SMED30027319

Overview
NameSMED30027319
Smed IDSMED30027319
Length (bp)1257
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027319 (SMED30027319) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027319 (SMED30027319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027319 (SMED30027319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027319 (SMED30027319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027319h1SMcG0014242 dd_Smed_v4_11660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027319h1SMcG0014242 dd_Smed_v4_11660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027319h1SMcG0014242 dd_Smed_v4_11660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027319h1SMcG0014242 dd_Smed_v4_11660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027319h1SMcG0014242 dd_Smed_v4_11660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027319h1SMcG0014242 Contig42140newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027319h1SMcG0014242 Contig42140uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027319 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000392:26144..34861 +6189
Homology
BLAST of SMED30027319 vs. Ensembl Human
Match: ATXN1 (ataxin 1 [Source:HGNC Symbol;Acc:HGNC:10548])

HSP 1 Score: 77.411 bits (189), Expect = 1.572e-14
Identity = 46/117 (39.32%), Postives = 66/117 (56.41%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  574 FMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 690          
BLAST of SMED30027319 vs. Ensembl Human
Match: ATXN1 (ataxin 1 [Source:HGNC Symbol;Acc:HGNC:10548])

HSP 1 Score: 77.411 bits (189), Expect = 1.572e-14
Identity = 46/117 (39.32%), Postives = 66/117 (56.41%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  574 FMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 690          
BLAST of SMED30027319 vs. Ensembl Human
Match: ATXN1L (ataxin 1 like [Source:HGNC Symbol;Acc:HGNC:33279])

HSP 1 Score: 63.929 bits (154), Expect = 2.532e-10
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQ-LIHENRSSV-IVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  I+ S       +  ++ E +S V I V    PFF+   GW++  P      +SL   +LQ+ DVC  +  + L
Sbjct:  469 FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTTQLFSLPCHRLQVGDVCISISLQSL 585          
BLAST of SMED30027319 vs. Ensembl Celegans
Match: K04F10.1 (pep chromosome:WBcel235:I:6364886:6366224:1 gene:WBGene00019394.1 transcript:K04F10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K04F10.1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.406e-9
Identity = 32/122 (26.23%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  609 ASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKK 974
            AS  +   F +G  + +++G +K VE LS+ DF +     + +++  S +K I+ +    T   +   E +   +   V  PFF+   GW + +P      Y L    LQ++DVC  L + +
Sbjct:  114 ASTYYPTHFMRGTQLNVANGNIKKVEDLSSDDFLRCAAESDDVIVNASVIKSIKSTAGSVTIIFETGIEKQLIPLKCQVEHPFFVLGKGWCSCNPRKSGENYGLDCEILQVDDVCIVLTRNE 235          
BLAST of SMED30027319 vs. Ensembl Fly
Match: Atx-1 (gene:FBgn0029907 transcript:FBtr0299814)

HSP 1 Score: 56.9954 bits (136), Expect = 4.579e-9
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  609 ASNDFQDP----FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSV--SKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLV 965
            +SN F D     F++G  I+++ G ++ VE +   DF +S        L  + V  I+ S   +   +   ++   + + + V    P F+   GWA+ DP   L  Y L   +LQ+ D+C  LV
Sbjct:   32 SSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREATVVRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVGDICLSLV 156          
BLAST of SMED30027319 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 78.9518 bits (193), Expect = 2.858e-15
Identity = 48/117 (41.03%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ I+ SH+ N A IQ  +   RS V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L
Sbjct:  530 FTKGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNL 646          
BLAST of SMED30027319 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 78.9518 bits (193), Expect = 2.858e-15
Identity = 48/117 (41.03%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ I+ SH+ N A IQ  +   RS V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L
Sbjct:  530 FTKGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNL 646          
BLAST of SMED30027319 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 78.9518 bits (193), Expect = 2.858e-15
Identity = 48/117 (41.03%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ I+ SH+ N A IQ  +   RS V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L
Sbjct:  530 FTKGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNL 646          
BLAST of SMED30027319 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 78.9518 bits (193), Expect = 2.858e-15
Identity = 48/117 (41.03%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ I+ SH+ N A IQ  +   RS V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L
Sbjct:  530 FTKGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNL 646          
BLAST of SMED30027319 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 78.9518 bits (193), Expect = 3.153e-15
Identity = 48/117 (41.03%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ I+ SH+ N A IQ  +   RS V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L
Sbjct:  530 FTKGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNL 646          
BLAST of SMED30027319 vs. Ensembl Xenopus
Match: polr2h (polymerase (RNA) II subunit H [Source:Xenbase;Acc:XB-GENE-491773])

