVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMY--LNIVYASIGTFIFGMYLVVDTQLIVGGKHRYAVSPEEYIFAALNIYLDIINLFLMLLQIF 306          
BLAST of Zgc:110410 vs. Ensembl Xenopus
Match: faim2 (Fas apoptotic inhibitory molecule 2 [Source:NCBI gene;Acc:779810])

HSP 1 Score: 103.219 bits (256), Expect = 1.722e-24
Identity = 80/294 (27.21%), Postives = 139/294 (47.28%), Query Frame = 1
Query:  136 DDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVL-LVVALGFIVGLLLIGYDVIT---MIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            +  S  PS+     G G   +        + Q+  Q   P N    P   SG              +Y      ++  S D    ++  R  FI+ VY +L IQ+L TV ++ +  F + +K ++     + W    + F   L++  C   RRKFP N +LL  FT+++  I GM++ F  +K +   + + A + +   +F FQ+K D T   G L VL +V+    I  ++LI +  I     +Y V+G I++++ L  +TQ+++ G   Y +S  E++F  LN+YL+ I+
Sbjct:   27 NRSSAPPSYEEATAGDGKKADYLQATSPTLSQHSWQHGEPYN---SPDCSSG--------------IYSGDTEMLTTQSWD----NETVRRGFIRKVYAILMIQLLVTVAVVALFTFCDPVKGYIQANPGWYWASYAVFFSTYLVLACCSGPRRKFPWNLILLCIFTLSMAYITGMLSSFYNTKSVILCLGITALVCMSVTLFSFQSKIDFTSCQGVLFVLSMVLLFSGIFLVILIPFQYIPWLHAVYAVIGAIVFTMFLAFDTQMLM-GSRRYSLSPEEYIFGALNIYLDIIY 298          
BLAST of Zgc:110410 vs. Ensembl Xenopus
Match: tmbim1 (transmembrane BAX inhibitor motif containing 1 [Source:NCBI gene;Acc:595060])

HSP 1 Score: 96.6709 bits (239), Expect = 7.051e-22
Identity = 77/286 (26.92%), Postives = 136/286 (47.55%), Query Frame = 1
Query:  202 QMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCNLTQ 1047
            Q G       Y      PE    DP         TIP  +    +Y   N +  +  +   +  KA R+AFI+ VY ++ +Q+L TV II I  +V  + +++       +    + F+  +++  C   RR+FP N +LL  FT+ +  + G +  F +SK +  S+ + A + I+  +F FQ K D T   G   VL +V    G +  ++L    V  + M+Y  +G I++++ L  +TQL++ G   + I+  E+V+  L +Y + ++       +F NL Q
Sbjct:   73 QPGGYPAPSGYPQPGGYPEPGHNDPPKPVMPILPTIPLNTGDGEMY---NTNDGEGGNFGSWDDKAVRHAFIRRVYAIIAVQLLLTVGIIAIFTYVEPVTSFIRRTPGVYYASYAVFFVTYIVLVCCEGPRRRFPWNIILLAIFTLAMAFMAGTIASFYSSKAVLISMGITAIVTIIVTIFCFQTKVDFTSCAGLFAVLGIVMFVTGIVTAIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQLVI-GNRKHTINPEEYVYGALKIYTDIVY-------IFLNLLQ 347          
BLAST of Zgc:110410 vs. Ensembl Xenopus
Match: tmbim1 (transmembrane BAX inhibitor motif containing 1 [Source:NCBI gene;Acc:595060])

HSP 1 Score: 87.0409 bits (214), Expect = 1.580e-18
Identity = 75/286 (26.22%), Postives = 133/286 (46.50%), Query Frame = 1
Query:  202 QMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCNLTQ 1047
            Q G       Y      PE    DP         TIP  +    +Y   N +  +  +   +  KA R+AFI+ VY ++ +Q+L TV II I  +V  + +++       +    + F+  +++  C   RR+FP N +LL  F +    +  +   F +SK +  S+ + A + I+  +F FQ K D T   G   VL +V    G +  ++L    V  + M+Y  +G I++++ L  +TQL++ G   + I+  E+V+  L +Y + ++       +F NL Q
Sbjct:   55 QPGGYPAPSGYPQPGGYPEPGHNDPPKPVMPILPTIPLNTGDGEMY---NTNDGEGGNFGSWDDKAVRHAFIRRVYAIIAVQLLLTVGIIAIFTYVEPVTSFIRRTPGVYYASYAVFFVTYIVLVCCEGPRRRFPWNIILLAIFYV----VFSLYCSFYSSKAVLISMGITAIVTIIVTIFCFQTKVDFTSCAGLFAVLGIVMFVTGIVTAIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQLVI-GNRKHTINPEEYVYGALKIYTDIVY-------IFLNLLQ 325          
BLAST of Zgc:110410 vs. Ensembl Mouse
Match: Tmbim7 (transmembrane BAX inhibitor motif containing 7 [Source:MGI Symbol;Acc:MGI:1922305])

HSP 1 Score: 98.5969 bits (244), Expect = 5.998e-23
Identity = 75/287 (26.13%), Postives = 143/287 (49.83%), Query Frame = 1
Query:  181 IGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGA----SPRTL----VYGLR-NADISQDSDDVK----FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAI 1002
            +  P N   G     Q  ++   +  N  R  Q ++ +S   +  A     PR       Y ++ + D++  ++ V     F + + R  FI  V+ +L+IQ+  T  II I  F   ++ W++ +  FL+       + I ++  C   RR+ P NY+LL  FTI  G +LG ++VF  ++ + ++      + +V  +F  Q K+D T L G + V   V L + +  L+I    + ++Y  +G +L+S+ L+++ Q+++ G + Y I+  E++F  LN+Y++ I
Sbjct:    7 VSEPVNFSSGDH---QHLVHTAAIKGNTGRLDQPFTASSGDRVQEAVQYSHPRNRDGANTYAVQVSEDVTPSNETVNQSIPFENTSIRNDFIMKVFVVLSIQLFITAVIIGIFVFCEPVRKWVIAKPWFLYALLPAVMILIFVLACCRDIRRQVPANYILLAFFTILEGLLLGSLSVFYRAEEILWAAGATTMVTLVLTLFALQTKWDFTLLNGVMFVFTSVLLIYGIIALVIRSYWLHLVYSALGTLLFSIYLVMDVQMMVGGRYHYEINPEEYIFAALNIYVDII 290          
BLAST of Zgc:110410 vs. Ensembl Mouse
Match: Faim2 (Fas apoptotic inhibitory molecule 2 [Source:MGI Symbol;Acc:MGI:1919643])

HSP 1 Score: 96.6709 bits (239), Expect = 3.533e-22
Identity = 72/285 (25.26%), Postives = 135/285 (47.37%), Query Frame = 1
Query:  169 KKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLL---LIGYDVIT---MIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            K  G    ++   G++K      + P   E       L +GT     P A P    +   +    +      +  +  R  FI+ VY +L +Q+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   +V+ A + +   +F FQ K+D T   G L VLL+    F  GLL   L+ +  +     +Y V+G  ++++ L  +TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   11 KAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQG-PTAVPLHPSWAYVDPRHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTL--FFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 291          
BLAST of Zgc:110410 vs. Ensembl Mouse
Match: Faim2 (Fas apoptotic inhibitory molecule 2 [Source:MGI Symbol;Acc:MGI:1919643])

