SMED30027315

Overview
NameSMED30027315
Smed IDSMED30027315
Length (bp)6618
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027315 (SMED30027315) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027315 (SMED30027315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027315 (SMED30027315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027315 (SMED30027315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027315SMESG000023005.1 Contig639uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000023005.1 Contig639newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000023005.1 Contig3882uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000023005.1 Contig3882newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000023005.1 Contig4394uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000023005.1 Contig4394newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000001727.1 Contig3882uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000001727.1 Contig3882newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000051379.1 Contig639uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000051379.1 Contig639newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000038746.1 Contig4394uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027315SMESG000038746.1 Contig4394newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30027315SMESG000023005.1 Contig640newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027315SMESG000069834.1 Contig640newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30027315SMESG000023005.1 dd_Smed_v4_8220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30027315 vs. Ensembl Human
Match: PLEC (plectin [Source:HGNC Symbol;Acc:HGNC:9069])

HSP 1 Score: 62.003 bits (149), Expect = 1.973e-8
Identity = 42/185 (22.70%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIV---PIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K +V   P H       +  +L  C   Y   E++VH  +E  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  731 WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYS-CDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC--DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQ 912          
BLAST of SMED30027315 vs. Ensembl Human
Match: PLEC (plectin [Source:HGNC Symbol;Acc:HGNC:9069])

HSP 1 Score: 60.8474 bits (146), Expect = 4.144e-8
Identity = 42/185 (22.70%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIV---PIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K +V   P H       +  +L  C   Y   E++VH  +E  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  841 WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYS-CDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC--DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQ 1022          
BLAST of SMED30027315 vs. Ensembl Human
Match: PLEC (plectin [Source:HGNC Symbol;Acc:HGNC:9069])

HSP 1 Score: 60.8474 bits (146), Expect = 4.279e-8
Identity = 42/185 (22.70%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIV---PIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K +V   P H       +  +L  C   Y   E++VH  +E  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  708 WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYS-CDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC--DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQ 889          
BLAST of SMED30027315 vs. Ensembl Human
Match: PLEC (plectin [Source:HGNC Symbol;Acc:HGNC:9069])

HSP 1 Score: 60.4622 bits (145), Expect = 4.810e-8
Identity = 42/185 (22.70%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIV---PIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K +V   P H       +  +L  C   Y   E++VH  +E  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  672 WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYS-CDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC--DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQ 853          
BLAST of SMED30027315 vs. Ensembl Human
Match: PLEC (plectin [Source:HGNC Symbol;Acc:HGNC:9069])

HSP 1 Score: 60.4622 bits (145), Expect = 4.811e-8
Identity = 42/185 (22.70%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIV---PIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K +V   P H       +  +L  C   Y   E++VH  +E  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  690 WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYS-CDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC--DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQ 871          
BLAST of SMED30027315 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273223)

HSP 1 Score: 86.2705 bits (212), Expect = 3.892e-16
Identity = 42/160 (26.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query: 5056 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS-QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPD 5532
            W ++ +L    +VHL++A++YHQF  +I +    L KR ++++++ +  +    + + + L   ++D +         +  LQ  ++ +VP++ R+ PV+ Q  V   C Y     ++ +   E V +L+NS  + W+++  KG+ G IP  C+ +P PD
Sbjct:  706 WAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSD--FGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQG-QLQIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPD 862          
BLAST of SMED30027315 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304853)

HSP 1 Score: 86.2705 bits (212), Expect = 3.928e-16
Identity = 42/160 (26.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query: 5056 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS-QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPD 5532
            W ++ +L    +VHL++A++YHQF  +I +    L KR ++++++ +  +    + + + L   ++D +         +  LQ  ++ +VP++ R+ PV+ Q  V   C Y     ++ +   E V +L+NS  + W+++  KG+ G IP  C+ +P PD
Sbjct:  776 WAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSD--FGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQG-QLQIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPD 932          
BLAST of SMED30027315 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304847)

HSP 1 Score: 86.2705 bits (212), Expect = 3.928e-16
Identity = 42/160 (26.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query: 5056 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS-QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPD 5532
            W ++ +L    +VHL++A++YHQF  +I +    L KR ++++++ +  +    + + + L   ++D +         +  LQ  ++ +VP++ R+ PV+ Q  V   C Y     ++ +   E V +L+NS  + W+++  KG+ G IP  C+ +P PD
Sbjct:  776 WAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSD--FGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQG-QLQIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPD 932          
BLAST of SMED30027315 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0301593)

HSP 1 Score: 86.2705 bits (212), Expect = 3.996e-16
Identity = 42/160 (26.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query: 5056 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS-QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPD 5532
            W ++ +L    +VHL++A++YHQF  +I +    L KR ++++++ +  +    + + + L   ++D +         +  LQ  ++ +VP++ R+ PV+ Q  V   C Y     ++ +   E V +L+NS  + W+++  KG+ G IP  C+ +P PD
Sbjct:  776 WAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSD--FGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQG-QLQIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPD 932          
BLAST of SMED30027315 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304852)

HSP 1 Score: 86.2705 bits (212), Expect = 3.996e-16
Identity = 42/160 (26.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query: 5056 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS-QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPD 5532
            W ++ +L    +VHL++A++YHQF  +I +    L KR ++++++ +  +    + + + L   ++D +         +  LQ  ++ +VP++ R+ PV+ Q  V   C Y     ++ +   E V +L+NS  + W+++  KG+ G IP  C+ +P PD
Sbjct:  776 WAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSD--FGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQG-QLQIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPD 932          
BLAST of SMED30027315 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 63.1586 bits (152), Expect = 4.675e-9
Identity = 54/229 (23.58%), Postives = 101/229 (44.10%), Query Frame = -1
Query: 4870 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRT---QLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKI---DYFNNLLRDVQ 5532
            W++I +L    + HL+  + Y QF  D+ E    LKK    +  +          +  D L + +++ +         I NL   +K ++ +  R DP    + K+  Q +  +   EI++H  +E  ++NNS P  WK+ N  G+   +PS+C  +P  +  + E    L     Q    W++       +L   Y+    +L+   NI++ K    D +  +LR++Q
Sbjct:  733 WSWILQLCCCIETHLKENTAYFQFFADVKEADERLKKMQDTMKKKYMCDRSTTATRLEDLLQDAVEEREQVN-EFKNDIANLNKRAKSVIQLKPR-DPTCPFRGKLPIQAVCDFKQMEITMHKGDECALINNSQPSRWKVLNRSGDEAVVPSICFLVPPVNKEAVESVSGLEAGHQQTVILWQKLHADLRALLSWQYLMKDIQLIRSWNITMFKTMKPDEYRLILRNLQ 959          
BLAST of SMED30027315 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 63.1586 bits (152), Expect = 4.675e-9
Identity = 54/229 (23.58%), Postives = 101/229 (44.10%), Query Frame = -1
Query: 4870 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRT---QLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKI---DYFNNLLRDVQ 5532
            W++I +L    + HL+  + Y QF  D+ E    LKK    +  +          +  D L + +++ +         I NL   +K ++ +  R DP    + K+  Q +  +   EI++H  +E  ++NNS P  WK+ N  G+   +PS+C  +P  +  + E    L     Q    W++       +L   Y+    +L+   NI++ K    D +  +LR++Q
Sbjct:  738 WSWILQLCCCIETHLKENTAYFQFFADVKEADERLKKMQDTMKKKYMCDRSTTATRLEDLLQDAVEEREQVN-EFKNDIANLNKRAKSVIQLKPR-DPTCPFRGKLPIQAVCDFKQMEITMHKGDECALINNSQPSRWKVLNRSGDEAVVPSICFLVPPVNKEAVESVSGLEAGHQQTVILWQKLHADLRALLSWQYLMKDIQLIRSWNITMFKTMKPDEYRLILRNLQ 964          
BLAST of SMED30027315 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 63.1586 bits (152), Expect = 5.040e-9
Identity = 54/229 (23.58%), Postives = 101/229 (44.10%), Query Frame = -1
Query: 4870 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRT---QLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKI---DYFNNLLRDVQ 5532
            W++I +L    + HL+  + Y QF  D+ E    LKK    +  +          +  D L + +++ +         I NL   +K ++ +  R DP    + K+  Q +  +   EI++H  +E  ++NNS P  WK+ N  G+   +PS+C  +P  +  + E    L     Q    W++       +L   Y+    +L+   NI++ K    D +  +LR++Q
Sbjct:  709 WSWILQLCCCIETHLKENTAYFQFFADVKEADERLKKMQDTMKKKYMCDRSTTATRLEDLLQDAVEEREQVN-EFKNDIANLNKRAKSVIQLKPR-DPTCPFRGKLPIQAVCDFKQMEITMHKGDECALINNSQPSRWKVLNRSGDEAVVPSICFLVPPVNKEAVESVSGLEAGHQQTVILWQKLHADLRALLSWQYLMKDIQLIRSWNITMFKTMKPDEYRLILRNLQ 935          
BLAST of SMED30027315 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 63.1586 bits (152), Expect = 5.083e-9
Identity = 54/229 (23.58%), Postives = 101/229 (44.10%), Query Frame = -1
Query: 4870 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRT---QLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKI---DYFNNLLRDVQ 5532
            W++I +L    + HL+  + Y QF  D+ E    LKK    +  +          +  D L + +++ +         I NL   +K ++ +  R DP    + K+  Q +  +   EI++H  +E  ++NNS P  WK+ N  G+   +PS+C  +P  +  + E    L     Q    W++       +L   Y+    +L+   NI++ K    D +  +LR++Q
Sbjct:  714 WSWILQLCCCIETHLKENTAYFQFFADVKEADERLKKMQDTMKKKYMCDRSTTATRLEDLLQDAVEEREQVN-EFKNDIANLNKRAKSVIQLKPR-DPTCPFRGKLPIQAVCDFKQMEITMHKGDECALINNSQPSRWKVLNRSGDEAVVPSICFLVPPVNKEAVESVSGLEAGHQQTVILWQKLHADLRALLSWQYLMKDIQLIRSWNITMFKTMKPDEYRLILRNLQ 940          
BLAST of SMED30027315 vs. Ensembl Zebrafish
Match: pleca (plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984])