HSP 1 Score: 80.4925 bits (197), Expect = 1.194e-15
Identity = 53/150 (35.33%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLL---VDENKSLLNTSF-LKRPLSEKL-NKKSRY 1061
            F KG +I++++GELK VE L   DF +S    N + +  S V+ IE SHS   A +Q  + E+RS V V V +  PFF+   GW++  P+     + L  +KL + DVC  L  K L    + + +S+ + +F LK P ++ L   + RY
Sbjct:  557 FMKGSIIQLANGELKKVEDLKTDDFIQSADISNDLKIDSSTVERIESSHSPGIAVVQFAVGEHRSQVSVEVLIEYPFFVFGQGWSSCSPERTSQMFDLPCSKLSVGDVCISLTLKNLKNGSIKKGQSMDSANFLLKHPKNDSLSGSRHRY 706          
BLAST of SMED30027319 vs. Ensembl Xenopus
Match: bicdl2 (BICD family like cargo adaptor 2 [Source:Xenbase;Acc:XB-GENE-5747721])

HSP 1 Score: 62.3882 bits (150), Expect = 8.346e-10
Identity = 34/112 (30.36%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSV--SKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCL 962
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  I+ S       +  I   + S + + V    PFF+   GW++  P      ++L   +LQ+ DVC  +
Sbjct:  475 FMKGAIIQLATGELKKVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVTLHFIVGEQQSKVCLDVPPEHPFFVYGQGWSSCSPRQTAQLFALPCHRLQVGDVCISI 586          
BLAST of SMED30027319 vs. Ensembl Mouse
Match: Atxn1 (ataxin 1 [Source:MGI Symbol;Acc:MGI:104783])

HSP 1 Score: 78.9518 bits (193), Expect = 3.456e-15
Identity = 55/158 (34.81%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  531 YDPSQSVQNAAF-----ASKHMESV--IQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            ++P   V  AA+     A  H+  V  +   + AS      F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  509 FNPEALVTQAAYPAMVQAQIHLPVVQSVASPTTASPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEESHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 666          
BLAST of SMED30027319 vs. Ensembl Mouse
Match: Atxn1 (ataxin 1 [Source:MGI Symbol;Acc:MGI:104783])

HSP 1 Score: 78.9518 bits (193), Expect = 3.456e-15
Identity = 55/158 (34.81%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  531 YDPSQSVQNAAF-----ASKHMESV--IQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            ++P   V  AA+     A  H+  V  +   + AS      F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  509 FNPEALVTQAAYPAMVQAQIHLPVVQSVASPTTASPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEESHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 666          
BLAST of SMED30027319 vs. Ensembl Mouse
Match: Atxn1 (ataxin 1 [Source:MGI Symbol;Acc:MGI:104783])

HSP 1 Score: 75.485 bits (184), Expect = 4.177e-14
Identity = 54/166 (32.53%), Postives = 81/166 (48.80%), Query Frame = 3
Query:  531 YDPSQSVQNAAF-----ASKHMESV--IQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSV---------IVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            ++P   V  AA+     A  H+  V  +   + AS      F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V         + V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  509 FNPEALVTQAAYPAMVQAQIHLPVVQSVASPTTASPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEESHSPGVAVIQFAVGEHRAQVTLTRVIQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 674          
BLAST of SMED30027319 vs. Ensembl Mouse
Match: Atxn1l (ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797])

HSP 1 Score: 64.3142 bits (155), Expect = 1.604e-10
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQ-LIHENRSSV-IVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  I+ S       +  ++ E +S V I V    PFF+   GW++  P      +SL   +LQ+ DVC  +  + L
Sbjct:  467 FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSL 583          
BLAST of SMED30027319 vs. Ensembl Mouse
Match: Atxn1l (ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797])