HSP 1 Score: 93.2041 bits (230), Expect = 5.731e-21
Identity = 63/217 (29.03%), Postives = 115/217 (53.00%), Query Frame = 1
Query:  373 DDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLL---LIGYDVIT---MIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            DD K      R  FI+ VY +L +Q+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   +V+ A + +   +F FQ K+D T   G L VLL+    F  GLL   L+ +  +     +Y V+G  ++++ L  +TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   95 DDQKV-----RRLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTL--FFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 303          
BLAST of Zgc:110410 vs. Ensembl Mouse
Match: Tmbim1 (transmembrane BAX inhibitor motif containing 1 [Source:MGI Symbol;Acc:MGI:1916910])

HSP 1 Score: 88.5817 bits (218), Expect = 2.200e-19
Identity = 62/226 (27.43%), Postives = 118/226 (52.21%), Query Frame = 1
Query:  349 NADISQDSDDVK---FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            N +    SD  +   +  +  R++FI+ VY ++++Q+L TV II I  FV  +  ++       +V   +  +  L +  C   RR+FP N +LL  FT+ +G + G ++    +K +  ++++ A + I   +F FQ K D T  TG   VL +V +  G +  ++LI   +  + M+Y  +G I +++ L  +TQL+L G   + IS  +++   L +Y + ++
Sbjct:   72 NEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTFVEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWNIILLTIFTLALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLVL-GNRKHTISPEDYITGALQIYTDIVY 296          
BLAST of Zgc:110410 vs. Ensembl Mouse
Match: Tmbim1 (transmembrane BAX inhibitor motif containing 1 [Source:MGI Symbol;Acc:MGI:1916910])

HSP 1 Score: 88.5817 bits (218), Expect = 2.200e-19
Identity = 62/226 (27.43%), Postives = 118/226 (52.21%), Query Frame = 1
Query:  349 NADISQDSDDVK---FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            N +    SD  +   +  +  R++FI+ VY ++++Q+L TV II I  FV  +  ++       +V   +  +  L +  C   RR+FP N +LL  FT+ +G + G ++    +K +  ++++ A + I   +F FQ K D T  TG   VL +V +  G +  ++LI   +  + M+Y  +G I +++ L  +TQL+L G   + IS  +++   L +Y + ++
Sbjct:   72 NEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTFVEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWNIILLTIFTLALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLVL-GNRKHTISPEDYITGALQIYTDIVY 296          
BLAST of Zgc:110410 vs. UniProt/SwissProt
Match: sp|Q7Z429|LFG1_HUMAN (Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.974e-21
Identity = 69/264 (26.14%), Postives = 129/264 (48.86%), Query Frame = 1
Query:  232 YLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNAD------ISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            Y   P  P  Y + PQ++        PG  P +  +G    +       +QD     +  K+ R AFI+ V+ +LT+Q+  T+  + +  FV  +K ++       +V   + F+ ++++  C   RRK P N + L   T ++  ++GM+  F  ++ +  ++ +   +     +F  Q +YD T   G L+V +VV   F +  + I   ++ ++Y  +G +L++  L V+TQL+L G     +S  E+VF  LNLY + I+
Sbjct:  104 YPQSPFPPNPYGQ-PQVF--------PGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLL-GNKQLSLSPEEYVFAALNLYTDIIN 357          
BLAST of Zgc:110410 vs. UniProt/SwissProt
Match: sp|Q1LZ71|LFG2_BOVIN (Protein lifeguard 2 OS=Bos taurus OX=9913 GN=FAIM2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.508e-21
Identity = 77/287 (26.83%), Postives = 137/287 (47.74%), Query Frame = 1
Query:  208 GKQKRVQQYLNQPVVPENYARDPQLWSGTSTMT-----IPGASP--RTLVYGLRNADISQDSD----DVKFLS------KADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            G+Q+   +    P VP       +  SG           P A P   +  Y   N+  S +S     D +F +      +  R  FI+ VY +L IQ+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   + + A + +   VF FQ K+D T   G L VLL+     G I+ +LL    V  +  +Y V+G  ++++ L  +TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   17 GQQQANGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPAPSAVPLHPSWAYVDPNSSSSYESGFPTGDHEFFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLGVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLSITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLM-GSRRHSLSPEEYIFGALNIYLDIIY 302          
BLAST of Zgc:110410 vs. UniProt/SwissProt
Match: sp|Q9BWQ8|LFG2_HUMAN (Protein lifeguard 2 OS=Homo sapiens OX=9606 GN=FAIM2 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.125e-20
Identity = 59/205 (28.78%), Postives = 111/205 (54.15%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VY +L IQ+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   + + A + +   VF FQ K+D T   G L VLL+     G I+ +LL    V  +  +Y  +G  ++++ L ++TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   99 RRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 302          
BLAST of Zgc:110410 vs. UniProt/SwissProt
Match: sp|Q8K097|LFG2_MOUSE (Protein lifeguard 2 OS=Mus musculus OX=10090 GN=Faim2 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.009e-20
Identity = 63/217 (29.03%), Postives = 115/217 (53.00%), Query Frame = 1
Query:  373 DDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLL---LIGYDVIT---MIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            DD K      R  FI+ VY +L +Q+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   +V+ A + +   +F FQ K+D T   G L VLL+    F  GLL   L+ +  +     +Y V+G  ++++ L  +TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   95 DDQKV-----RRLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTL--FFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 303          
BLAST of Zgc:110410 vs. UniProt/SwissProt
Match: sp|Q5R4I4|LFG2_PONAB (Protein lifeguard 2 OS=Pongo abelii OX=9601 GN=FAIM2 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.539e-19
Identity = 58/205 (28.29%), Postives = 110/205 (53.66%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VY +L IQ+L T+ ++ +  F + +K+++     + W    + F   L +  C   RR FP N +LL  FT+++  + GM++ +  +  +   + + A + +   VF FQ K+D T   G L VL +     G I+ +LL    V  +  +Y  +G  ++++ L ++TQL++ G   + +S  E++F  LN+YL+ I+
Sbjct:   99 RRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLPMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIY 302          
BLAST of Zgc:110410 vs. TrEMBL
Match: A0A1I8PBL0 (Uncharacterized protein OS=Stomoxys calcitrans OX=35570 GN=106085526 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.783e-30
Identity = 76/217 (35.02%), Postives = 125/217 (57.60%), Query Frame = 1
Query:  361 SQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGY--DVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            S   ++ +F   + R  FIK VY +L  Q+L T+ ++      +A  +++      L V  ++ F+ ++I+  C I RRK P NY+ L  FT     +LG++     ++ +  ++ L A I IV  ++  Q K D T + G L+V L+V  G + G+L+I +  DV+ MIYC +GV+LYS+ L+ +TQL++ G H Y IS +EH+F  LNLY++ I 
Sbjct:    8 SASPNNTEFEDDSMRRKFIKKVYMILAAQLLLTLGLVSFFVTSDAFLDYVEENPFLLLVAMVVLFVTMIILACCSIVRRKAPMNYMCLAIFTFAQSFLLGVIGARYDARSILLTVALTALICIVLSLYAMQTKVDFTMMGGFLLVCLIV--GLVFGILMIFFYSDVMMMIYCSLGVVLYSIFLIYDTQLMVGGNHAYSISPDEHIFAALNLYVDIIQ 222          
BLAST of Zgc:110410 vs. TrEMBL
Match: A0A310SL60 (Protein lifeguard 1 OS=Eufriesea mexicana OX=516756 GN=WN48_01770 PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.546e-29
Identity = 75/234 (32.05%), Postives = 127/234 (54.27%), Query Frame = 1
Query:  313 GASPRTLVYGLRNADISQDSDDVK---FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            GA P+  +YG   AD    S+D+K   F  K+ R  FI+ VY +L  Q+L T+ +IV+  +     N+++      W+      + I+ +  C   RRK P N++ L  FTI  G +L  V    +S+ +  ++ + A I +   +F FQ K+D T L   L V L+V + F +   L    +IT++Y  +G +L+S+ L+ +TQ+++ G H Y IS  E++F  LNLY++ ++
Sbjct:   67 GAGPQPAMYGSNYADDPMQSNDIKAFEFNEKSIRNGFIRKVYSILMCQLLITLSMIVLFLYHRPTHNFVMAHPELFWICFAATIVLIICMACCTSVRRKAPMNFIFLFIFTIAEGFLLATVASTYSSEEVLLAVGITAVICLALTLFAFQTKFDFTGLNSILFVALIVLVLFGIIAALWPGKIITVVYASLGALLFSIYLIYDTQMMMGGSHKYAISPEEYIFAALNLYIDIVN 300          
BLAST of Zgc:110410 vs. TrEMBL
Match: A0A5N5Q605 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00002970 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.548e-29
Identity = 78/261 (29.89%), Postives = 132/261 (50.57%), Query Frame = 1
Query:  241 QPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKAD-RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
             P  P+ Y    + +      T+   S           + +Q  +DV   S+A  R  FI+ VY  L +Q+L TV II    +   +K+W++  S F +       + ++++  C   RRK P N+  L  FT+  G +LG VTVF  ++ + +++   A +     VF  Q+K+D T ++GSL VL      F +   ++    + + Y  VG +++SV L+++TQL+L G H Y IS  E++F  LNLYL+ +   +M+
Sbjct:   17 NPTYPQPYTHGARNFGEAGISTVTQCSNNVGTADGMPPEYTQCFEDVNCFSEASVRRGFIRKVYLTLMVQLLITVGIICAFLYWETLKSWVIRTSWFAYTMMGTTLVLVIVLSCCGDVRRKVPVNFFFLGLFTVAEGMLLGSVTVFFNAEAVLWAVGATALVSFGLSVFAMQSKWDFTTISGSLWVLCWTLFSFGLLCAIMRSQFLYIAYASVGTLIFSVYLVMDTQLMLGGKHKYTISAEEYIFAALNLYLDIVTIFLMI 277          
BLAST of Zgc:110410 vs. TrEMBL
Match: A0A423SH96 (Uncharacterized protein OS=Penaeus vannamei OX=6689 GN=C7M84_018555 PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.080e-28
Identity = 76/217 (35.02%), Postives = 119/217 (54.84%), Query Frame = 1
Query:  355 DISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            DI  +     F  K+ R  FI+ VY +L  Q+L T  ++ +  +V A+ ++ L     LWV   L F  ++ +  C   RRK P NY+ L  FTI+   +LG+V+     K +  +IV  A + +V  +F FQ KYD T + G ++V L V L F +   +    ++ M+Y  +GV+L+S  L+ +TQLI+ G H +  S  E+VF  LNLYL+ I+
Sbjct:    3 DIEAEDATFAFSEKSIRMGFIRKVYAILCTQLLITFGLVAVFVWVPAVNDYALKNQWMLWVAIGLTFTMVIALSCCGNLRRKSPHNYIALFVFTISEAYLLGVVSASYQGKEVAIAIVATAVVTLVLTLFAFQTKYDFTMMGGFVLVSLTVLLIFGILAAIWSNQIVNMVYACLGVLLFSFYLVFDTQLIIGGNHKFAYSPEEYVFAALNLYLDIIN 219          
BLAST of Zgc:110410 vs. TrEMBL
Match: A0A267FI04 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028790g2 PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 3.094e-28
Identity = 71/214 (33.18%), Postives = 126/214 (58.88%), Query Frame = 1
Query:  367 DSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSL-LAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            D+ +++F  ++ R  F++ VYG+LT+Q++ T+  I +  F   IK + +    +L++ +L L  + ++++  C   RRKFP N +LL  FT+    +LG ++    +  +F +I +  FI+    +F  Q K D TYL+G L VLL+  + F +   ++     T+ Y  +G +L+SV L+V+TQ++L G H Y +S  E+VF  LNLYL+ ++
Sbjct:   19 DNGNMQFNEESIRKGFVRKVYGILTVQLVVTMGFIALFVFCQPIKQYAIRND-WLYILALVLTIILVIVLACCEDVRRKFPVNLILLGLFTLCESYMLGSISARFDTDAVFMAIGVTVFIVFALTLFAMQTKIDFTYLSGILFVLLIALILFGLLCAIVQNRFATLAYACLGALLFSVYLVVDTQMMLGGKHKYSLSPEEYVFAALNLYLDIVN 231          
BLAST of Zgc:110410 vs. Ensembl Cavefish
Match: zgc:110410 (protein lifeguard 1-like [Source:NCBI gene;Acc:111193442])