HSP 1 Score: 63.1586 bits (152), Expect = 5.627e-9
Identity = 38/158 (24.05%), Postives = 75/158 (47.47%), Query Frame = -1
Query: 5065 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIP 5532
            W++I +L    + HL+  + Y QF  D+ E    +KK    +  +    +   T+   + L  +  + +       T ++ L   +K I+ +  R    P+ + K+  Q +  +   EI+VH  +E  ++NNS P  WK++++ G    +PS+C  +P
Sbjct:  727 WSWILQLCCCIETHLKENTAYFQFFSDVKEAEDRMKKMEDTMKKKYV-CDRSITVTRLEDLLQDAVEEKEQLNEFKTHLEGLNRRAKTIIQLKPRNPAQPI-KGKLPVQAVCDFKQMEITVHKGDECALVNNSQPYKWKVRDSSGNEAVVPSICFIVP 882          
BLAST of SMED30027315 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 56.9954 bits (136), Expect = 6.375e-7
Identity = 56/233 (24.03%), Postives = 103/233 (44.21%), Query Frame = -1
Query: 4849 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR-QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP--DVISSEKPISLRTQ--LTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNL 5532
            WN+I +L +  + H+R  S Y ++ +D  + +  LK     I  + +  +     K  D L  +++  Q   L   + + +L  ++K I+ +  R  D   +  +  + +  Y   EI+++  +E ++ +NS+   WK+ +  G    +PSVC  +P P  + + S   I    Q  LT   E  +N  S V   + +N  E       I  SK+     LL    + +L NL
Sbjct:  962 WNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEKEQ--LLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQIEITIYKDDECILASNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDSANRIEQMYQSVLTLWHESHINMKSTVSWHYLMNEIE------GIRASKVSTIKTLLPGEHQQVLSNL 1186          
BLAST of SMED30027315 vs. Ensembl Xenopus
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:NCBI gene;Acc:100127846])

HSP 1 Score: 56.6102 bits (135), Expect = 7.358e-7
Identity = 59/262 (22.52%), Postives = 113/262 (43.13%), Query Frame = -1
Query: 4843 KSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS-QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSE----------KPISLRTQLTKNWEQCLN----RFSIVLIDHY-------INLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTD 5562
            ++ S  V   W ++ +L    + HL+  + Y QF +D+ E    L      I  + +        +  D L +++ D +   +   + + +L   SK IV +  R   ++  N +  + +  Y   EI++   EE V+ +N+    WK+ +  G    +PSVC  IP P+  + E          K +SL  QL  N +  ++    R  + ++  +       + L ERL    N+S S   + +  L D ++  + ++TD
Sbjct:  689 EAYSAAVVSQWQWVKQLCLCVEQHLKENTAYFQFFNDVRESEVYLNNLQDSIKRKYSCDRTTSINRLEDILQDSM-DEKEQLIQSRSSVASLVGRSKNIVQLKPRNPELTLANTLPIKAVCDYRQIEITIGRNEECVLEDNTQRTKWKVISTTGNEAMVPSVCFLIPPPNQEAMEMASRVEQLYQKVMSLWHQLHINTKSLISWNYLRKDVEVVQSWNAEKLKVLPLAERLETLSNLSASLKCHLDEFLEDSKDSQIFSMTD 949          
BLAST of SMED30027315 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 56.225 bits (134), Expect = 8.504e-7
Identity = 36/159 (22.64%), Postives = 77/159 (48.43%), Query Frame = -1
Query: 5059 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR-QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP 5532
            WN+I +L +  + H+R  S Y ++ +D  + +  LK     I  + +  +     K  D L  ++++ +   L   + + +L  ++K I+ +  R  D   +  +  + +  Y   EI+++  +E ++ +NS+   WK+ +  G    +PSVC  +P P
Sbjct:  749 WNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEEKEQ-LLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQIEITIYKDDECILASNSHRAKWKVISPTGNEAMVPSVCFTVPPP 906          
BLAST of SMED30027315 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 56.225 bits (134), Expect = 8.794e-7
Identity = 55/233 (23.61%), Postives = 104/233 (44.64%), Query Frame = -1
Query: 4849 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ-DPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP--DVISSEKPISLRTQ--LTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNL 5532
            WN+I +L +  + H+R  S Y ++ +D  + +  LK     I  + +  +     K  D L  ++++ +   L   + + +L  ++K I+ +  R  D   +  +  + +  Y   EI+++  +E ++ +NS+   WK+ +  G    +PSVC  +P P  + + S   I    Q  LT   E  +N  S V   + +N  E       I  SK+     LL    + +L NL
Sbjct:  787 WNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEEKEQ-LLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQIEITIYKDDECILASNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDSANRIEQMYQSVLTLWHESHINMKSTVSWHYLMNEIE------GIRASKVSTIKTLLPGEHQQVLSNL 1012          
BLAST of SMED30027315 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 56.225 bits (134), Expect = 8.848e-7
Identity = 36/159 (22.64%), Postives = 77/159 (48.43%), Query Frame = -1
Query: 5059 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR-QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP 5532
            WN+I +L +  + H+R  S Y ++ +D  + +  LK     I  + +  +     K  D L  ++++ +   L   + + +L  ++K I+ +  R  D   +  +  + +  Y   EI+++  +E ++ +NS+   WK+ +  G    +PSVC  +P P
Sbjct:  797 WNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEEKEQ-LLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQIEITIYKDDECILASNSHRAKWKVISPTGNEAMVPSVCFTVPPP 954          
BLAST of SMED30027315 vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 54.299 bits (129), Expect = 2.418e-6
Identity = 36/159 (22.64%), Postives = 73/159 (45.91%), Query Frame = -1
Query: 5059 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR-QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP 5532
            W++I +L    + H++  S Y +F +D  E +  L+     I  + +  +   +I + + L     + +   L   + +  L   +K +V +  R  D   +  +  + +  Y   EI+++  +E V+ NNS+   WK+ +  G    +PSVC  +P P
Sbjct:  461 WSWILQLCQCVEQHIQENSAYFEFFNDAKEATDYLRNLKDAIQRKYS-CDRSSSIHKLEDLVQESMEEKEELLQYRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPP 618          
BLAST of SMED30027315 vs. Ensembl Mouse
Match: Plec (plectin [Source:MGI Symbol;Acc:MGI:1277961])

HSP 1 Score: 53.9138 bits (128), Expect = 3.363e-6
Identity = 41/185 (22.16%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQN-KVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K IV +  R    PV  +  ++  C   Y   E++VH  ++  ++  + P  WK+ +       +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  844 WSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYS-CDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVC--DYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQ 1025          
BLAST of SMED30027315 vs. Ensembl Mouse
Match: Plec (plectin [Source:MGI Symbol;Acc:MGI:1277961])

HSP 1 Score: 53.9138 bits (128), Expect = 3.536e-6
Identity = 41/185 (22.16%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQN-KVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K IV +  R    PV  +  ++  C   Y   E++VH  ++  ++  + P  WK+ +       +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  849 WSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYS-CDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVC--DYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQ 1030          
BLAST of SMED30027315 vs. Ensembl Mouse
Match: Plec (plectin [Source:MGI Symbol;Acc:MGI:1277961])

HSP 1 Score: 53.9138 bits (128), Expect = 3.840e-6
Identity = 41/185 (22.16%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQN-KVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K IV +  R    PV  +  ++  C   Y   E++VH  ++  ++  + P  WK+ +       +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  708 WSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYS-CDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVC--DYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQ 889          
BLAST of SMED30027315 vs. Ensembl Mouse
Match: Plec (plectin [Source:MGI Symbol;Acc:MGI:1277961])

HSP 1 Score: 53.9138 bits (128), Expect = 3.898e-6
Identity = 41/185 (22.16%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQN-KVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K IV +  R    PV  +  ++  C   Y   E++VH  ++  ++  + P  WK+ +       +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  544 WSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYS-CDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVC--DYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQ 725          
BLAST of SMED30027315 vs. UniProt/SwissProt
Match: sp|Q15149|PLEC_HUMAN (Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 1.990e-7
Identity = 42/185 (22.70%), Postives = 79/185 (42.70%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIV---PIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K +V   P H       +  +L  C   Y   E++VH  +E  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  841 WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYS-CDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVC--DYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQ 1022          
BLAST of SMED30027315 vs. UniProt/SwissProt
Match: sp|P30427|PLEC_RAT (Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 6.715e-7
Identity = 43/185 (23.24%), Postives = 81/185 (43.78%), Query Frame = -1
Query: 4996 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQN-KVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQ---LTKNWEQ 5532
            W+++ +L    + HL+  + Y QF  D+ E    L+K  + +  + +  +   T+   + L  + +D +         +  L   +K IV +  R    PV  +  +L  C   Y   E++VH  ++  ++  + P  WK+ ++ G    +PSVC  +P P+  + E    L  Q   L   W Q
Sbjct:  844 WSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYS-CDRSITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLLAVC--DYKQVEVTVHKGDQCQLVGPAQPFHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQ 1025          
BLAST of SMED30027315 vs. UniProt/SwissProt
Match: sp|Q03001|DYST_HUMAN (Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4)