HSP 1 Score: 64.3142 bits (155), Expect = 1.604e-10
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQ-LIHENRSSV-IVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  I+ S       +  ++ E +S V I V    PFF+   GW++  P      +SL   +LQ+ DVC  +  + L
Sbjct:  467 FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSL 583          
BLAST of SMED30027319 vs. UniProt/SwissProt
Match: sp|P54254|ATX1_MOUSE (Ataxin-1 OS=Mus musculus OX=10090 GN=Atxn1 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.417e-14
Identity = 55/158 (34.81%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  531 YDPSQSVQNAAF-----ASKHMESV--IQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            ++P   V  AA+     A  H+  V  +   + AS      F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  509 FNPEALVTQAAYPAMVQAQIHLPVVQSVASPTTASPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEESHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 666          
BLAST of SMED30027319 vs. UniProt/SwissProt
Match: sp|Q63540|ATX1_RAT (Ataxin-1 OS=Rattus norvegicus OX=10116 GN=Atxn1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.547e-14
Identity = 60/176 (34.09%), Postives = 87/176 (49.43%), Query Frame = 3
Query:  531 YDPSQSVQNAAF-----ASKHMESV--IQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCL---------VKKKLLVDENKSLL 1004
            ++P   V  AA+     A  H+  V  +   + AS      F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L         VKK   VD   +LL
Sbjct:  507 FNPEALVTQAAYPAMVQAQIHLPVVQSVASPAAASPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQPVDPASALL 682          
BLAST of SMED30027319 vs. UniProt/SwissProt
Match: sp|P54253|ATX1_HUMAN (Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 7.552e-14
Identity = 46/117 (39.32%), Postives = 66/117 (56.41%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I++++GELK VE L   DF +S +  N + +  S V+ IE SHS   A IQ  + E+R+ V V V V  PFF+   GW++  P+     + L  +KL + DVC  L  K L
Sbjct:  574 FMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNL 690          
BLAST of SMED30027319 vs. UniProt/SwissProt
Match: sp|P0C7T6|ATX1L_MOUSE (Ataxin-1-like OS=Mus musculus OX=10090 GN=Atxn1l PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.122e-9
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQ-LIHENRSSV-IVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  I+ S       +  ++ E +S V I V    PFF+   GW++  P      +SL   +LQ+ DVC  +  + L
Sbjct:  467 FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSL 583          
BLAST of SMED30027319 vs. UniProt/SwissProt
Match: sp|P0C7T5|ATX1L_HUMAN (Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.216e-9
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQ-LIHENRSSV-IVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  I+ S       +  ++ E +S V I V    PFF+   GW++  P      +SL   +LQ+ DVC  +  + L
Sbjct:  469 FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTTQLFSLPCHRLQVGDVCISISLQSL 585          
BLAST of SMED30027319 vs. TrEMBL
Match: R7U162 (AXH domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_75745 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.364e-12
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  600 LSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKK 971
            + E S  +   F KG +I++++GELK VE L   DF +S      + +  S V  IE +H   TA +   + E R  V V  ++  PFF+   GW++ +P   L++Y L   +L + DVC  L  K
Sbjct:    8 VGEVSPHYPPHFMKGSIIQLANGELKRVEELRTDDFVQSADVSGDLKIDSSTVVRIEENHDKGTAVLGFSVGEQRVQVTVEATLEHPFFVFGQGWSSCNPQQTLHRYGLQCHRLTVGDVCISLTHK 133          
BLAST of SMED30027319 vs. TrEMBL
Match: F7DSH7 (Polymerase (RNA) II subunit H OS=Xenopus tropicalis OX=8364 GN=ccdc18 PE=4 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.875e-12
Identity = 53/150 (35.33%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLL---VDENKSLLNTSF-LKRPLSEKL-NKKSRY 1061
            F KG +I++++GELK VE L   DF +S    N + +  S V+ IE SHS   A +Q  + E+RS V V V +  PFF+   GW++  P+     + L  +KL + DVC  L  K L    + + +S+ + +F LK P ++ L   + RY
Sbjct:  557 FMKGSIIQLANGELKKVEDLKTDDFIQSADISNDLKIDSSTVERIESSHSPGIAVVQFAVGEHRSQVSVEVLIEYPFFVFGQGWSSCSPERTSQMFDLPCSKLSVGDVCISLTLKNLKNGSIKKGQSMDSANFLLKHPKNDSLSGSRHRY 706          
BLAST of SMED30027319 vs. TrEMBL
Match: A0A1L8FY50 (AXH domain-containing protein OS=Xenopus laevis OX=8355 GN=XELAEV_18031701mg PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.496e-12
Identity = 53/150 (35.33%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLL---VDENKSLLNTSF-LKRPLSEKL-NKKSRY 1061
            F KG +I++++GELK VE L   DF +S    N + +  S V+ IE SHS   A +Q  + E+RS V V V +  PFF+   GW++  P+     + L  +KL + DVC  L  K L    + + +S+ + +F LK P ++ L   + RY
Sbjct:  554 FMKGSIIQLANGELKKVEDLKTDDFIQSADISNDLKIDSSTVERIENSHSPGIAVVQFAVGEHRSQVSVEVLIEYPFFVFGQGWSSCSPERTSQMFDLPCSKLSVGDVCISLTLKNLKNGSIKKGQSMDSANFLLKHPKNDSLSGSRHRY 703          
BLAST of SMED30027319 vs. TrEMBL
Match: A0A5C6NEB0 (Ataxin-1 Spinocerebellar ataxia type 1 protein-like protein OS=Takifugu flavidus OX=433684 GN=D4764_21G0001080 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.722e-12
Identity = 59/147 (40.14%), Postives = 79/147 (53.74%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSH-SDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLK--RPLSEKLNKKSR 1058
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ IE SH S N A +Q  + E+R+ V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L   +N SL  T  L+   P+S    K SR
Sbjct:  548 FVKGSIIQLADGELKRVEDLKTEDFIQSAEISNDLKIDSSTVERIEGSHTSPNFAVVQFSVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPDRTTQILELPCTKLSVGDVCISLTLKNL---KNGSLKKTQSLELAPPVSASSLKSSR 691          
BLAST of SMED30027319 vs. TrEMBL
Match: H2UKE7 (Ataxin 1a OS=Takifugu rubripes OX=31033 GN=atxn1 PE=4 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 4.183e-12
Identity = 59/147 (40.14%), Postives = 79/147 (53.74%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSH-SDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLK--RPLSEKLNKKSR 1058
            F KG +I+++DGELK VE L   DF +S +  N + +  S V+ IE SH S N A +Q  + E+R+ V V V V  PFF+   GW++  PD       L  TKL + DVC  L  K L   +N SL  T  L+   P+S    K SR
Sbjct:  535 FVKGSIIQLADGELKRVEDLKTEDFIQSAEISNDLKIDSSTVERIEGSHTSPNFAVVQFSVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPDRTTQILELPCTKLSVGDVCISLTLKNL---KNGSLKKTQSLELAPPVSASGLKSSR 678          
BLAST of SMED30027319 vs. Ensembl Cavefish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 75.485 bits (184), Expect = 3.593e-14
Identity = 51/139 (36.69%), Postives = 73/139 (52.52%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL----LVDENKSLLNTSFLKRPL 1031
            F KG +I+++DGELK VE L   DF +S +  + + +  S V+ I+ SH+ N A IQ  + E+RS V V V V  PFF+   GW++  P+       L   KL + DVC  L  K L    L      + +T+ L  PL
Sbjct:  509 FIKGSIIQLADGELKRVEDLKTEDFIQSAEISSELKIDSSTVERIDSSHTPNYAIIQFAVGEHRSQVSVEVLVEYPFFVFGQGWSSCCPERTTQLLELPCAKLSVGDVCISLTLKNLKNGSLKKSPGQIPDTAGLGPPL 647          
BLAST of SMED30027319 vs. Ensembl Cavefish
Match: atxn1b (ataxin-1-like [Source:NCBI gene;Acc:103029611])