HSP 1 Score: 121.324 bits (303), Expect = 3.472e-31
Identity = 74/225 (32.89%), Postives = 127/225 (56.44%), Query Frame = 1
Query:  355 DISQDSDDVKFLSKAD-RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSL--IVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
            D +Q  +D+   S+A  R AF++ VY  L +Q+L TV II    + + ++ W      F +       + I+++  C   RRK P N++ L  FTIT G +LG VTVF +++ + +++   A +     +F  Q+K+D T  +GS+  I   +V+ G +  +L   Y  + ++Y  +G +++S+ L+++TQLIL G H Y IS  E++F  LNLYL+ I   +M+
Sbjct:   91 DYTQAFEDMNCFSEAVIRRAFVRKVYLTLVVQLLITVGIICAFIYWDTLRKWARGTPWFTYAMMAATLVLIVVLSCCGDVRRKVPLNFIFLGLFTITEGLLLGSVTVFYSAEAVLWAVGATALVSFALSLFAMQSKWDFTAASGSIWAICWTLVSFGLLCAILRSQY--LYIVYASLGTLVFSIYLVMDTQLILGGKHKYSISPEEYIFAALNLYLDIITIFLMI 313          
BLAST of Zgc:110410 vs. Ensembl Cavefish
Match: grinab (protein lifeguard 1-like [Source:NCBI gene;Acc:103028312])

HSP 1 Score: 96.6709 bits (239), Expect = 4.037e-22
Identity = 84/317 (26.50%), Postives = 143/317 (45.11%), Query Frame = 1
Query:   82 KPSNVSNALAPYTSIYVLD--DESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYAR---DPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVK---FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILI-IGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
             P   S    P    +VL   D +  P+     GG+  P     G+    Q     P  P  +      PQ    +       + P +  Y   +   + D DD++   F  KA R AFI+ V+ +LT Q++ T   + +  F   IK ++  Q+ + +  S   F+  LI I  C   RRK P N + L   T+++  + GM+  F  +  +  ++ +   +     +F  Q+KYD T   G L V ++V   F +  + I   ++ ++Y  +G ++++  L V+TQL+L G     +S  E+VF  LNLYL+ I+
Sbjct:   15 SPQQGSGFGQPNPPGFVLPPPDYAGMPAGPGAPGGLPFPTPGAFGQPMYGQGAPGFPQAPFPHMAPYGQPQNQGPSQPYQYHPSEPMSDPYQSTDEPPAYDHDDIRISGFDDKAVRRAFIRKVFLVLTAQLVVTFSFVALFTFEKNIKTFV-QQNVWTYYVSYAVFIIPLIAISCCGEFRRKHPWNLVALSILTLSMSYMTGMIASFYDTDTVVMAVGITVVVCFTVVIFSMQSKYDFTSCMGVLFVCVIVLFVFGILCIFIRNKILDIVYASLGALVFTCFLAVDTQLLL-GNKKLSLSPEEYVFGALNLYLDIIN 329          
BLAST of Zgc:110410 vs. Ensembl Cavefish
Match: grinaa (glutamate ionotropic receptor NMDA type subunit associated protein 1 [Source:NCBI gene;Acc:103028129])