HSP 1 Score: 58.5362 bits (140), Expect = 9.993e-7
Identity = 37/159 (23.27%), Postives = 75/159 (47.17%), Query Frame = -1
Query: 5059 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR-QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP 5532
            W++I +L    + H++  + Y +F +D  E +  L+     I  + +  +   +I + + L     + +   L   + I NL  ++K I+ +  R  D   +  +  + +  Y   EI+++  +E V+ NNS+   WK+ +  G    +PSVC  +P P
Sbjct:  787 WSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYS-CDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPP 944          
BLAST of SMED30027315 vs. TrEMBL
Match: A0A1R4A3Q6 (Mucin-like protein (Fragment) OS=Schistosoma mansoni OX=6183 GN=SmOPG1 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.804e-57
Identity = 135/413 (32.69%), Postives = 226/413 (54.72%), Query Frame = -1
Query: 4528 DIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPV---------SQNKVLGQCLYSYSSPEISVHDREEV-VILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVXXXXXXXXXXSH---VYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRE--TGDKRYSSNLDMLNKLHSDNKNELNRLLQSIE 5721
            +I+D+V++  S+L+YL  IS LEN ++ LT N+   ++  S  +   + + V K L+ NV  CW Y+++LA LSQVH+RNA++YHQFHH +NE  A LK R ++   +     P  T+K    LAN L++H ++ +HLW R  NL  ES++IVP+HLR   V         S + V+ + L S + P   + + EEV VI N  +   W +Q N G V +IPSVC+WI  PD+ + ++ + LR +  ++W+  + R    L  +Y  L  ++    +I        +N L D++ +LL N  D ++ EL   +     R+   + N  R+ H     +E +I+ MH+P+LR  DH + +  LR   +       N  RE     KR    L ++++L  +++++L++L+  ++
Sbjct:   66 EIRDDVKNNTSALRYLETISQLENSFTVLTENVTETSVQLSAPKELKDEVHVKKELTGNVKSCWTYVSQLARLSQVHIRNAAEYHQFHHAVNEAEASLKARVRMTEPRNTRALP-ATLKNCTILANELREHLNHMIHLWGRSGNLLEESRRIVPVHLRLGGVIDGLSTNTESASPVMARMLTSLTGPNYELKEGEEVRVISNKDDQHFWTVQTNNGIV-KIPSVCLWISDPDLEAVKRSVILREKCIESWDLLVERSRERLRSYYSCLLNQMAENGDIQYQHKIAMDNFLEDLRGLLLPN--DTRATELSQAIYAFTDRLKMTDINRQRSPHGGVFLREQDIVCMHSPLLRLRDHERQMDHLRAQSELAGTHMTNYLREIDADQKRVDQELSLIDQLQHESQSQLDQLINRVK 474          
BLAST of SMED30027315 vs. TrEMBL
Match: A0A4Z2DBR9 (SH3_10 domain-containing protein (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_002503 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.716e-55
Identity = 136/414 (32.85%), Postives = 230/414 (55.56%), Query Frame = -1
Query: 4528 DIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPV---------SQNKVLGQCLYSYSSPEISVHDREEV-VILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVXXX-XXXXXXXSHV---YKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRE--TGDKRYSSNLDMLNKLHSDNKNELNRLLQSIE 5721
            +I+D+V++  ++L+YL  IS LEN ++ LT N+   ++  S  +   + + V K LS+NV  CW Y+++LA LSQVH+RNA++YHQFHH ++E+ A LK R ++   +     P  ++K    LAN L++H ++ +HLW R  NL  ES++IVP+HLR   V         S N V+ + L S + P   + + EEV VI N  +   W +Q N G V +IPSVC+WI  PD+ + ++ + LR +  ++W+  + R    L  +Y  L   +    +I  +     +N L D++ +LL N  D ++ ELG  +     R+     S    +SH     +E +I+ MH+P+LR  DH + L +LR   +       N  RE     KR  + L ++++L  +++++L++L+  ++
Sbjct:   64 EIRDDVKNNTAALRYLETISQLENSFTVLTENVTETSVQLSAPKELKDEVHVKKELSSNVKSCWTYVSQLARLSQVHIRNAAEYHQFHHAVSEVEASLKARVRMTEPRSVRVLPP-SLKNCTILANELREHLNHMIHLWGRSGNLLEESRRIVPVHLRLGGVVDGLSTNTESPNPVMARMLTSLTGPNYELKEGEEVRVISNKDDQHFWTVQTNNGIV-KIPSVCLWISDPDLEAVKRAVILREKCIESWDLLVERSRERLRSYYARLLNNMAENGDIQYNHKTAMDNFLEDLRGLLLPN--DNRTSELGQAMYAFTDRLKMADISRQRSSSHGGINLREQDIVCMHSPLLRLRDHERQLENLRAQSEMIGTHMTNYLREIDADQKRVDNELSLIDQLQHESQSQLDQLISRVK 473          
BLAST of SMED30027315 vs. TrEMBL
Match: A0A430QC58 (SH3_10 domain-containing protein (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0004418 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 5.308e-54
Identity = 137/413 (33.17%), Postives = 231/413 (55.93%), Query Frame = -1
Query: 4528 DIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPV---------SQNKVLGQCLYSYSSPEISVHDREEV-VILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVXXXXXXXXXXSH---VYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRE--TGDKRYSSNLDMLNKLHSDNKNELNRLLQSIE 5721
            +I+D+V++  S+L+YL  IS LEN ++ LT N+   ++  S  +   + + V K L++NV  CW Y+++LA LSQVH+RNA++YHQFHH +NE  A LK R ++   + +   P  T+K    LAN L++H ++ +HLW R  NL  ES++IVP+HLR   V         S + V+ + L S + P   + + EEV VI N  +   W +Q N G V +IPSVC+WI  PD+ + ++ + LR +  ++W+  + R    L  +Y  L  ++    +I        +N L D++ +LL N  D ++ EL   +    +R+   + N  R+SH   V +E +I+ MH+P+LR  DH + +  LR   +       N  RE     KR    L ++++L  +++++L++L+  ++
Sbjct:   66 EIRDDVKNNTSALRYLETISQLENSFTVLTENVTETSVQLSAPKELKDEVHVKKELTSNVKSCWTYVSQLARLSQVHIRNAAEYHQFHHAVNEAEASLKARVRMTEPRNSRALP-ATLKNCTILANELREHLNHMIHLWGRSGNLLEESRRIVPVHLRLGGVIDGLSTNTESASPVMARMLTSLTGPNYELKEGEEVRVISNKDDQHFWTVQTNNGIV-KIPSVCLWISDPDLEAVKRSVILREKCIESWDLLVERSRERLRSYYSCLLNQMAENGDIQYQHKITMDNFLEDLRGLLLPN--DTRAVELNQAIYAFTERLKMTDINRQRSSHGGVVLREQDIVCMHSPLLRLRDHERQMDHLRAQSELAGTHMTNYLREIDADQKRVDHELSLIDQLQHESQSQLDQLINRVK 474          
BLAST of SMED30027315 vs. TrEMBL
Match: A0A5K4F489 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 3.477e-53
Identity = 135/409 (33.01%), Postives = 224/409 (54.77%), Query Frame = -1
Query: 4540 DIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPV---------SQNKVLGQCLYSYSSPEISVHDREEV-VILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVXXXXXXXXXXSH---VYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRE--TGDKRYSSNLDMLNKLHSDNKNELNRLL 5721
            +I+D+V++  S+L+YL  IS LEN ++ LT N+   ++  S  +   + + V K L+ NV  CW Y+++LA LSQVH+RNA++YHQFHH +NE  A LK R ++   +     P  T+K    LAN L++H ++ +HLW R  NL  ES++IVP+HLR   V         S + V+ + L S + P   + + EEV VI N  +   W +Q N G V +IPSVC+WI  PD+ + ++ + LR +  ++W+  + R    L  +Y  L  ++    +I        +N L D++ +LL N  D ++ EL   +     R+   + N  R+ H     +E +I+ MH+P+LR  DH + +  LR   +       N  RE     KR    L ++++L  +++++L++L+
Sbjct:   66 EIRDDVKNNTSALRYLETISQLENSFTVLTENVTETSVQLSAPKELKDEVHVKKELTGNVKSCWTYVSQLARLSQVHIRNAAEYHQFHHAVNEAEASLKARVRMTEPRNTRALP-ATLKNCTILANELREHLNHMIHLWGRSGNLLEESRRIVPVHLRLGGVIDGLSTNTESASPVMARMLTSLTGPNYELKEGEEVRVISNKDDQHFWTVQTNNGIV-KIPSVCLWISDPDLEAVKRSVILREKCIESWDLLVERSRERLRSYYSCLLNQMAENGDIQYQHKIAMDNFLEDLRGLLLPN--DTRATELSQAIYAFTDRLKMTDINRQRSPHGGVFLREQDIVCMHSPLLRLRDHERQMDHLRAQSELAGTHMTNYLREIDADQKRVDQELSLIDQLQHESQSQLDQLI 470          
BLAST of SMED30027315 vs. TrEMBL
Match: G7YKJ4 (SH3_10 domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CLF_110325 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.778e-51
Identity = 130/410 (31.71%), Postives = 220/410 (53.66%), Query Frame = -1
Query: 4531 DIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR----QDPVSQNK-----VLGQCLYSYSSPEISVHDREEVVILNNS-NPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVXXXXX-XXXXXSHVYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRE--TGDKRYSSNLDMLNKLHSDNKNELNRLLQSI 5721
            +++ +++S  ++L+YL  IS LE  ++ LT N+   ++  S  +  +E++ V K L  NV  CWNY++ L+ LSQVH+RNA++Y QFHH +NE+ A L +R K+     A       I  +  LAN L+DH ++F+HLW R   L  ES+++VP+HLR     + +S N      V+ + L S + P   + + EEV I++N+ +P  WK+Q + G V E+PSVC+WI  PD+ + ++ I+ R +  ++WE  ++R    L  +Y  +   +    ++  S  +   + L D+   LL   +D  + EL   L   Q ++         R++ V +E +I+ MH+P+LR  DH   +RSL    QF      +  RE     +R    L  +  L  D++ +L  L+  +
Sbjct:  309 ELRSDIKSNSAALRYLETISRLERSFTVLTENVSETSVQLSSPKALTESVYVKKDLGGNVQSCWNYVSNLSRLSQVHIRNAAEYQQFHHAVNEVEAKLSRRIKMTHPDHAR-PLDEDITGAHVLANELRDHLNHFIHLWNRTGQLLEESRRVVPVHLRLGGVNNGLSTNTEVPSVVMARALLSLAGPNYELAEGEEVRIVSNTDDPHFWKVQTSSGIV-EVPSVCLWISDPDLGAVKRAITAREKCVESWELAVDRMRERLRTYYTRMLSHMAENGDVYYSSKNVMQHFLDDLD--LLYPPSDASAVELKRALNRFQDKLQLVERGRQPRDAFVLREQDIVSMHSPLLRLRDHENQMRSLNVQAQFIGQHMAHYLREIDADRRRMDDELKRMTSLQRDHQTQLEHLISRV 714          
BLAST of SMED30027315 vs. Ensembl Cavefish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 71.633 bits (174), Expect = 1.223e-11
Identity = 54/227 (23.79%), Postives = 107/227 (47.14%), Query Frame = -1
Query: 4870 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRT---QLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVS-KIDYFNNLLRDVQ 5532
            W++I +L    + HL+  + Y+QF  D+ E    +KK    +  +        + +  D + + L D +       T++  L   ++ I+ +  R   +P+   + + Q +  +   EI+VH  EE  +LNNS P  WK+ N  G    +PSVC  +P  +  + E   +L     Q+T  W++       +L   Y+    +++   NI+++ K+D +  +LR+++
Sbjct:  670 WSWILQLCCCIEAHLKENTAYYQFFADVKEADEKMKKMQDTMKKKYTCDRSTTSTRLEDLVKDAL-DEKEQLNEFKTQLAGLNKRARSIIQLKPRNPTNPIKGKQPV-QAVCDFKQMEITVHKGEECALLNNSQPSNWKVLNRSGAEAIVPSVCFLVPPVNKEAVESVSNLDAGLQQMTTLWQRLHIDMKSLLSWQYLMKDIQIIRSWNITMTMKVDEYRQILRNLE 894          
BLAST of SMED30027315 vs. Ensembl Cavefish
Match: pleca (plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984])