HSP 1 Score: 72.4034 bits (176), Expect = 2.901e-13
Identity = 42/117 (35.90%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +    + +  S V+ I+ S + +   IQ  + E+++ V V V V  PFF+   GW++  PD      +L   KL + DVC  L  K L
Sbjct:  594 FMKGSIIQLADGELKRVEDLRTEDFLQSAEVSGELKIDSSTVERIDTSRTPDAVIIQFSVGEHKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSCAKLSVGDVCISLTLKSL 710          
BLAST of SMED30027319 vs. Ensembl Cavefish
Match: atxn1b (ataxin-1-like [Source:NCBI gene;Acc:103029611])

HSP 1 Score: 72.4034 bits (176), Expect = 2.901e-13
Identity = 42/117 (35.90%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +    + +  S V+ I+ S + +   IQ  + E+++ V V V V  PFF+   GW++  PD      +L   KL + DVC  L  K L
Sbjct:  594 FMKGSIIQLADGELKRVEDLRTEDFLQSAEVSGELKIDSSTVERIDTSRTPDAVIIQFSVGEHKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSCAKLSVGDVCISLTLKSL 710          
BLAST of SMED30027319 vs. Ensembl Cavefish
Match: ENSAMXT00000002788.2 (ataxin-1-like [Source:NCBI gene;Acc:103038298])

HSP 1 Score: 62.3882 bits (150), Expect = 3.853e-10
Identity = 35/112 (31.25%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSV--SKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCL 962
            F KG LI+++ G LK VE L   DF  S  +     L    + LI    ++    +Q++  +R++  +++V    PFF+RD GW++  P      Y L   +L   DVC  L
Sbjct:  395 FAKGSLIELAGGRLKRVEELRTEDFLHSADTSPEFHLSTCTILLISPGPTNGFNHLQVLLADRNTQELLTVLEEYPFFVRDRGWSSCSPQRSAQLYGLPCRQLSAGDVCLAL 506          
BLAST of SMED30027319 vs. Ensembl Cavefish
Match: atxn1l (ataxin 1 like [Source:NCBI gene;Acc:103023764])