HSP 1 Score: 93.9745 bits (232), Expect = 4.306e-21
Identity = 57/205 (27.80%), Postives = 112/205 (54.63%), Query Frame = 1
Query:  391 SKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
             K+ R AFI+ V+ +LT+Q++ T   + +  F N +K ++       +V  ++ F+ ++ +  C   RRK P N + L   T+++  ++GM+  F  +  +  ++ + + +     +F  Q+KYD T   G L V L+V + F    ++I + ++ ++Y  +G +L++  L V+TQL+L G     +S  E++F  LNLY + I+
Sbjct:  138 DKSIRQAFIRKVFMVLTVQLMVTFSFVAVFTFSNDVKLFVRQNRWTYYVSYVVFFVSLIALSCCGEFRRKHPWNLVALSILTLSLSYMVGMIASFYNTDSVIIAVGITSVVCFSVVIFSLQSKYDFTSCRGVLFVCLIVLILFSFLCMVIRHKILHIVYASLGALLFTCFLAVDTQLLL-GNKKLALSPEEYIFAALNLYTDIIN 341          
BLAST of Zgc:110410 vs. Ensembl Cavefish
Match: tmbim1b (protein lifeguard 3-like [Source:NCBI gene;Acc:111197343])

HSP 1 Score: 92.8189 bits (229), Expect = 6.620e-21
Identity = 82/302 (27.15%), Postives = 145/302 (48.01%), Query Frame = 1
Query:  139 DESQNPSHSLKKGGIGAPRNL-QMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSD---DVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
            +E+ +  +   + G G P        Q  V     QP V  + +  P    G     +P   P  +  G+ ++D     D   D  + S++ R+AFI+ VY +L  Q+  T  I+ +  FV+ ++ +++      W    + F+  L++  C   RR+ P N LLL  FT+ +  + G +  +  +K +F ++ + A + I   +F FQ K D T  TG L VL VV L  G I  ++L    V  + M+Y  +G I Y++ L   TQ+++ G   + +S  E+++  L+LY++ +   I L
Sbjct:   11 EEAAHHQYGAPQQGAGYPYTAYGYPPQPVVYGGQEQPGV--HPSAGPWYGQGYPASGMPSFIPAYVPSGMPSSDPEVREDYAADGLWESRSVRHAFIRKVYLILAAQLTVTASIVAVFTFVDPVRLFVIKYPAIYWASFAVYFVTYLVLVCCEKPRRRVPWNLLLLFVFTLAMSYMTGTLASYFDTKAVFLALGITAVVCIAVTIFSFQTKVDFTSCTGLLCVLGVVVLVTGIITTIVLSFQYVPWLHMLYAAIGAIAYTLFLAYHTQVLI-GNRSHTLSPEEYIYAALSLYVDIVQIFIFL 309          
BLAST of Zgc:110410 vs. Ensembl Cavefish
Match: tmbim1b (protein lifeguard 3-like [Source:NCBI gene;Acc:111197343])

HSP 1 Score: 92.8189 bits (229), Expect = 6.620e-21
Identity = 82/302 (27.15%), Postives = 145/302 (48.01%), Query Frame = 1
Query:  139 DESQNPSHSLKKGGIGAPRNL-QMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSD---DVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
            +E+ +  +   + G G P        Q  V     QP V  + +  P    G     +P   P  +  G+ ++D     D   D  + S++ R+AFI+ VY +L  Q+  T  I+ +  FV+ ++ +++      W    + F+  L++  C   RR+ P N LLL  FT+ +  + G +  +  +K +F ++ + A + I   +F FQ K D T  TG L VL VV L  G I  ++L    V  + M+Y  +G I Y++ L   TQ+++ G   + +S  E+++  L+LY++ +   I L
Sbjct:   11 EEAAHHQYGAPQQGAGYPYTAYGYPPQPVVYGGQEQPGV--HPSAGPWYGQGYPASGMPSFIPAYVPSGMPSSDPEVREDYAADGLWESRSVRHAFIRKVYLILAAQLTVTASIVAVFTFVDPVRLFVIKYPAIYWASFAVYFVTYLVLVCCEKPRRRVPWNLLLLFVFTLAMSYMTGTLASYFDTKAVFLALGITAVVCIAVTIFSFQTKVDFTSCTGLLCVLGVVVLVTGIITTIVLSFQYVPWLHMLYAAIGAIAYTLFLAYHTQVLI-GNRSHTLSPEEYIYAALSLYVDIVQIFIFL 309          
BLAST of Zgc:110410 vs. Ensembl Sea Lamprey
Match: faim2a (Fas apoptotic inhibitory molecule 2a [Source:ZFIN;Acc:ZDB-GENE-050320-88])

HSP 1 Score: 90.8929 bits (224), Expect = 4.733e-21
Identity = 65/242 (26.86%), Postives = 119/242 (49.17%), Query Frame = 1
Query:  319 SPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLV--VALGFIVGLLL-IGY-DVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVF 1032
            SP    Y   +++I        +  K  R  FI+ VY +L +Q+L T  I+ I      +  ++       W    +  +  L++  C   RR+FP N +LL  FT+ +  + G +  F +++ +     + A +     +F FQ K+D T   G L VLL+  V  G +  + +  GY   + ++Y  +G +++++ L  +TQL++ G   Y IS  EH+F +LNLY++ ++  + L  +F
Sbjct:   62 SPSYTPYTDTSSNIGDSFSSNTWEDKNLRRVFIRKVYAILMLQLLVTFGIVAIFTLCEPVGYYVKRNPILYWSSYAVFLVTYLVLACCKEPRRRFPLNIILLSIFTLAMSYMTGTLASFYSTRSVMLCFGITALVCFSVTIFCFQTKFDFTTCHGLLFVLLMALVLTGLVAAIAVPFGYMPWLHVVYGGLGAVVFTLFLAYDTQLLI-GNRRYAISPEEHIFASLNLYMDLVYIFMFLLQIF 302          
BLAST of Zgc:110410 vs. Ensembl Sea Lamprey
Match: faim2a (Fas apoptotic inhibitory molecule 2a [Source:ZFIN;Acc:ZDB-GENE-050320-88])

HSP 1 Score: 82.4185 bits (202), Expect = 1.405e-18
Identity = 59/207 (28.50%), Postives = 110/207 (53.14%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLI-----GY-DVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VY +L +Q+L T  I+ +  F  +++ ++       W    + F+  L++  C   RR FP NY+LL  FT+ +  + GM+  + ++K +   + + A +     +F FQ K+D T   G + VL +  L  + GL+ +     GY   I  +Y  +G +++++ L  +TQL+L G   + IS  EHV+  L+LY++ ++
Sbjct:   10 RRVFVRKVYTILMLQLLVTFGIVAVFTFNESVERFVRRTPAIYWTSYGVFFVTYLVLICCTKARRMFPLNYILLSVFTLAMAYMTGMLASYYSTKSVLMCLGITAMVCAAVTLFCFQTKFDFTSCHGLMFVLSMALL--LTGLVAVFTVPFGYIPWIQTVYAGLGAVVFTLFLAFDTQLLL-GNRRHSISPEEHVYGALSLYMDIVY 213          
BLAST of Zgc:110410 vs. Ensembl Sea Lamprey
Match: grinaa (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1a (glutamate binding) [Source:ZFIN;Acc:ZDB-GENE-060616-231])