HSP 1 Score: 69.3218 bits (168), Expect = 6.171e-11
Identity = 44/177 (24.86%), Postives = 82/177 (46.33%), Query Frame = -1
Query: 5008 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ--DPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTK 5532
            W+++ +L    + HL+  + Y QF  D+ E    ++K  + +  +    +   T+   + L  +  D +       T +D L   +K I+ +  R    PV + K+  Q +  +   EI+VH  +E  +LNNS P  WK+++  G    +PS+C  +P  +  + E    L + L K
Sbjct:  618 WSWMLQLCCCIETHLKENTAYFQFFSDVKEAEERMRKMQESMKKKYV-CDRSITVTRLEDLLQDAVDEKEQLTEFKTHLDGLNRRAKTIIQLKPRNPATPV-KGKLPVQAVCDFKQMEITVHRGDECALLNNSQPFKWKVRSTSGSEATVPSICFIVPPTNKEAVESTSGLDSSLQK 792          
BLAST of SMED30027315 vs. Ensembl Cavefish
Match: ENSAMXT00000038112.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:36528525:36546960:1 gene:ENSAMXG00000043116.1 transcript:ENSAMXT00000038112.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 7.713e-8
Identity = 39/161 (24.22%), Postives = 74/161 (45.96%), Query Frame = -1
Query: 5056 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR--QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPD 5532
            W+++ +L Y  + HL+  + Y  F +D  E    LK     IS +       G  +  D +  ++ D +   L   + +  L   +K +  +  R  + PV +  +  + +  Y   EI+++  +E V+ NNS+   WK+ +  G    +PSVC  +P P+
Sbjct:  458 WSWVLQLCYCVEQHLKENAVYFDFFNDAKESMDYLKSLQDSISRKYGCDRTSGLHRLEDLIQESM-DEKEQLLQYRSTVAGLVGRAKSVGQLKPRNPESPV-RTSIPVKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPSGNEAMVPSVCFSVPPPN 616          
BLAST of SMED30027315 vs. Ensembl Cavefish
Match: evplb (envoplakin b [Source:ZFIN;Acc:ZDB-GENE-030131-212])

HSP 1 Score: 58.9214 bits (141), Expect = 8.781e-8
Identity = 48/179 (26.82%), Postives = 80/179 (44.69%), Query Frame = -1
Query: 5011 VNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESD-QLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLT 5544
            V   W     L    + HL N   Y ++  D   IS  LK+    I+   +  EP    K S+ Q+   L+  +        R+ +L+    K+VP+ LR+   +   V+  C   +S+ + SV   E+  ++++     W+++NN G+   IP VC  IP PD  + E+  SL   L 
Sbjct:   63 VQKKWEQFLSLLICQEAHLNNVEDYKKYQLDAETISESLKR----IN---STMEPSLLSKMSNPQILMQLEGEERAVQRNERRLADLREFCTKVVPLPLRRSTTTSLPVVALC--DWSADKASVKRGEKYTLVSSPTNENWEVKNNLGDTKIIPGVCFVIPPPDRDAIERVDSLEQDLA 232          
BLAST of SMED30027315 vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 56.6102 bits (135), Expect = 4.027e-7
Identity = 41/183 (22.40%), Postives = 84/183 (45.90%), Query Frame = -1
Query: 4987 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQ-DPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLN 5532
            W ++ +L    + HL++ + Y QF  D  E    L++    I  Q          K  D L +++++ +   +   + + +L   +K IV +  R  D +       + +  Y   EI+V+  EE V+ +NS    WKI +  G    +PSVC  +P P+    ++ I + +++ + ++  ++
Sbjct:  722 WQWVRQLCVCVEQHLKDNTAYFQFMSDARECETYLRQLQDTIKRQYTCDRNSRLGKLEDLLQDSMEEKEQ-LIEYRSSVASLVGRAKTIVQLRPRSVDCIVGTTTPIRAICDYKQIEITVNKGEECVLEDNSQRTKWKIISPTGNEAMVPSVCFTVPPPN----QEAIDIASRMEQQYQNVMS 899          
BLAST of SMED30027315 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007587.1 (pep scaffold:Pmarinus_7.0:GL476641:205588:235369:-1 gene:ENSPMAG00000006815.1 transcript:ENSPMAT00000007587.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 2.235e-8
Identity = 44/169 (26.04%), Postives = 76/169 (44.97%), Query Frame = -1
Query: 5059 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLK-------KRWKV-ISNQIANFEP--KGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR-QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP 5532
            WN++ +L    + HL   + Y QF  D  E+   L        +++K   S  +   E   +  I+E +QL+       SY     +R++NL   +K +V +  R  D      +  + +  Y   EI++H   E V+ +NS    WK+ ++ G    +PSVC  +P P
Sbjct:  525 WNWVLQLCSCVETHLAENTAYFQFFQDAKEVEQQLNNLQDTIWRKYKCDKSTSLTRLENLLQDAIEEKEQLS-------SYK----SRVNNLASRAKTVVQLKPRNPDSFLHGTIPIRAICDYKQLEITLHKNAECVLEDNSQRSRWKVISSSGSEAMVPSVCFSVPTP 682          
BLAST of SMED30027315 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004845.1 (pep scaffold:Pmarinus_7.0:GL477442:57807:78762:-1 gene:ENSPMAG00000004379.1 transcript:ENSPMAT00000004845.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 5.671e-7
Identity = 53/264 (20.08%), Postives = 113/264 (42.80%), Query Frame = -1
Query: 5047 LTNNFLNNFYHSRLQDDRTNRTAAQILDIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQ--NFSENMLVNKSLS--------NNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIP--GPDVIS 5802
            L  + ++N  HS +Q D ++R                 +L Y+      EN+      N    A   S+NQ  +  E +L  K  +        + V + W     L    + HL+  +++H+F+ D+ E +  L K+   +  +    +P  ++   ++L   +++ +         +  L+  + ++VP+  R++ + +   + + L  Y   E+ +H  ++  + +NS+   W + N+ G+   +PS C  IP   PD I+
Sbjct:  190 LVQSLVHNLVHSLVQQDWSDR-----------------NLDYVVRTRKYENIV-----NNELVAKEASINQIQDEGEKLLAAKHPAKPTIEAHMDAVENDWKRYLNLLICEEAHLKFMTEHHKFNKDVKESNEWLTKQSSKVKRRY-TVDPNDSVLRVEELLKEVQEKEKEMDAYEKNVVALKNRATQMVPLKYRREKIPKPLTV-ETLCDYEDGELVLHRGDKYTLKDNSDKENWVVSNSAGKTETVPSACFVIPPTDPDSIA 429          
BLAST of SMED30027315 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008465.1 (pep scaffold:Pmarinus_7.0:GL476656:166292:202932:-1 gene:ENSPMAG00000007665.1 transcript:ENSPMAT00000008465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.839e-6
Identity = 35/160 (21.88%), Postives = 75/160 (46.88%), Query Frame = -1
Query: 5059 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLR--QDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGP 5532
            W+++ +L      HL+N   Y QF  D  +    LK R + + ++    +   ++   ++L + +   +    +    + NL   +K +V +  R   +PV QN++  + L  Y + E+ +   ++ ++ NNSN + W+     G   ++ S+C  +P P
Sbjct:  166 WSWMLQLTQSIDSHLQNNMAYFQFFEDAKQTEQTLKARQEKMRSKYT-ADKTSSVAHLEELLDGIMAEKESLFNYNRTVANLAGRAKAVVQLKPRNPANPV-QNQIPLKALCEYKTEEVLIKPNDQCILRNNSNRIKWRGIGPGGRDIDLLSLCFQVPPP 323          
BLAST of SMED30027315 vs. Ensembl Nematostella
Match: EDO37708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF38])

HSP 1 Score: 56.6102 bits (135), Expect = 1.752e-7
Identity = 28/82 (34.15%), Postives = 48/82 (58.54%), Query Frame = -1
Query: 5053 IDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDV 5298
            I +LQ+ SK++ P+  R+  + Q K   + + SY + + +V   EE  + +N+    WK+ ++ GE  E+PSVC  IP PD+
Sbjct: 1023 ISSLQLLSKQVTPMKQRKSKLRQ-KTSVKAVCSYKNMQNTVEQGEEYTLFDNTEHHAWKVASSPGEQSEVPSVCFVIPAPDL 1103          
BLAST of SMED30027315 vs. Ensembl Medaka
Match: ENSORLT00000042543.1 (epiplakin [Source:NCBI gene;Acc:101165224])