HSP 1 Score: 61.6178 bits (148), Expect = 7.840e-10
Identity = 36/116 (31.03%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIH----ENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLV 965
            F KG +I+++ GELK VE L   DF +S +   G+ +  S V  +++  S     +  +H    E +S V + V    PFF+   GW++  P+     Y L    LQ+ DVC  + 
Sbjct:  560 FTKGAIIQLATGELKRVEDLQTQDFVRSAEMSGGLKIDSSMV--VDIRGSQQRPGLVSLHFTVGEQQSKVTIDVPPEHPFFVFGQGWSSCSPERTAQLYGLTCHHLQVGDVCVSIT 673          
BLAST of SMED30027319 vs. Ensembl Nematostella
Match: EDO32536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUT3])

HSP 1 Score: 59.6918 bits (143), Expect = 3.873e-11
Identity = 37/113 (32.74%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  630 PFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCL 962
            PF KG +I+++ GELK VE L+  DF  S      + L  S V  +  +     A +   I   ++ V +  +V  PFF+   GW++  P+  L KY+L    L++ DVC  L
Sbjct:    5 PFIKGSIIQLTSGELKRVEDLTTDDFVHSTGLCPDLKLETSTVVSVRKNDEVGMALVGFTITSTKAQVTLSCAVEHPFFVYGQGWSSCVPEQSLKKYNLQCHPLKVGDVCIFL 117          
BLAST of SMED30027319 vs. Ensembl Medaka
Match: atxn1b (ataxin-1 [Source:NCBI gene;Acc:101164503])

HSP 1 Score: 72.4034 bits (176), Expect = 3.304e-13
Identity = 46/131 (35.11%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFL 1019
            F +G +I+++DGELK VE L   DF +S +  N + +  S V+ I+   S N   IQ  + E ++ V V V V  PFF+   GW++  PD     + L   KL + DVC  L  + L   +N SL ++  L
Sbjct:  537 FMRGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDTGQSPNAVVIQFSVGELKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLFELSCAKLCVGDVCVSLTLRSL---KNGSLTDSHAL 664          
BLAST of SMED30027319 vs. Ensembl Medaka
Match: atxn1b (ataxin-1 [Source:NCBI gene;Acc:101164503])

HSP 1 Score: 72.4034 bits (176), Expect = 3.304e-13
Identity = 46/131 (35.11%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFL 1019
            F +G +I+++DGELK VE L   DF +S +  N + +  S V+ I+   S N   IQ  + E ++ V V V V  PFF+   GW++  PD     + L   KL + DVC  L  + L   +N SL ++  L
Sbjct:  537 FMRGSIIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDTGQSPNAVVIQFSVGELKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLFELSCAKLCVGDVCVSLTLRSL---KNGSLTDSHAL 664          
BLAST of SMED30027319 vs. Ensembl Medaka
Match: atxn1a (ataxin 1 [Source:NCBI gene;Acc:105355143])

HSP 1 Score: 69.707 bits (169), Expect = 2.583e-12
Identity = 46/118 (38.98%), Postives = 65/118 (55.08%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSH-SDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  + + +  S V+ IE S  S N A +Q  + E+RS V V V +  PFF+   GW++  PD       L  +KL + DVC  L  K L
Sbjct:  544 FIKGSIIQLADGELKQVEDLRTEDFIQSAEISSELKIDSSTVERIEGSQTSANFAVVQFAVGEHRSQVSVEVLLEYPFFVFGQGWSSCCPDRTTQLLELPCSKLSVGDVCISLTLKNL 661          
BLAST of SMED30027319 vs. Ensembl Medaka
Match: atxn1a (ataxin 1 [Source:NCBI gene;Acc:105355143])

HSP 1 Score: 69.707 bits (169), Expect = 2.583e-12
Identity = 46/118 (38.98%), Postives = 65/118 (55.08%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSH-SDNTARIQL-IHENRSSVIV-VSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKL 977
            F KG +I+++DGELK VE L   DF +S +  + + +  S V+ IE S  S N A +Q  + E+RS V V V +  PFF+   GW++  PD       L  +KL + DVC  L  K L
Sbjct:  544 FIKGSIIQLADGELKQVEDLRTEDFIQSAEISSELKIDSSTVERIEGSQTSANFAVVQFAVGEHRSQVSVEVLLEYPFFVFGQGWSSCCPDRTTQLLELPCSKLSVGDVCISLTLKNL 661          
BLAST of SMED30027319 vs. Ensembl Medaka
Match: ENSORLT00000027865.1 (ataxin-1-like [Source:NCBI gene;Acc:105354405])