HSP 1 Score: 78.9518 bits (193), Expect = 4.735e-17
Identity = 60/235 (25.53%), Postives = 115/235 (48.94%), Query Frame = 1
Query:  310 PGASPRTLVYGLRNADISQDSDDVK---FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            P  +P    +   +  I  D++D     +  K  R AFI+ VY +LT Q+                  ++ +     +    + F+ ++ +  C   RRK P N + L   T+ +  ++GM+  F  +  +  ++ +   + +   +F  Q KYD T   G L+V+LVV + F +  +++   ++ ++Y  +G +L++V L V+TQL++ G H Y +S  E++F  LNLY + I+
Sbjct:   38 PAPAP---AFNDEHPPIYHDNEDFNISDWTDKTVRRAFIRKVYLVLTAQL----------------PTYVKSTPGLYYASYAVFFVCLIALSCCGEFRRKHPWNIITLSILTLCMSYMVGMIATFYEADAVVMAMGITVAVCVAVILFSMQTKYDFTSCNGVLLVMLVVLMLFSILCIILRNHILNIVYGALGALLFTVFLAVDTQLLM-GNHKYALSPEEYIFAALNLYTDVIN 252          
BLAST of Zgc:110410 vs. Ensembl Sea Lamprey
Match: faim2a (Fas apoptotic inhibitory molecule 2a [Source:ZFIN;Acc:ZDB-GENE-050320-88])

HSP 1 Score: 64.6994 bits (156), Expect = 2.135e-12
Identity = 59/205 (28.78%), Postives = 97/205 (47.32%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVAL--GFIVGLLL-IGY-DVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R+     VY +L +Q+L T   + +  FV  +K ++       W    + F   L +  C   RR FP N++LL   T+ +  + GM+  F  +  +   I + A +     +F FQ K D T   G +  L +V L  G I    +  GY   I  +Y  +G ++++V L V+TQL+L G     IS  EH+   L LY++ ++
Sbjct:    2 RHICAPQVYIILFVQLLVTFGFVAVCTFVVPVKTFVQKNPAMYWASYGVFFATYLGLVCCTKARRLFPLNFILLAVLTLAMSYLTGMLASFYNTNSVLMCIGVTAAVCGAVTLFCFQTKVDFTSCPGVMFALSMVLLLTGLIAAFTVPFGYIPWIQTVYAGLGAVIFTVFLAVDTQLLL-GNRRNSISPEEHINGALRLYMDIVY 205          
BLAST of Zgc:110410 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002320.1 (pep scaffold:Pmarinus_7.0:GL476639:16633:21901:-1 gene:ENSPMAG00000002114.1 transcript:ENSPMAT00000002320.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.434e-11
Identity = 31/94 (32.98%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  715 AFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLN 996
            AFI +   +F FQ K D T  +G + V L+  L F +   ++  D   + Y  +G ++++V L+++TQL++ G H Y ++  E++F  LNLY++
Sbjct:   43 AFISLGLTIFSFQTKIDFTMKSGIMFVFLMALLSFGLMCAILRSDWANIAYATLGALVFAVYLVIDTQLMMGGKHRYSLNPEEYIFAALNLYID 136          
BLAST of Zgc:110410 vs. Ensembl Nematostella
Match: EDO37574 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG5])

HSP 1 Score: 93.5893 bits (231), Expect = 3.467e-22
Identity = 64/221 (28.96%), Postives = 118/221 (53.39%), Query Frame = 1
Query:  349 NADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYD--VITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
             AD     + + F   + R  FI+ VY +L  Q+  T+  I    +   ++ + ++     +    + F+ ++ +  C   RRKFPTN L L  FT+  G +LG V+    +  +  ++ + A +++   +F FQ KYD T + G L V L+V + F  G L I +   V+ ++Y  +G +L+++ L+ +TQ+++ G  +Y IS  E++F  LNLYL+ ++
Sbjct:   15 GADDPFADNSMAFSDISIRAGFIRKVYSILLCQLAVTISFICFFLYCEPVRLYAVSHPGIFYGALAVTFVTMIAMACCEGVRRKFPTNLLFLTLFTLCEGYLLGAVSSVYKADEVLMAVGITAVVVLAITIFAFQTKYDFTMMGGFLFVALIVLICF--GFLAIFFHNRVVQIVYASLGALLFALYLVYDTQIMMGGGKMYSISPEEYIFAALNLYLDIVN 233          
BLAST of Zgc:110410 vs. Ensembl Nematostella
Match: EDO49375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG77])

HSP 1 Score: 75.485 bits (184), Expect = 2.815e-15
Identity = 84/317 (26.50%), Postives = 141/317 (44.48%), Query Frame = 1
Query:  127 YVLDDESQNPSHSLKKGGIGAP---RNLQMGKQKRVQQYLNQPVVPENY-ARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQ----SCFLWVFSLLAFLQILI-IGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALG------FIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVF 1032
            Y    +S  P++    GG G P     +Q G Q         P  PE+Y A  P   S  S +  P   P +  YG    D+ +    V F  K+ R  FI+ VY +L IQ+  TV  I +  F   ++N++  +    +  ++V + + F  +   I  C   RRK+P N + L  FT+ +  ++G ++ +  + I+   + +   + +   +F  Q KYD T   G   VL   AL       F    LL+      ++   V  +++   L  +TQLI+ G   Y +S  E++F  L LY++ I   ++L  +F
Sbjct:   11 YGGQPQSAQPAYP-PPGGYGNPVYPPPVQPGYQPPPSTGYQPP--PESYPASFPPPPSYDSAIAKPLEQPSS--YG-DGYDV-EYGGAVSFSDKSIRMGFIRRVYFILMIQLSVTVATICLFLFYKPVRNFVHGKHGAGNTVVYVSAFVVFFVLYFVIACCESVRRKYPVNLICLAIFTLALSYLVGTISSYHDTNIVLIMMGVTTLVCLSVMIFSCQTKYDFTTWGG---VLFCAALAIFFLSIFTPVWLLLNTTAGKIVLGGVLALVFVAFLAYDTQLIMGG-KKYELSPEEYIFGALTLYMDIIRIFLLLLALF 316          
BLAST of Zgc:110410 vs. Ensembl Nematostella
Match: EDO48159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF0])

HSP 1 Score: 63.929 bits (154), Expect = 7.216e-12
Identity = 53/204 (25.98%), Postives = 106/204 (51.96%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFI-VGLLLIGY--DVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            R  F++ VYG+L+ Q+  T+ +  +     AIK+++ ++   L+V  +L+F  ++ + F    RR+ P N  LL  FT+     LG +  F    I+  +  + A   I   ++  Q+K D +     L  +L +   FI  GLL + +  D++ + Y V+G +L+S  ++ +T +++       +S  E++  ++NLY++ I+
Sbjct:   22 RLGFLRKVYGILSAQLGLTILVSALFMSTPAIKDFVQSRPEVLFVAFILSFGFLIALMF---KRRESPMNMYLLFGFTLVEAYTLGTLVTFFDRMIVLEAFGMTAATTIALTMYTLQSKRDYSSWGAGLFTMLWI---FIWAGLLQMFFQSDILELAYAVLGALLFSAFIVFDTHMLMNK-----MSPEEYILASINLYMDIIN 214          
BLAST of Zgc:110410 vs. Ensembl Medaka
Match: grinaa (protein lifeguard 1 [Source:NCBI gene;Acc:101164659])