HSP 1 Score: 77.7962 bits (190), Expect = 1.585e-13
Identity = 52/197 (26.40%), Postives = 98/197 (49.75%), Query Frame = -1
Query: 4948 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANF--EPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINL 5532
            W+++ ++    +VHL+    +HQF  +++E ++ L+K  +VI   I NF  + + ++++  +L   L+  +   +    R+ NL  +SK IV +  R      N ++ + L  Y   E  +H   E ++ +NS    W +    G    +PSVC+ IP P+ +S    I++ T++    EQC +    V    YIN+
Sbjct:  365 WSWLLQITKCIEVHLKENGAFHQFFKEVDETNSALQKEREVI---IKNFSCDKETSLEDLMELLKGLEKEKETIMDHKRRVQNLVSKSKSIVRLKERSPDEKSNSIVVKALCDYKEDEKVIHTGNEAILKDNSQRSKWIVTGPGGLEMTVPSVCLIIPPPNPLS----INIATKV----EQCFDAIMSVWNQLYINM 550          
BLAST of SMED30027315 vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 72.7886 bits (177), Expect = 5.959e-12
Identity = 54/241 (22.41%), Postives = 109/241 (45.23%), Query Frame = -1
Query: 4825 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIP--GPDVISSEKPISLRTQ-LTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKEL 5532
            W++I +L    + HL+  + Y QF  D+ E    +KK    +  +    +   T+   + L  +  D +       T ++ L+ ++  IV +  R +P +  + K+  Q +  +   EI+VH  +E  +LNN+ P  W++ NNKG    +PS+C  +P    D ++S   +    Q L   W+        +L   Y+     ++N  N    +++ +   LR++++     L D +  ++
Sbjct:  686 WSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYT-CDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPR-NPTTPIKGKLPIQAVCDFKQMEITVHRGDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTWNFKTLRVEEYRLALRNLEQHYQEFLRDSQDSQM 924          
BLAST of SMED30027315 vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 71.2478 bits (173), Expect = 1.552e-11
Identity = 56/244 (22.95%), Postives = 112/244 (45.90%), Query Frame = -1
Query: 4825 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIP--GPDVISSEKPISLRTQ-LTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSK---IDYFNNLLRDVQEVLLMNLTDVKSKEL 5532
            W++I +L    + HL+  + Y QF  D+ E    +KK    +  +    +   T+   + L  +  D +       T ++ L+ ++  IV +  R +P +  + K+  Q +  +   EI+VH  +E  +LNN+ P  W++ NNKG    +PS+C  +P    D ++S   +    Q L   W+        +L   Y+     ++N  N+S+ K   ++ +   LR++++     L D +  ++
Sbjct:  727 WSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYT-CDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPR-NPTTPIKGKLPIQAVCDFKQMEITVHRGDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTWNVSMFKTLRVEEYRLALRNLEQHYQEFLRDSQDSQM 968          
BLAST of SMED30027315 vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 71.2478 bits (173), Expect = 1.566e-11
Identity = 56/244 (22.95%), Postives = 112/244 (45.90%), Query Frame = -1
Query: 4825 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIP--GPDVISSEKPISLRTQ-LTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSK---IDYFNNLLRDVQEVLLMNLTDVKSKEL 5532
            W++I +L    + HL+  + Y QF  D+ E    +KK    +  +    +   T+   + L  +  D +       T ++ L+ ++  IV +  R +P +  + K+  Q +  +   EI+VH  +E  +LNN+ P  W++ NNKG    +PS+C  +P    D ++S   +    Q L   W+        +L   Y+     ++N  N+S+ K   ++ +   LR++++     L D +  ++
Sbjct:  741 WSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYT-CDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPR-NPTTPIKGKLPIQAVCDFKQMEITVHRGDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTWNVSMFKTLRVEEYRLALRNLEQHYQEFLRDSQDSQM 982          
BLAST of SMED30027315 vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 71.2478 bits (173), Expect = 1.591e-11
Identity = 56/244 (22.95%), Postives = 112/244 (45.90%), Query Frame = -1
Query: 4825 WNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVS--QNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIP--GPDVISSEKPISLRTQ-LTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSK---IDYFNNLLRDVQEVLLMNLTDVKSKEL 5532
            W++I +L    + HL+  + Y QF  D+ E    +KK    +  +    +   T+   + L  +  D +       T ++ L+ ++  IV +  R +P +  + K+  Q +  +   EI+VH  +E  +LNN+ P  W++ NNKG    +PS+C  +P    D ++S   +    Q L   W+        +L   Y+     ++N  N+S+ K   ++ +   LR++++     L D +  ++
Sbjct:  692 WSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYT-CDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPR-NPTTPIKGKLPIQAVCDFKQMEITVHRGDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTWNVSMFKTLRVEEYRLALRNLEQHYQEFLRDSQDSQM 933          
BLAST of SMED30027315 vs. Planmine SMEST
Match: SMESG000023005.1 (SMESG000023005.1)

HSP 1 Score: 2543.07 bits (6590), Expect = 0.000e+0
Identity = 1269/1272 (99.76%), Postives = 1270/1272 (99.84%), Query Frame = -2
Query:    3 RNPKKLLIDSMTQIGCFTESVSTQANLEKKTLSQNAFQMDAMTQISTLVNDRIVQTVAKSKPKKMKRDCQTQIGTLKNEMVTQTNIHCKSKAIQKSTLQLDAITQLSILNKDADLQTDPIGEDFLDEVDLLRSGPRKTVIYIRDNSTDMDSIGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQSDLEIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDESTQWGIIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTEELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWNDVEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESILPKEYSNKETQPESEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKEMINQRSFGLELIDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDDI 3818
            + PKKLLIDSMTQIGCFTESVSTQANLEKKTLSQNAFQMDAMTQISTLVNDRIVQTVAKSKPKKMKRDCQTQIGTLKNEMVTQTNIHCKSKAIQKSTLQLDAITQLSILNKDADLQTDPIGEDFLDEVDLLRSGPRKTVIYIRDNSTDMDSIGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQSDLEIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDESTQWGIIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTEELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWNDVEEGSQSSSGLKSKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFYKTESILPKEYSNKETQPESEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKEMINQRSFGLELIDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSG IMDDI
Sbjct:  704 KKPKKLLIDSMTQIGCFTESVSTQANLEKKTLSQNAFQMDAMTQISTLVNDRIVQTVAKSKPKKMKRDCQTQIGTLKNEMVTQTNIHCKSKAIQKSTLQLDAITQLSILNKDADLQTDPIGEDFLDEVDLLRSGPRKTVIYIRDNSTDMDSIGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQSDLEIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDESTQWGIIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTEELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWNDVEEGSQSSSGLKSKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFYKTESILPKEYSNKETQPESEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKEMINQRSFGLELIDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDI 1975          

HSP 2 Score: 1264.21 bits (3270), Expect = 0.000e+0
Identity = 699/715 (97.76%), Postives = 699/715 (97.76%), Query Frame = -1
Query: 3832 MALDIDLDVFRNRLADCKDRSQNLHFGVSSKSLKVXXXXXXXXXXXXXXXXXXLKYKVLTNNFLNNFYHSRLQDDRTNRTAAQILDIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVXXXXXXXXXXSHVYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRETGDKRYSSNLDMLNKLHSDNKNELNRLLQSIESMPNETYKHRHSQEFIHHSKFHDHTNRDHRQYXXXXXXXXXXXXXXXXXXXXXHTQLKPDRRNVHSEVFSPSTSLSVSDAQLNRHDARDAHNFYSSDNFIDNEAELNQEYSEHVKASYSLPMALNNTDIQSIXXXXXXXXXXKTWKVDSQTQLGVTVRDSKIQCNPTMYDVSTFIQDEIFSTTGXXXXXXXXXXXXXSPQKYQLDAQTQIGVLFKDSSTQSEMNSTFSVPVS 5976
            MALDIDLDVFRNRLADCKDRSQNLHFGVSSKSLKVEEHRQQLILQELRELENNLKYK                DDRTNRTAAQILDIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVNSRNSNDSRNSHVYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRETGDKRYSSNLDMLNKLHSDNKNELNRLLQSIESMPNETYKHRHSQEFIHHSKFHDHTNRDHRQYLSASDLSHSHHYHLNSSHLESHTQLKPDRRNVHSEVFSPSTSLSVSDAQLNRHDARDAHNFYSSDNFIDNEAELNQEYSEHVKASYSLPMALNNTDIQSIKSKSHHPPKKKTWKVDSQTQLGVTVRDSKIQCNPTMYDVSTFIQDEIFSTTGSSIASSKQFSKSMSPQKYQLDAQTQIGVLFKDSSTQSEMNSTFSVPVS
Sbjct:    1 MALDIDLDVFRNRLADCKDRSQNLHFGVSSKSLKVEEHRQQLILQELRELENNLKYK----------------DDRTNRTAAQILDIKDEVESGISSLKYLGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVNSRNSNDSRNSHVYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISRETGDKRYSSNLDMLNKLHSDNKNELNRLLQSIESMPNETYKHRHSQEFIHHSKFHDHTNRDHRQYLSASDLSHSHHYHLNSSHLESHTQLKPDRRNVHSEVFSPSTSLSVSDAQLNRHDARDAHNFYSSDNFIDNEAELNQEYSEHVKASYSLPMALNNTDIQSIKSKSHHPPKKKTWKVDSQTQLGVTVRDSKIQCNPTMYDVSTFIQDEIFSTTGSSIASSKQFSKSMSPQKYQLDAQTQIGVLFKDSSTQSEMNSTFSVPVS 699          