HSP 1 Score: 62.3882 bits (150), Expect = 3.979e-10
Identity = 36/113 (31.86%), Postives = 53/113 (46.90%), Query Frame = 3
Query:  633 FQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQL--IHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLV 965
            F KG LI+++ G LK VE L   DF +S  + +   L    V  I  S +   +++QL     N    + V V  PFF++D GW++  P      Y L   +L   D+C  L 
Sbjct:  461 FTKGSLIELASGRLKRVEELRTEDFLRSADTSSEFHLSTCTVLSISPSSAQGFSQLQLHLTDRNTQESLKVLVEYPFFVQDRGWSSCSPQRTTQLYGLPCRQLSEGDICLALT 573          
BLAST of SMED30027319 vs. Planmine SMEST
Match: SMESG000006149.1 (SMESG000006149.1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 319/320 (99.69%), Postives = 320/320 (100.00%), Query Frame = 3
Query:  111 MNNVHRNLIRPHSFMSAEKDLPNFNGNIXXXXXXXXXXXXXXXXXXXXYFSIPPPPSLLFKSSDMYNSINNKKSPFTSDSGLIQSPSSDIMKISQTTHPSSVLSKIXXXXXXXXXXXXXXXXXQLTLSAFSSGNYKRFSGYDPSQSVQNAAFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLKRPLSEKLNKKSRYQPY 1070
            MNNVHRNLIRPHSFMSAEKDLPNFNGNIPLPPFFQNFMPPFPQNNNLNYFSIPPPPSLLFKSSDMYNSIN+KKSPFTSDSGLIQSPSSDIMKISQTTHPSSVLSKIPGNFFPFPSLSNSPFLGQLTLSAFSSGNYKRFSGYDPSQSVQNAAFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLKRPLSEKLNKKSRYQPY
Sbjct:    1 MNNVHRNLIRPHSFMSAEKDLPNFNGNIPLPPFFQNFMPPFPQNNNLNYFSIPPPPSLLFKSSDMYNSINSKKSPFTSDSGLIQSPSSDIMKISQTTHPSSVLSKIPGNFFPFPSLSNSPFLGQLTLSAFSSGNYKRFSGYDPSQSVQNAAFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLKRPLSEKLNKKSRYQPY 320          
BLAST of SMED30027319 vs. Planmine SMEST
Match: SMESG000006149.1 (SMESG000006149.1)