HSP 1 Score: 98.9821 bits (245), Expect = 6.625e-23
Identity = 79/271 (29.15%), Postives = 131/271 (48.34%), Query Frame = 1
Query:  211 KQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKAD---RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVF--SLLAFLQILI-IGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
             Q   QQ   QP  P     DP        M +P  SP    Y         D+D+ K     D   R AFI+ V+ +LT+Q++ T   + I  F +  K ++       WV+  S  +FL  LI +  C   RRK+P N++ L   T+++  ++GM+  F  ++ +  ++ + A +     +F  Q KYD T   G L V L+V + F +  + I   ++ ++Y  +G +L++  L V+TQL+L G     +S  E++F  LNLY + I+
Sbjct:   79 PQGPYQQGFGQPGFPV----DP--------MGVPADSP---AYHDDGPPSYGDNDEFKIGGLEDKTVRRAFIRKVFLVLTVQLVVTFSFVAIFTFSDDAKIFVRRNP---WVYYTSYASFLVCLIALSCCGDFRRKYPGNFIALGILTLSLSYMVGMIASFYDTETVIIAVGITAGVCFTVVLFSLQTKYDFTSCRGVLFVCLIVLMIFSILCIFIRNKIMHLVYASLGALLFTCFLAVDTQLLL-GNKNLALSPEEYIFAALNLYTDIIN 330          
BLAST of Zgc:110410 vs. Ensembl Medaka
Match: tmbim1a (transmembrane BAX inhibitor motif containing 1 [Source:NCBI gene;Acc:101159382])

HSP 1 Score: 96.2857 bits (238), Expect = 5.723e-22
Identity = 63/210 (30.00%), Postives = 114/210 (54.29%), Query Frame = 1
Query:  403 RYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVL-LVVALGFIVGLLLIGYDVI---TMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIML 1020
            R++FI+ VY +L  Q+L T  I+ I  FV+ +K ++       W    +  +  +++  C   RRK+P N +LL  FT+ +  + G ++ F  +K +F ++ + A + I   VF FQ K D T   G   VL +VV +  I+  +++ +  I    M+Y  +G I++++ L   TQL++ G   Y IS+ E+VF  L++Y++ +   + L
Sbjct:  119 RHSFIRKVYLILASQLLLTTAIVAIFTFVHPVKTFVRDNPAVYWASYAIYIITHIVLVCCKGPRRKYPWNLILLLIFTLALSYMTGTISSFYDTKSVFLALGITAVVCIAVTVFCFQTKVDFTKCQGLFCVLGIVVFVTGIIAAIVLSFKYILWLHMLYAAIGAIVFTLFLAYHTQLLI-GNRKYSISEEEYVFAALSIYVDIVQIFLFL 327          
BLAST of Zgc:110410 vs. Ensembl Medaka
Match: zgc:110410 (protein lifeguard 1 [Source:NCBI gene;Acc:101167569])

HSP 1 Score: 95.5153 bits (236), Expect = 6.986e-22
Identity = 78/266 (29.32%), Postives = 126/266 (47.37%), Query Frame = 1
Query:  259 NYARDPQLWSGTSTM-TIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYH-VYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCNLTQG 1050
            +YA DP  + G       P   P   V+               F  KA R  FIK VY  L  Q+L TV II    + + +K W++  + F +    +  + ++I+       R+ P NYL L  FTIT G +LG VTV+  ++ + +++   AF+ +   +F  Q+K+D T    S+  L        +    I    + ++Y  +  +++S+ L+ +T LIL G H  Y IS  E+VF  L LY++ I S+ ++   F NL  G
Sbjct:   55 SYAEDPPTYGGYPQYGQAPPPYPEVPVF-------------CDFSDKAIRKGFIKKVYLTLMTQLLITVGIICGFIYWDKLKMWVVENNYFTYSMIAVGSVLLVIMSIFGKLHRQAPLNYLALSLFTITEGVMLGSVTVYFKAEAVMWAVGATAFVTLGITLFASQSKFDFTPAAASMWTLAWSLFSLCILCAAIQSQYLYIVYAFLASLVFSLFLVFDTMLILGGKHRRYEISPEEYVFAALTLYVD-IVSLFLIILQFINLCFG 306          
BLAST of Zgc:110410 vs. Ensembl Medaka
Match: tmbim1b (protein lifeguard 3-like [Source:NCBI gene;Acc:101175308])

HSP 1 Score: 93.9745 bits (232), Expect = 2.513e-21
Identity = 75/264 (28.41%), Postives = 137/264 (51.89%), Query Frame = 1
Query:  262 YARDPQLWSG----TSTMTIPGASPR-TLVYGLRNADISQDSDDVK------FLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFC-PITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIV--LLVVALGFIVGLLLIGYDV--ITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
            Y   P  WS       T   PG SP  T +  L  A  +  + D++      + S + R+AFI+ VY +L +Q+ FT  ++ +  FV+ ++ +++      W  SL  +  +  +  C    RR+FP N LLL  FT+ +  + G ++ +  +K +F ++ +   + +   VF FQ K DLT  +G L +  +L++ +G +  ++L    V  + M+Y  +G ++Y++ L+  TQL++ G     IS  E+VF  L+LY++ +H
Sbjct:   38 YPGPPGYWSQGGVFPQTSESPGLSPTVTTIPTLSAAVPAAHTGDMEAFFRNQWESTSVRHAFIRKVYLILAVQLAFTFTVVAVFTFVDPVRLFVIRYPGIYWA-SLAVYFVVYCVLICLKEPRRRFPWNLLLLGIFTLALSYMAGTISSYYETKAVFIAMGITVVVCVAVTVFCFQTKVDLTSCSGLLCIAGVLLMIIGIVTAVVLSFQYVHWLHMLYAAIGAVVYTLFLVYNTQLLI-GNRELAISPEEYVFGALSLYVDIVH 299          
BLAST of Zgc:110410 vs. Ensembl Medaka
Match: grinab (protein lifeguard 1 [Source:NCBI gene;Acc:101161330])

HSP 1 Score: 89.7373 bits (221), Expect = 9.022e-20
Identity = 65/219 (29.68%), Postives = 115/219 (52.51%), Query Frame = 1
Query:  364 QDSDD--VKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVF--SLLAFL-QILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIH 1005
             D+ D  +   +K+ R AF++ V+ +LT Q++ T   + I  FV  +K ++      +W +  S + F+  +L I  C   RRK P N + L   T+++  ++GM+  F  +  +  ++ + A +     +F  Q KYD T   G L V L+V + F    + I   ++ ++Y  +G +L++  L V+TQL+L G     +S  E+VF  LNLYL+ I+
Sbjct:  110 HDNQDFMIGLDNKSIRRAFVRKVFLVLTAQLMVTFAFVAIFTFVKEVKAFVKVN---IWTYIVSYVIFIVALLAISCCGNLRRKHPWNLVALSILTLSMSYMVGMIASFHDTDSVIMAVGITAVVCFTVVIFSLQTKYDFTSCYGVLFVCLIVLIIFGFLCIFIQNKILEIVYAGLGALLFTCFLAVDTQLLL-GNKELSLSPEEYVFAALNLYLDIIN 324          
BLAST of Zgc:110410 vs. Planmine SMEST
Match: SMESG000014372.1 (SMESG000014372.1)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 332/332 (100.00%), Postives = 332/332 (100.00%), Query Frame = 1
Query:   61 MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCNLTQGIN 1056
            MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCNLTQGIN
Sbjct:    1 MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCNLTQGIN 332          
BLAST of Zgc:110410 vs. Planmine SMEST
Match: SMESG000014372.1 (SMESG000014372.1)

HSP 1 Score: 302.753 bits (774), Expect = 6.401e-104
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 1
Query:   61 MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFV 489
            MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFV
Sbjct:    1 MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMGKQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFV 143          
BLAST of Zgc:110410 vs. Planmine SMEST
Match: SMESG000014373.1 (SMESG000014373.1)