HSP 3 Score: 495.738 bits (1275), Expect = 2.192e-141
Identity = 426/1254 (33.97%), Postives = 651/1254 (51.91%), Query Frame = -2
Query:    3 HLI---EANVQTNNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQ---SDLEIVKQ----KGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEK----SSPIGLELKDESTQWGIIPIDNEIEHGM-KKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE------------------ELLFMEPMG-LLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQ---------VQSSFFEAETETISLARNEFEMNEREW------------------TVKT---TENKETQIGCSRLDGDFETSCQTGHIVKDFESQTEND-------------------------YTEHQIQLVTM-ANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMT------------LTDGEIQWNDVEEXXXXXXXXXXXXXXXXX--SRLNADYEASCQTGHIVNEIETQTEFFY--KTESI---------LPKEYS-----NKETQPE-------SEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQ--TDQIGSEKEMINQRSFGLE-------LIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKK---EYTEKEIQ------PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI-FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQ----PDFVSE--KSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPI-TLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDI--DDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQ-----CNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDDI 3281
            HL+   E+  Q     +   T + + +   EIL    K   D EIQ   +D  I +     K KKVQ+G  +L E  +  CQ G ++ +  +Q +   +F+I+ N++    +S    +L DE+TQ+   P+   I     +K KKLQ+G  RL+G+ E SCQTG ++ +   QT+                  E LF EPM     KEIQ +  +    +     K KKVQVG+P+  + +DVECQ         VQ    E   E     R E  + ER +                  T+     T+ K+ Q+G  RLD DFE SCQTGH++ D E QTE D                         Y E +IQ  T   ++ Q VK++ K KK+QVG+P+LN S E   Q G  ++D  +Q ++ E  I                L +  IQ++D        S  + K+ +      RL+ D E SCQTGH++ + + QTEF +   T +I         + ++YS      KE Q E        +    K KKIQVG+  +++ SE E Q    + ++ +Q  TD+      +I+ +   LE       LI EE+QY    ++ RL  +  ++GK +Q+G  KL  +L+ SCQ G++  ++ECQT  EF +   +I+     L  Q+   ES  K    + +KEIQ       I   +    K KKIQVGH +LN++ EVECQS   ++++ VQTE+DEF+I E + +N   +LF +++I+ES Q+  +++  T+  PKE + K  QVG+ R+  D++ SCQ GHL+   E QT+ +  +  +T    +  +  S+ + R   ++ EKE+Q     +  SE  K+ KSKKVQVGHPRLN+NL+VECQSG L++++ +Q E++E +I  + + N   ++  +++IEE  QY+ E +     ++   KGKKLQ G+S+LE D + SCQTGHL+ +SE QTE D+    +   I L ++      E   KEY+++E+Q +   D ++  +  N K KKVQVG+PRLN  +  ECQS  ++ +  +Q E +E +     +RNLE  L   ++I+E+TQ      N  +  P + K    GKKLQVG++RL  DF+ SCQTGH++ +   QTEI+  + ++ I   +   ++ E   ++ I   E EIQ +         +  +KSKKVQVGHPRLNE L+VECQSG +MDDI
Sbjct: 2521 HLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVD-EFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIE----ERKEKNLEERLFVEDLIEEATQYDEENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQTEIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTK-KSKKIQVGHPRLNKSLEGECQSGCIMDDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFI----IIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQT--EFDNNNEIIS---LSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPI--KSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEID--NEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTV--TITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKAN-KSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVEEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIK----GKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTI--TMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDI 3746          

HSP 4 Score: 467.233 bits (1201), Expect = 2.109e-132
Identity = 422/1302 (32.41%), Postives = 651/1302 (50.00%), Query Frame = -2
Query:    3 NKDADLQTDPIGEDFLDEVDLLRSGPRKTVIYIRDNSTDMDSIGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQT--NNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQSDL-------EIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEK----SSPIGLELKDESTQWGIIPIDNEIEHGMKK-NKKLQIGNSRLEGNLESSCQTGHVVDEFHTQT-------------------EELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREW-----------------------------TVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTE-ND-------------------------YTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMT------------LTDGEIQWNDVEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESIL--P-KEYSNKETQPES-------EMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTD----QIGSEKEMINQRSFGLE-LIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYKAS-----NKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI-FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQ------PDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITL-KTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQ-TQFQNELLFKEYVDQEVQLD-IDDFTGPIPRNTKC---KKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVID---RNLEAFLVNKEMINEATQCNF-DLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSIS-LREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDDI 3491
            NK+ +L+     ED +DE       P K +I         +S+ ++K K++Q G  +L G+ E S QT   + ++  QT  N+ VE       +     ++  +  K+  + EIQ +        +I   K KKVQ+G  +L E  +  CQ G ++ +  +Q +   +F+I+ N++    +S    +L DE+TQ+   P+   I    KK  KKLQ+G S++ G+LE SCQTGH+V +  +QT                   EE+L         KEIQ +       +     K KKVQVG+P+  + +DVECQ   S +  +   +    +EF + E +                              +++  + K+ Q+G  RLDGDFE SCQTG I+KD E QT+ ND                         Y E +IQ  T  ++        K KKVQVG+P+LN   +   Q G  ++D  +Q +  E  I                L D   Q++D  E  + +     K  +  +  L  D E+  Q     +++ T T     +E IL  P K+Y +KE Q E+            K KK+QVG+P +N+I + E Q    + +  +Q +     I   KE   + S  +E LIDE  QY    ++  + ++   +GK +Q G P+L  + + SCQ G +  ++ECQTD   S E L IT    +   +  L +   KEY EKEIQ     Y  S     NK KK+QVGHP+LNE ++VECQS   +++I VQ E+DEF+IEE + KN    LFVE++IEE+ QY  +++  TI    ET+ K  QVG PR+++D++ SCQ GHL+ + E QT  E  +  +T    +  +  S+ + +    ++EKE+Q       D    K++KSKK+QVGHPRLN +L+ ECQSG +++++ +Q E DEF+IE+  + N   +   +++IEE +QY  E+     L +   K KKLQ G+ RL+ D + SCQTGHL+ +S+ QTE D         I L ++   Q   +    +  ++E+Q + IDD      R+ KC   KK+QVG+ +L+    AECQ+  ++ +  +Q E D+    ++ID    +LE  L    +I+E  Q +  D+      +    GK +Q G S+L +D +ASCQTGH++ D   QTE +    + +I   L   +F E +S   I    + EIQ D     S+  ++  KSKK+QVGH RLN+  +VECQSG IMDD+
Sbjct: 1989 NKEQNLEASLFIEDLIDEATQYDDEPVKGII---------NSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVD-EFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQ---SGYIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDD--EPVKLTIVSNKKDWKEITRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEK--LFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEERKEKNLEERLFVEDLIEEATQYDEENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQT--EIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTKKSKKIQVGHPRLNKSLEGECQSGCIMDDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDT--SAITLVSKDFNQVARKYSLTDLAEKEIQFELIDD---SFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKF---IIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDN--NNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCD-SIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDV 3260          

HSP 5 Score: 449.899 bits (1156), Expect = 5.656e-127
Identity = 420/1280 (32.81%), Postives = 654/1280 (51.09%), Query Frame = -2
Query:    3 KNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQT--NNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQ------SDLEIVK-QKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEK---SSPIGLELKDESTQWG--IIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE--ELLFMEPMGLLSKEIQSDIESADKYQIRLEM----------------KGKKVQVGYPQTYDRIDVECQ---------VQSS---FFEAETETISLARN-----------EFEMNEREWTV---KTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTE--------------NDYT-------------EHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDS------------------IEEYINPMTLTDGEIQWNDVEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESIL--------------P-KEYSNKETQPES-EMAITK------GKKIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKE----MINQRSFGLELIDEELQYYGSLQDRLGNE-----LFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQ-----PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI-FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIV-----RTTTEFIEKEVQPDF------VSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLR-PITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELL--FKEYVDQEVQLD-IDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVV--IDRNLEAFLVNKEMINEATQ-----CNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSIS-LREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDDI 3353
            K K++Q G ++L+ + E S QT + ++ +  QT  +NE+ D  T++ +     E L +EP +  + EIQ      S  E VK  K KKVQ+G  +L E  E  CQ G ++ +  +Q +     ++ + E+   +S +  +L +ESTQ+   +I + N ++  +K  KKLQ+G S+LEG+LE SCQTGH++ +   QTE  +L     + L SK+   + E + K  +  E+                K KKVQVG+P+  + ++VECQ         VQ     F   ET+  +L  +           +++     +T+   K  + K+ Q+G  RLD D E SCQTGH++ D   QT+               D++             + +IQ  T  ++        K KKVQVG+P+LN + E   Q G  ++D  +Q +                   I++ I   T  DGE+    +   +     +K KKLQ G+ +L  D E SCQTGH++ + E QTEF   T++++              P KEY  KE Q E  E + T+        K+QVG+P +++  E E Q        SI  D     +     M++ +   LE        +G L D L NE     +  +GK +Q G P+L  EL+ SCQ G++  ++ CQTD +   +  +IT    +   +  L     KE+ EKE+Q          +  +NK KK+QVGHP+LNE ++VECQ+   +++I VQ +++EF+I E + +N  A LF+E++IEES QY   ++  T    KE + K  QVG  R++ D + SCQ GHL+ E E QT+   FD    +IT +   L +Q+       R+  EF+ KE+Q +       +S+KS KSKKVQVGH +L++ ++VECQSG +++E+ +Q ELDEF+I +  + N   +   E++IEE  QY+ ENL   I++   TKGKKLQ G S+L+ D + SCQTG L+  SE QTE +E       +I +      F +  +   K+++++E+Q D +D+      + TK  KVQ+G  R+N     ECQS  ++ +  +Q + +E   E++   +R +EA L   ++I+E TQ      N  ++   + K    GKKLQVG+ RLE D D SCQ GH+V D   QTE  +++      S     +F E+ ++  +    E EIQ +     S  I N+  SK VQVG  RL E  DVECQ+  + DD+
Sbjct: 3635 KGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEI-DTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVK-GKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVDEFMIMETKERNLEASLFVEDLIDEATQYDDKNLHFTIAAHKDVKGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFSVEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGNKEQNLEVSRLIDDLIEESTQYDGEV----IIVTNAMQKEVKGKKLQVGTPKLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGEKNENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRLDENREVECQ------SGSIMDDVEVQTEVVEVMMLDNKERSLE--------FGFLFDDLINESIQYNVAVKGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTER--LNREFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTE---FDEKVDEITFL---LNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNE-------QIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINE--SEIIESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYK----GKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRS-----DFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDV 4868          