HSP 1 Score: 506.138 bits (1302), Expect = 0.000e+0
Identity = 305/306 (99.67%), Postives = 306/306 (100.00%), Query Frame = 3
Query:  153 MSAEKDLPNFNGNIXXXXXXXXXXXXXXXXXXXXYFSIPPPPSLLFKSSDMYNSINNKKSPFTSDSGLIQSPSSDIMKISQTTHPSSVLSKIXXXXXXXXXXXXXXXXXQLTLSAFSSGNYKRFSGYDPSQSVQNAAFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLKRPLSEKLNKKSRYQPY 1070
            MSAEKDLPNFNGNIPLPPFFQNFMPPFPQNNNLNYFSIPPPPSLLFKSSDMYNSIN+KKSPFTSDSGLIQSPSSDIMKISQTTHPSSVLSKIPGNFFPFPSLSNSPFLGQLTLSAFSSGNYKRFSGYDPSQSVQNAAFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLKRPLSEKLNKKSRYQPY
Sbjct:    1 MSAEKDLPNFNGNIPLPPFFQNFMPPFPQNNNLNYFSIPPPPSLLFKSSDMYNSINSKKSPFTSDSGLIQSPSSDIMKISQTTHPSSVLSKIPGNFFPFPSLSNSPFLGQLTLSAFSSGNYKRFSGYDPSQSVQNAAFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNTSFLKRPLSEKLNKKSRYQPY 306          
BLAST of SMED30027319 vs. Planmine SMEST
Match: SMESG000010590.1 (SMESG000010590.1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.232e-6
Identity = 25/109 (22.94%), Postives = 47/109 (43.12%), Query Frame = 3
Query:  648 LIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKK 974
            +I +  G  K +E ++ SD     K ++      SEV  I     D    I     N+  V    + +PFF+++ GW ++ P      Y + ++ + +   C  L +K+
Sbjct:  149 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKR 257          
The following BLAST results are available for this feature:
BLAST of SMED30027319 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ATXN11.572e-1439.32ataxin 1 [Source:HGNC Symbol;Acc:HGNC:10548][more]
ATXN11.572e-1439.32ataxin 1 [Source:HGNC Symbol;Acc:HGNC:10548][more]
ATXN1L2.532e-1032.48ataxin 1 like [Source:HGNC Symbol;Acc:HGNC:33279][more]
back to top
BLAST of SMED30027319 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K04F10.17.406e-926.23pep chromosome:WBcel235:I:6364886:6366224:1 gene:W... [more]
back to top
BLAST of SMED30027319 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atx-14.579e-927.20gene:FBgn0029907 transcript:FBtr0299814[more]
back to top
BLAST of SMED30027319 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atxn1a2.858e-1541.03ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1a2.858e-1541.03ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1a2.858e-1541.03ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1a2.858e-1541.03ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1a3.153e-1541.03ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
back to top
BLAST of SMED30027319 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
polr2h1.194e-1535.33polymerase (RNA) II subunit H [Source:Xenbase;Acc:... [more]
bicdl28.346e-1030.36BICD family like cargo adaptor 2 [Source:Xenbase;A... [more]
back to top
BLAST of SMED30027319 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atxn13.456e-1534.81ataxin 1 [Source:MGI Symbol;Acc:MGI:104783][more]
Atxn13.456e-1534.81ataxin 1 [Source:MGI Symbol;Acc:MGI:104783][more]
Atxn14.177e-1432.53ataxin 1 [Source:MGI Symbol;Acc:MGI:104783][more]
Atxn1l1.604e-1032.48ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797][more]
Atxn1l1.604e-1032.48ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797][more]
back to top
BLAST of SMED30027319 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54254|ATX1_MOUSE2.417e-1434.81Ataxin-1 OS=Mus musculus OX=10090 GN=Atxn1 PE=1 SV... [more]
sp|Q63540|ATX1_RAT2.547e-1434.09Ataxin-1 OS=Rattus norvegicus OX=10116 GN=Atxn1 PE... [more]
sp|P54253|ATX1_HUMAN7.552e-1439.32Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=... [more]
sp|P0C7T6|ATX1L_MOUSE1.122e-932.48Ataxin-1-like OS=Mus musculus OX=10090 GN=Atxn1l P... [more]
sp|P0C7T5|ATX1L_HUMAN1.216e-932.48Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE... [more]
back to top
BLAST of SMED30027319 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U1621.364e-1233.33AXH domain-containing protein (Fragment) OS=Capite... [more]
F7DSH71.875e-1235.33Polymerase (RNA) II subunit H OS=Xenopus tropicali... [more]
A0A1L8FY503.496e-1235.33AXH domain-containing protein OS=Xenopus laevis OX... [more]
A0A5C6NEB03.722e-1240.14Ataxin-1 Spinocerebellar ataxia type 1 protein-lik... [more]
H2UKE74.183e-1240.14Ataxin 1a OS=Takifugu rubripes OX=31033 GN=atxn1 P... [more]
back to top
BLAST of SMED30027319 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atxn1a3.593e-1436.69ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1b2.901e-1335.90ataxin-1-like [Source:NCBI gene;Acc:103029611][more]
atxn1b2.901e-1335.90ataxin-1-like [Source:NCBI gene;Acc:103029611][more]
ENSAMXT00000002788.23.853e-1031.25ataxin-1-like [Source:NCBI gene;Acc:103038298][more]
atxn1l7.840e-1031.03ataxin 1 like [Source:NCBI gene;Acc:103023764][more]
back to top
BLAST of SMED30027319 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027319 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027319 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO325363.873e-1132.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027319 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atxn1b3.304e-1335.11ataxin-1 [Source:NCBI gene;Acc:101164503][more]
atxn1b3.304e-1335.11ataxin-1 [Source:NCBI gene;Acc:101164503][more]
atxn1a2.583e-1238.98ataxin 1 [Source:NCBI gene;Acc:105355143][more]
atxn1a2.583e-1238.98ataxin 1 [Source:NCBI gene;Acc:105355143][more]
ENSORLT00000027865.13.979e-1031.86ataxin-1-like [Source:NCBI gene;Acc:105354405][more]
back to top
BLAST of SMED30027319 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000006149.10.000e+099.69SMESG000006149.1[more]
SMESG000006149.10.000e+099.67SMESG000006149.1[more]
SMESG000010590.11.232e-622.94SMESG000010590.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027319 ID=SMED30027319|Name=SMED30027319|organism=Schmidtea mediterranea sexual|type=transcript|length=1257bp
CCAGAATCGAACGCAAGTGACTCGTGACCCTTAACACTATATATTTAATC
TAATGTATTTTAATTACATTATTTGAAAAACAATATTTCTACTCAAAACT
ATGAGCTGCCATGAATAACGTTCACAGAAACCTAATCCGACCACATTCAT
TTATGTCTGCTGAAAAAGATTTACCGAATTTCAATGGAAACATTCCATTG
CCTCCATTTTTCCAGAACTTTATGCCACCTTTTCCACAAAACAATAATTT
GAATTACTTTTCCATTCCACCTCCTCCGAGTCTTCTCTTTAAGTCTTCAG
ATATGTACAACTCTATAAACAATAAAAAATCACCCTTTACCAGTGATTCT
GGTTTGATCCAGTCTCCATCTTCTGACATTATGAAAATATCCCAAACCAC
TCATCCAAGTTCGGTTTTATCAAAAATCCCGGGAAATTTCTTTCCGTTTC
CTTCTTTGTCTAATTCTCCTTTTCTTGGCCAGTTGACTTTGTCTGCGTTT
TCTTCGGGAAACTATAAAAGATTCAGTGGATATGATCCCAGTCAATCGGT
CCAAAATGCTGCTTTTGCATCCAAGCACATGGAATCAGTTATTCAAAAAC
TATCCGAAGCATCAAATGATTTTCAGGATCCATTTCAGAAAGGCAGACTT
ATCAAAATGAGTGATGGGGAATTGAAAGTGGTTGAAAGTTTATCGGCTTC
TGATTTTGAAAAGAGCTGTAAATCTCACAATGGTATGGTTTTGGTTCCAA
GTGAAGTCAAACTAATTGAAGTCAGTCATTCTGATAACACAGCCAGAATA
CAACTAATCCATGAAAACAGATCAAGTGTAATTGTTGTATCCGTTTCCAA
ACCATTTTTCATCCGAGATGCTGGCTGGGCTGCGATTGATCCTGATGCGT
GCTTGAATAAATACAGTCTTCATGCAACAAAATTACAGCTCAACGATGTT
TGTTTTTGCCTTGTAAAGAAGAAGCTTCTTGTCGATGAAAATAAATCCTT
ACTCAATACTTCGTTTCTCAAGAGGCCATTATCTGAAAAACTAAACAAAA
AATCCCGATATCAACCATACTGAATACTTTATTTTCAGTCACTTTTAGAC
AGAATCTATTAAAACGGTCTTTCAACTTTAAAATTTTTTCATCTTCCACT
ACTTTTCTTGGCCTAGTCACACTTGTTTCACTTGACGATCTGTGATCAGG
ACAAAATGCCATTATGTTATCGTATTTGTATACATAAAACGTTTTGTGAT
GTAGATC
back to top