HSP 1 Score: 159.073 bits (401), Expect = 2.970e-45
Identity = 95/288 (32.99%), Postives = 167/288 (57.99%), Query Frame = 1
Query:  232 YLNQPVVP--ENYARDPQLWSGTSTMTIPGASPRTLVYG--LRNADI------------SQDSDDVKFL--SKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFC-PITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCN 1038
            Y  QP  P    Y+  PQ        +IP   P+   YG  L+N  I            + DSD   F+  SK+ R AFI+ VY +L++Q++ T+ ++ +M FV  IK W+  ++ +L++ ++   + ++++  C    RRKFP N +LL +FT+    +LG++++   ++ + Y+ V+   I++   +F FQ K D TYL+G L++L +V L F +  L++   ++ +IYC +GV+++S+ LLV+TQL+L G H Y IS  +++F  LNLY++ +   +M+ G+F N
Sbjct:   53 YGAQPQYPGRPTYSGQPQYSPTDGGYSIPQPRPQVYPYGSQLQNPPIYSYGNPGNASLTNPDSDTAHFVFTSKSIRLAFIRKVYAILSLQMVITIGLMALMLFVEPIKLWV-QRNKYLYIVAIAIVIVLMVVLGCFTGPRRKFPLNIILLLAFTLAESFMLGVISISKDTRYVAYATVITLAIVVAITIFAFQTKIDFTYLSGGLLILSIVFLAFGIFALIMRNRLVNLIYCCIGVLIFSIFLLVDTQLMLGGNHSYSISPEDYIFAALNLYVDIVQIFLMVLGIFSN 339          
BLAST of Zgc:110410 vs. Planmine SMEST
Match: SMESG000014373.1 (SMESG000014373.1)

HSP 1 Score: 158.688 bits (400), Expect = 3.569e-45
Identity = 95/288 (32.99%), Postives = 167/288 (57.99%), Query Frame = 1
Query:  232 YLNQPVVP--ENYARDPQLWSGTSTMTIPGASPRTLVYG--LRNADI------------SQDSDDVKFL--SKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFC-PITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCN 1038
            Y  QP  P    Y+  PQ        +IP   P+   YG  L+N  I            + DSD   F+  SK+ R AFI+ VY +L++Q++ T+ ++ +M FV  IK W+  ++ +L++ ++   + ++++  C    RRKFP N +LL +FT+    +LG++++   ++ + Y+ V+   I++   +F FQ K D TYL+G L++L +V L F +  L++   ++ +IYC +GV+++S+ LLV+TQL+L G H Y IS  +++F  LNLY++ +   +M+ G+F N
Sbjct:   51 YGAQPQYPGRPTYSGQPQYSPTDGGYSIPQPRPQVYPYGSQLQNPPIYSYGNPGNASLTNPDSDTAHFVFTSKSIRLAFIRKVYAILSLQMVITIGLMALMLFVEPIKLWV-QRNKYLYIVAIAIVIVLMVVLGCFTGPRRKFPLNIILLLAFTLAESFMLGVISISKDTRYVAYATVITLAIVVAITIFAFQTKIDFTYLSGGLLILSIVFLAFGIFALIMRNRLVNLIYCCIGVLIFSIFLLVDTQLMLGGNHSYSISPEDYIFAALNLYVDIVQIFLMVLGIFSN 337          
BLAST of Zgc:110410 vs. Planmine SMEST
Match: SMESG000057144.1 (SMESG000057144.1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.289e-17
Identity = 64/264 (24.24%), Postives = 124/264 (46.97%), Query Frame = 1
Query:  262 YARDPQLWSGTSTMTIPGASPRTLVYGLRNADISQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWLLTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILGMVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVALGF-----IVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQNEHVFVTLNLYLNAIHSMIMLSGVFCN 1038
            Y   PQ+++  +T   P       +YG  N           F  K+ R  FI+ VY ++T Q+L T   I +  FV  I+ W+     F ++   +  +  + +  CP  RRK+P N+  L  FT+ +  +   +  F  +  +  +  + A + I   +F  Q K D T  +G ++VL +V L       I+   +    V+  +Y  + ++++ + L+ +TQL++ G   Y +S  +++   L LYL+ ++  +++  +F N
Sbjct:   47 YPPQPQVYNYQATEPQPPYQGAGDMYGGDNF--------AAFSDKSVRNGFIRKVYLIMTAQLLVTCLFIAVFQFVEPIQKWVKRNPWFYYLSFAIFIVTYIALVCCPGVRRKYPGNFFALSIFTLALSYMTATIASFYETPAVLVAAGITAIVCISITIFAMQTKIDFTMCSGMILVLSLVLLLTGLSCGIIYATMGPSKVVHAVYAGLCILVFGIYLIYDTQLVIGG-RKYELSPEDYIEGALQLYLDIVNMFLIILSLFGN 301          
The following BLAST results are available for this feature:
BLAST of Zgc:110410 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRINA6.194e-2226.14glutamate ionotropic receptor NMDA type subunit as... [more]
GRINA6.194e-2226.14glutamate ionotropic receptor NMDA type subunit as... [more]
FAIM26.506e-2128.78Fas apoptotic inhibitory molecule 2 [Source:HGNC S... [more]
FAIM25.701e-2028.78Fas apoptotic inhibitory molecule 2 [Source:HGNC S... [more]
FAIM28.987e-2028.78Fas apoptotic inhibitory molecule 2 [Source:HGNC S... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-1202.176e-1025.51pep chromosome:WBcel235:V:9706603:9709814:-1 gene:... [more]
tag-1202.176e-1025.51pep chromosome:WBcel235:V:9707771:9709877:-1 gene:... [more]
tmbi-44.307e-1022.98Transmembrane BAX inhibitor motif-containing prote... [more]
Y42H9AR.23.989e-821.60pep chromosome:WBcel235:IV:8099918:8101424:1 gene:... [more]
xbx-61.160e-622.03X-BoX promoter element regulated [Source:UniProtK... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmda12.952e-2628.95gene:FBgn0013305 transcript:FBtr0089877[more]
Nmda12.952e-2628.95gene:FBgn0013305 transcript:FBtr0089873[more]
Nmda12.952e-2628.95gene:FBgn0013305 transcript:FBtr0089875[more]
Nmda14.607e-2628.95gene:FBgn0013305 transcript:FBtr0089876[more]
Nmda14.607e-2628.95gene:FBgn0013305 transcript:FBtr0309295[more]
back to top
BLAST of Zgc:110410 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1104103.005e-2828.63zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465][more]
zgc:1104101.084e-2728.75zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465][more]
zgc:1104101.084e-2728.75zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465][more]
zgc:1104102.962e-2628.23zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465][more]
faim2b1.886e-2129.47Fas apoptotic inhibitory molecule 2b [Source:ZFIN;... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grina2.179e-2626.67glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grina2.179e-2626.67glutamate receptor, ionotropic, N-methyl D-asparta... [more]
faim21.722e-2427.21Fas apoptotic inhibitory molecule 2 [Source:NCBI g... [more]
tmbim17.051e-2226.92transmembrane BAX inhibitor motif containing 1 [So... [more]
tmbim11.580e-1826.22transmembrane BAX inhibitor motif containing 1 [So... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmbim75.998e-2326.13transmembrane BAX inhibitor motif containing 7 [So... [more]
Faim23.533e-2225.26Fas apoptotic inhibitory molecule 2 [Source:MGI Sy... [more]
Faim25.731e-2129.03Fas apoptotic inhibitory molecule 2 [Source:MGI Sy... [more]
Tmbim12.200e-1927.43transmembrane BAX inhibitor motif containing 1 [So... [more]
Tmbim12.200e-1927.43transmembrane BAX inhibitor motif containing 1 [So... [more]
back to top
BLAST of Zgc:110410 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z429|LFG1_HUMAN2.974e-2126.14Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRI... [more]
sp|Q1LZ71|LFG2_BOVIN4.508e-2126.83Protein lifeguard 2 OS=Bos taurus OX=9913 GN=FAIM2... [more]
sp|Q9BWQ8|LFG2_HUMAN3.125e-2028.78Protein lifeguard 2 OS=Homo sapiens OX=9606 GN=FAI... [more]
sp|Q8K097|LFG2_MOUSE4.009e-2029.03Protein lifeguard 2 OS=Mus musculus OX=10090 GN=Fa... [more]
sp|Q5R4I4|LFG2_PONAB1.539e-1928.29Protein lifeguard 2 OS=Pongo abelii OX=9601 GN=FAI... [more]
back to top
BLAST of Zgc:110410 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8PBL01.783e-3035.02Uncharacterized protein OS=Stomoxys calcitrans OX=... [more]
A0A310SL601.546e-2932.05Protein lifeguard 1 OS=Eufriesea mexicana OX=51675... [more]
A0A5N5Q6053.548e-2929.89Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A423SH961.080e-2835.02Uncharacterized protein OS=Penaeus vannamei OX=668... [more]
A0A267FI043.094e-2833.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1104103.472e-3132.89protein lifeguard 1-like [Source:NCBI gene;Acc:111... [more]
grinab4.037e-2226.50protein lifeguard 1-like [Source:NCBI gene;Acc:103... [more]
grinaa4.306e-2127.80glutamate ionotropic receptor NMDA type subunit as... [more]
tmbim1b6.620e-2127.15protein lifeguard 3-like [Source:NCBI gene;Acc:111... [more]
tmbim1b6.620e-2127.15protein lifeguard 3-like [Source:NCBI gene;Acc:111... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faim2a4.733e-2126.86Fas apoptotic inhibitory molecule 2a [Source:ZFIN;... [more]
faim2a1.405e-1828.50Fas apoptotic inhibitory molecule 2a [Source:ZFIN;... [more]
grinaa4.735e-1725.53glutamate receptor, ionotropic, N-methyl D-asparta... [more]
faim2a2.135e-1228.78Fas apoptotic inhibitory molecule 2a [Source:ZFIN;... [more]
ENSPMAT00000002320.13.434e-1132.98pep scaffold:Pmarinus_7.0:GL476639:16633:21901:-1 ... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zgc:110410 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO375743.467e-2228.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493752.815e-1526.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481597.216e-1225.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zgc:110410 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grinaa6.625e-2329.15protein lifeguard 1 [Source:NCBI gene;Acc:10116465... [more]
tmbim1a5.723e-2230.00transmembrane BAX inhibitor motif containing 1 [So... [more]
zgc:1104106.986e-2229.32protein lifeguard 1 [Source:NCBI gene;Acc:10116756... [more]
tmbim1b2.513e-2128.41protein lifeguard 3-like [Source:NCBI gene;Acc:101... [more]
grinab9.022e-2029.68protein lifeguard 1 [Source:NCBI gene;Acc:10116133... [more]
back to top
BLAST of Zgc:110410 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014372.10.000e+0100.00SMESG000014372.1[more]
SMESG000014372.16.401e-104100.00SMESG000014372.1[more]
SMESG000014373.12.970e-4532.99SMESG000014373.1[more]
SMESG000014373.13.569e-4532.99SMESG000014373.1[more]
SMESG000057144.19.289e-1724.24SMESG000057144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027323 ID=SMED30027323|Name=Zgc:110410|organism=Schmidtea mediterranea sexual|type=transcript|length=1123bp
GGCAAATATTATATTGATAAATTACAATTTCAACAAGCTATCCTCTCCTA
GAACTCAAGGATGTCAGAGCCAGATCCGACGAAACCCTCAAACGTATCCA
ATGCTTTAGCACCTTACACCTCAATCTACGTACTCGATGATGAATCTCAG
AATCCATCCCATTCCTTGAAAAAAGGTGGAATAGGGGCTCCTAGAAATTT
GCAAATGGGCAAGCAAAAGCGAGTGCAACAATACTTAAACCAGCCCGTGG
TCCCTGAAAACTATGCCCGTGATCCCCAATTGTGGAGTGGAACTTCTACT
ATGACAATACCTGGCGCTAGTCCCCGAACTTTGGTCTACGGTCTACGAAA
CGCTGACATCAGTCAAGATTCCGATGACGTCAAATTCCTCTCGAAAGCCG
ACAGATATGCTTTCATCAAATGGGTTTACGGTCTTTTGACTATACAAATT
TTATTCACAGTTTTTATAATTGTAATTATGTGTTTTGTGAACGCCATCAA
GAATTGGCTGTTAACTCAGAGTTGTTTTCTTTGGGTTTTTAGTCTTCTTG
CGTTTCTGCAAATTCTTATTATCGGATTTTGCCCAATAACTAGAAGGAAG
TTTCCGACAAATTATCTCCTCCTGGAAAGCTTCACCATAACGGTTGGGTG
CATCCTTGGAATGGTCACGGTATTTATGACGTCAAAAATTCTCTTTTATT
CGATCGTACTGATAGCTTTCATAATCATCGTTTCCTTTGTGTTCGGGTTT
CAAAACAAATATGATTTAACTTATCTCACGGGATCACTAATAGTTCTGCT
TGTGGTCGCTCTGGGTTTTATAGTTGGTCTTCTGTTGATTGGGTACGACG
TTATCACGATGATCTATTGTGTCGTTGGAGTCATTCTCTATTCGGTGATG
CTCTTGGTCGAGACCCAGCTGATCCTAGAAGGCTATCACGTGTATATAAT
ATCCCAGAATGAGCACGTATTCGTCACTCTCAATCTCTACCTAAACGCGA
TCCACTCTATGATCATGCTGTCAGGCGTATTTTGCAATCTGACCCAGGGC
ATCAACTAATTCATTAATATCCCAATTATGTTTCTTTTTCATTAAATAAA
GTTATTTTTAGTCTCAAAAAAAA
back to top