HSP 6 Score: 443.351 bits (1139), Expect = 5.764e-125
Identity = 418/1269 (32.94%), Postives = 644/1269 (50.75%), Query Frame = -2
Query:    3 KNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTN-NEVEDYATLSENGMLEYEILTQEPKQTIDVEIQ------SDLEIVK-QKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGL---ELKDESTQWG------IIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE------------------ELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQ---------VQSSF------------FEAETETISLARNEFEMNEREWTV-----KTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTEND-------------------------YTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMT-------------LTDGEIQWND--VEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTE----SILPKEYS-------------NKETQPES-------EMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQ-----IGSEKEMINQRSFGLELIDEELQYYGSL---QDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSD--EELVITEVQAELQSQNVLMESKKKEYTEKEIQ--PILTFYK---ASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQ-PDF-----VSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPIT-LKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFK---EYVDQEVQLDIDDFTGPIP-RNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGI-GKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDDI 3353
            K K++Q G SKL G+ E S QT + +I++  QT  +++ D  T++ N     E      K+ ++ EIQ      S  E VK  K KKVQ+G  +L E  E  CQ G ++ +  +Q + +   +++  E++    L   +L DESTQ+        + +  EI     K KKLQ+G++RL  + E SCQTGH++     QTE                  E LF EP+    KEIQ +       +     K KKVQVG+P+  + ++VECQ         VQ                EA      L     + ++    V     K  + K+ Q+G S+L+GD E SCQTGH++ D E QTE D                         Y E +IQ  T  ++        K KKVQVG+P+LN + E   Q G  ++D  +Q + ++E++   T             L D   Q++D  +     +   +K KKLQ G+ RL+AD E SCQTGH++ +   QT+     +    +  P+++S             +KE Q E+           +K KK+QVG+P +N+  E E Q    + +  +Q +      +G++++ +       +LI+E  QY G +    + +  E+  +GK +Q G+PKL  +L+ SCQ G++  ++ECQT  EF D  + ++IT    +   +N   E+  KEY EKE+Q  PI   Y     +    K+QVG P+L+E  EVECQS   ++++ VQTE+ E ++ + + ++       +++I ES+QY              + K  Q+G PR++ + + SCQ GHL+ +   QTD +           + D  E  N      EF EKEVQ  DF     + +++ KSKKVQVGHPRLN++LDVECQ+G L++++E+Q +L+EF+I +    N       E++IEE  QY+  NL   T +    KGKKLQ G+SRL++D + SCQTGHL+TESE QTE DE   K+D+   L N Q  F  E   +   E+V++E+Q +  D T  I  ++ K KKVQVG+ +L+  +  ECQS  ++    +Q E DE +     +RNLEA L+ +++I E+TQ + + +      L    GKKLQVG S+L+ D + SCQTG ++ +   QTE  E    I+I   +   +F ++  +      E E+Q D      +    + KS KVQ+G  R+NE  +VECQSG +MDD+
Sbjct: 3473 KGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVEEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEI-----KGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE-VDEFMIMETKERNLEASLFVEDLIDEATQYDDKNLHFTIAAHKDVKGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFSVEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGNKEQNLEVSRLIDDLIEESTQYDGEVIIVTNAMQKEV--KGKKLQVGTPKLEGDLEVSCQTGHLIIDSECQT--EFDDLTDTVIITLNSKDYGEKN---ENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRLDENREVECQSGSIMDDVEVQTEVVEVMMLDNKERSLEFGFLFDDLINESIQYNV----------AVKGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLN-REFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEFDE---KVDEITFLLNAQ-DFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNE---QIII--TMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDV 4708          

HSP 7 Score: 382.104 bits (980), Expect = 4.990e-106
Identity = 394/1258 (31.32%), Postives = 618/1258 (49.13%), Query Frame = -2
Query:    3 KNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEI---LTQEPKQTIDVEIQSDL-------EIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKD---ESTQWG--IIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE--ELLFMEPMGLLSKEIQSDIESADKYQIRLEMK----------------GKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNER----------------EWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTEND--------------------------YTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYI---NPMTLTDGEIQWNDVEE------------XXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESIL------------PK----EYSNKETQPESE---MAIT----KGKKIQVGYPHINKISEKEIQIEIDITESSIQTD----QIGSEKEMINQRSFGLE-LIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQ------PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI---FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKS------RKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFII--EQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQN-----ELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDDI 3353
            K K++Q G  +L  + E S QT + ++++  QT+ +      +      ++ +   L QE K   D EIQ +             K KKVQ+G  +L E  E  CQ G ++ +  +Q +     ++   E++  +   + D   ESTQ+   +I + N ++  +K  KKLQ+G  +LEG+LE SCQTGH++ +   QTE  +L     + L SK+     E+  K  +  EM+                  KVQVG+P+  +  +VECQ  S   + E +T  +     +  ER                ++ V   + K+ QIG  RLDG+ E SCQTGH++ D   QT+ D                          + E ++Q     +         K KKVQVG+P+LN S +   Q G  ++D  +Q   +EE++   N +   +  +   D+ E             +     +K KKLQ G+SRL++D E SCQTGH++ E E QTEF  K + I             PK    E+ NKE Q E+     +I+    K KK+QVG+  +++  E E Q    + E  +Q +     I   KE   + S  +E LI+E  QY   +L   +      +GK +Q G  KL  +L+ SCQ G +   +ECQT  EF +E+++IT    +     +    +KK++ EKE+Q       +L   K + K  K+Q+G  ++NE  EVECQS   ++++ VQ +I+E  I E R +   A+LF++++I+E+ QY  DD+     I   KE + K  QVG+PR+E+D D SCQ GHLV + E QT  E FD     IT  +         R   +F+EKE+Q + + + S      + SK VQVG  RL +  DVECQ+  + +++ +Q E+DE +I  E+     E      + MI+E  QY  E +   +L+ + K KKLQ G+SRL+ D + SCQTG+ + +SE QTE       ++    +     QFQN     +   +E+V++E+Q    +F     + +  + +QVG  +LN     ECQSE ++    +QTE  E +  V   RN++  L+  ++I E  Q N D+ +    KL G  KKLQVG   L+ D + SCQTGH++ +   QTE+ +   +I I+++   +  +E+  +      E EIQ +           +  SK+VQVG  RL E  +V CQS Y+M+DI
Sbjct: 3959 KGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFSVEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGNKEQNLEVSRLIDDLIEESTQYDGEVIIVTNAMQKEVK-GKKLQVGTPKLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGEKNENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRLDENREVECQSGSIMDDVEVQTEVVEVMMLDNKERSLEFGFLFDDLINESIQYNV-AVKGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLNREFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQC-KLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEFDEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQT--EF-NEQIIITMNSPDFTDLKI---QQKKDFMEKEMQCDSLDNSLLKENKIT-KSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEIIESRERKIEASLFIDDLIDETTQY--DDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQT--ESFDSI--SITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVL--DLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTE-------VEDSTDMILITHQFQNFEEERKPHVREFVEKEIQ---SEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAF-KKLKG--KKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTI-IKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDI 5184          

HSP 8 Score: 361.303 bits (926), Expect = 1.108e-99
Identity = 396/1259 (31.45%), Postives = 605/1259 (48.05%), Query Frame = -2
Query:   24 KNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNE-----------VEDYATLSENGMLEYEILTQEPKQTIDVEIQSDLEIVKQKGK-KVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGL---ELKDESTQWGIIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE--ELL-----------FMEPMG--LLSKEIQSDIESADKYQIRL----EMKGKKVQVGYPQTYDRIDVECQ---------VQSS---FFEAETETISLARNEF---------EMNEREWTVKTTENKET-----QIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQM--------------------------KGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTD------------SIEEYINPMTLTDGEIQWND--VEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEF------------FYKTESILPKEYSNKETQPES-------EMAITKGKKIQVGYPHINKISEKEIQ---------IEIDITESSIQTDQIGSEKEMINQRSFGLELIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYKASNK-----GKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRT--TTEFIEKEVQPDFVSE--KSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQ-FQNELL---FKEYVDQEVQLDIDDFTGPIPRNT--KCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNE----FQ-EMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQS 3353
            K K++Q G  KL G+ E S QT + +I++  QT  +            +DY   +EN + EY    ++  Q   +E +S   +VK     KVQ+G  +L E  E  CQ G+++ + E+QT+     ++   E+S   G    +L +ES Q+ +            K KKLQIG  RL+G LE SCQTGH++ + H QT+  EL            F E +    L +  + +++  D     L      K KKVQVG+P+  + +DVECQ         VQ     F   E +  +L  N F         + +E    + T  +KE      Q+G SRLD D E SCQTGH++ + E QTE D    +I  +  A +    K +                           K KKVQVG+ +L+   E   Q G  +++  +Q +            ++E  +    L +   Q++D  +          K KKLQ G S+L+ D E SCQTG ++   E QTEF            F   +    K++  KE Q +S       E  ITK  K+Q+G   IN+  E E Q         ++ DI ES I    I S +  I    F  +LIDE  QY   SL  R+ ++  Y+GK +Q GSP+L ++ D SCQ+G++  ++ECQT+   S + + IT+ +++     V  E   K++ EKEIQ  L    +S        K +QVG  +L E  +VECQ+    +++ VQ E+DE +I   R  +      ++ MI+E+ QY  + I      K+ + K  QVGN R++ID + SCQ G+ + + E QT+ E      T + ++  Q ++    R     EF+EKE+Q +F+S   K   S+ +QVG  +LN+  +VECQS  ++ EM +QTE  E +I   T  N +      ++IEE VQY +E++     K   KGKKLQ G+  L++D + SCQTGHL+ ESE QT   E G + D  I+   E TQ F  EL+    KE+V++E+Q +    +     NT    K+VQVG  RL       CQSE ++ +  ++TE  E    +    N E   V+ EMI E  Q   D       K    GKKLQ G+SRL  + D  CQTGH++ D+  QT            +K+  N+    FQ E+ + +S   + +  Q   +      +++  +++ +QVG P+L++  ++ CQS
Sbjct: 4123 KGKKLQVGTPKLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGEKNENPLKEY---LEKEMQFEPIE-ESYTRLVKTYASMKVQVGFPRLDENREVECQSGSIMDDVEVQTEVVEVMMLDNKERSLEFGFLFDDLINESIQYNVAV----------KGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLNREFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEFDEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEI----IESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTE---SFDSISITKYRSDFSE--VPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVED----STDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQY-NEDVNEAFKK--LKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQT---ELGDEFDTIIK--TEHTQDFSEELMERPMKEFVEKEIQFETAK-SSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWI-MEAKYNQENLSVSYEMIEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLMLDNECQT------------NKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSC-QNQALQVGFPKLHQSQEISCQS 5331          