protein sequence of SMED30027319-orf-1

>SMED30027319-orf-1 ID=SMED30027319-orf-1|Name=SMED30027319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MNNVHRNLIRPHSFMSAEKDLPNFNGNIPLPPFFQNFMPPFPQNNNLNYF
SIPPPPSLLFKSSDMYNSINNKKSPFTSDSGLIQSPSSDIMKISQTTHPS
SVLSKIPGNFFPFPSLSNSPFLGQLTLSAFSSGNYKRFSGYDPSQSVQNA
AFASKHMESVIQKLSEASNDFQDPFQKGRLIKMSDGELKVVESLSASDFE
KSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFF
IRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKKLLVDENKSLLNT
SFLKRPLSEKLNKKSRYQPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR036096Ataxin_AXH_dom_sf
IPR003652Ataxin_AXH_dom
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0008022protein C-terminus binding
GO:0008266poly(U) RNA binding
GO:0034046poly(G) binding
GO:0042802identical protein binding
GO:0043621protein self-association
Vocabulary: biological process
TermDefinition
GO:0060252positive regulation of glial cell proliferation
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008344adult locomotory behavior
GO:0008542visual learning
GO:0042326negative regulation of phosphorylation
GO:0043569negative regulation of insulin-like growth factor receptor signaling pathway
GO:0045892negative regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048286lung alveolus development
GO:0051168nuclear export
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0098794postsynapse
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016363nuclear matrix
GO:0042405nuclear inclusion body
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003652Ataxin, AXH domainSMARTSM00536toby4coord: 170..287
e-value: 1.6E-6
score: 30.2
IPR003652Ataxin, AXH domainPFAMPF08517AXHcoord: 175..285
e-value: 9.8E-21
score: 74.5
IPR003652Ataxin, AXH domainPROSITEPS51148AXHcoord: 163..292
score: 18.763
NoneNo IPR availablePANTHERPTHR13392ATAXIN 1coord: 144..293
NoneNo IPR availablePANTHERPTHR13392:SF13ATAXIN 1coord: 144..293
IPR036096Ataxin, AXH domain superfamilySUPERFAMILYSSF102031AXH domaincoord: 172..284