protein sequence of SMED30027323-orf-1

>SMED30027323-orf-1 ID=SMED30027323-orf-1|Name=SMED30027323-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=333bp
MSEPDPTKPSNVSNALAPYTSIYVLDDESQNPSHSLKKGGIGAPRNLQMG
KQKRVQQYLNQPVVPENYARDPQLWSGTSTMTIPGASPRTLVYGLRNADI
SQDSDDVKFLSKADRYAFIKWVYGLLTIQILFTVFIIVIMCFVNAIKNWL
LTQSCFLWVFSLLAFLQILIIGFCPITRRKFPTNYLLLESFTITVGCILG
MVTVFMTSKILFYSIVLIAFIIIVSFVFGFQNKYDLTYLTGSLIVLLVVA
LGFIVGLLLIGYDVITMIYCVVGVILYSVMLLVETQLILEGYHVYIISQN
EHVFVTLNLYLNAIHSMIMLSGVFCNLTQGIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006214Bax_inhibitor_1-related
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006214Bax inhibitor 1-relatedPFAMPF01027Bax1-Icoord: 117..318
e-value: 5.5E-20
score: 72.1
IPR006214Bax inhibitor 1-relatedPANTHERPTHR23291BAX INHIBITOR-RELATEDcoord: 104..319
NoneNo IPR availablePANTHERPTHR23291:SF47RIKEN CDNA 4930511M11, ISOFORM CRA_Ccoord: 104..319
NoneNo IPR availableTMHMMTMhelixcoord: 238..260
NoneNo IPR availableTMHMMTMhelixcoord: 184..206
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 118..140
NoneNo IPR availableTMHMMTMhelixcoord: 264..283
NoneNo IPR availableTMHMMTMhelixcoord: 210..229
NoneNo IPR availableTMHMMTMhelixcoord: 155..177