HSP 9 Score: 292.352 bits (747), Expect = 1.040e-78
Identity = 367/1257 (29.20%), Postives = 577/1257 (45.90%), Query Frame = -2
Query:    9 KNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTN-NEVEDYATLSENGMLEYEILTQEPKQT--------IDVEIQSDLEIVK---QKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKD---ESTQWGIIPIDNEIE-HGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE---------------ELLFMEPMGLLSKEIQSDIESADKYQIRLE--MKGKKVQVGYPQTYDRIDVECQ--------------------------VQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTEN-----------------------DYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLN-----------MSFEFGSQFGDDLNDATIQT---DSIEEYINPMTLTDGEIQWND-VEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESIL---------------PKEYSNKETQPESEMAITK---GKKIQVGYPHINKISEKEIQIEIDITESSIQTDQ------IGSEKEMINQRSFGLELIDEELQYYGSLQDRLGNELF--YEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQ-----PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDE-FVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLES-QNIVRTTTEFIEK-----EVQPDFVSEK--SRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDG-KLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNI----INMNKSKKVQVGHPRLNEILDVECQSGYIMD 3353
            K K++Q G S+L  + E S QT + + E+  QT  +E  D  T   N     +   ++PK++        I  E   D   +     K KKVQ+G +KL E  E  CQ G ++    +Q +     +++  E++    L ++D   ESTQ+    ++  I      K KKLQ+G S+L+ +LE SCQTG ++     QTE               +L   +    + KE+Q D  S D   ++     K  KVQ+G  +  +  +VECQ                          +++S F  +    +   ++  +N R  + K  + K+ Q+G  RL+ D + SCQ GH+V D E QTE+                       D+ E +IQ   + +    + +    K VQVG  +L            M  + G Q  +++++  I T   +  EE      + D   Q+ D +         LK+KKLQ G+SRL+ D E SCQTG+ + + E QTE    T+ IL                +E+  KE Q E      K    + IQVG   +N+  E E Q E  + E  +QT+       +G+ +  ++Q     +LI+E +QY   +     NE F   +GK +Q G+P L  + + SCQ G++  E+ECQT  E  DE   I + +        LME   KE+ EKEIQ       L+ Y      K++QVG  +L E  EV CQSE  + +I V+TE  E +++E   N+  L+  +  EMIEE +QY +DD   +   K+ + K  Q G+ R+  + D  CQ GHL+ + E QT++              D +E+ QN +     F  K     E Q D   E   S +++ +QVG P+L+ + ++ CQS     +  +Q+E    +  +  Q+ + L Q  E MIEE VQY  +    I++K NTK + +Q G+SR++ D D+S QT     +S  QT+  E   +ID EI L   Q    NE++    +  E+Q D  D +  +  N +   VQ+G  R+NL    + Q++   ++  +Q   DE L      +N+ + L+ +++I E  Q  F+ + P    K    GKKLQVG SRL  D D   QT     +  D   IE+          L + + Q   + ++IS  + E++    P F   +     N+ KS  VQVG+PRLN  +D E Q  + +D
Sbjct: 4437 KGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEFDEKVDEITFLLNAQ---DFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCD--SLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEIIESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQ--NEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRN-VDQDLLIYDLIEETVQYNEDV-----NEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQT--ELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY--EMIEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLMLDNECQTNK----------MTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE--SVLTNEEYQLKKQLCQ--EVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQA---NEVVVCNSI--EIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQ--FNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQT-----ELNDSRNIED----------LCIQQVQSFQNTNTISFSDKEVE----PLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDID 5636          

HSP 10 Score: 283.878 bits (725), Expect = 4.959e-76
Identity = 348/1294 (26.89%), Postives = 596/1294 (46.06%), Query Frame = -2
Query:    6 IGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLS------ENGMLEYEIL---TQEPKQTIDVEIQSDLEIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTD-----DKLKFVIQANEKSS-----PIGL---ELKDESTQWGIIPIDNEIEH-GMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE--ELLFM---EPMGLLSKEIQSDIESADKY---------QIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAE--------TETISLARN--------------------EFEMNEREWT--VKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTEND----------------YTEHQIQLVTMAN--NLQ---AVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTD-----------------SIEE--YINPMTLTDGEIQWNDVEEXXXXXXXXXXXXXXXX-XSRLNADYEASCQTGHIVNEIETQTE-----FFYKTE-----SILPKEYSNKETQPESEMAIT--------KGKKIQVGYPHINKISEKEIQIEIDITESSIQT---DQIGSEKEMINQRSFG-------LELIDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTF---------YKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDE----FVI-EEIRNKNE-LAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQIN------ENLTQSSEEMIEELVQYE-SENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDF--TGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFL-----VNKEMINEATQCNFDLMQPHDGKLMGIGK-----KLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMN----KSKKVQVGHPRLNEILDVECQSGYIMDD 3365
            +   K+K++Q G  +L    E   Q+   + +  VQ   EVE++  +       E  +   +++   TQ   + ++V +    EI   KGKK+Q+GS++L +  E SCQ G ++ NSE QT+     D L   + + + S      PI     E++ E+T+      ++  EH    K+KK+Q+G+ RL  NLE  CQ+G ++D+   Q E  E++ M   E     S+ I   IE + +Y          ++ E+KGKK+QVG  +    ++V CQ      ++E        ++T+++  N                    +FE  E  ++  VK  ++K+ Q+G  RL+ + E  CQ+G ++ D   Q E D                + E  I   T  +  NL    A    +KGKK+QVG P+L+   E   Q G  + D+  QTD                 S+E+  +     + D EIQ+   E+           K       RLN + E  CQ+G ++++I  Q E          E     S L  +   + TQ + E+ I         KGKK+QVG P +    E   Q    I +S  QT   D   +    +N + +G        E +++E+Q+    +        Y    VQ G P+L    DE+        E ECQ+ +   D E            + +++++K     E+ ++    F         Y  + KGKK+Q+G P+L+  +EV CQ+   I +   QT++DE    F+I   + +  E L   F++E  E+ VQY   D +++ + +  + K  QVG+PR+    D  CQ G L+ ++E+Q   E F   E ++  ++  L  ++++  +T++ E  +       K  K KK+QVG  RL+ +L+V CQ+G L+ E E QTE DE + E T  +N      E   +S  E + + +Q+E S++   I+ K+N K KK+Q G ++L    +  CQ+G+++ E  VQ E DEF       + + N++   +  LL ++ +++  Q D ++   T  + + TK KK+QVG  +L+  +   CQ+  ++ N + QTE +E   +++I  N   F        K+ + +  QC+       D  L+   K     K+Q+G +R+    +  CQ+G ++ D   Q +I E   S +IES+       E   + S+ + ++  +T  +   S+N+  ++    K KK+QVG PRL    D+ CQ G+++ D
Sbjct: 3552 VKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQC--EVEEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEI---KGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTE------NSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVDEFMIMETKERNLEASLFVEDLIDEATQYDDKNLHFTIAAHKDVKGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFSVEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGNKEQNLEVSRLIDDLIEESTQYDGEVIIVTNAMQKEVKGKKLQVGTPKLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGEKNENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRL----DEN-------REVECQSGSIMDDVE------VQTEVVEVMMLDNK-----ERSLEFGFLFDDLINESIQYNVAVKGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLNREFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEFDEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSN-KSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEF-------MIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNE---QIIITMNSPDFTDLKIQQKKDFMEKEMQCD-----SLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINE---SEIIESR-------ERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFD 4786          

HSP 11 Score: 254.603 bits (649), Expect = 3.491e-67
Identity = 342/1267 (26.99%), Postives = 578/1267 (45.62%), Query Frame = -2
Query:    6 DADLQTDPIGEDFLDEVDLLRSGPRKTVIYIRDNSTDMDSIGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQSDLEIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDESTQWGIIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQT------EELLFMEPMGLLSKEIQSD---IESADKYQIRLEM-----------KGKKVQVGYPQTYDRIDVECQVQSSFFEAETET------ISLARNEFE----------------MNEREWTV---KTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWNDVEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEF---------------FYKTESILPK--EYSNKETQPESEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTD------QIGSEKEMINQRS------FGLELIDEELQYYGSLQDRLGN-ELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITE-VQAELQSQNVLMESKKKEYTEKEIQPILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFV----IEEIRNKNELAALFVEEMIE-ESVQYMADDI--FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQ--YESE-------NLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELL--FKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTE----NDELLHEVVIDRNLEAFLVN--KEMINEATQCNF--DLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREI---EIQTDDFP--GFSVNIINMNKSKKVQVGHPRLNEILDVECQSGYIMDD 3485
            DA +QTD I E++++ + L         I   D      S    K+K++Q G S+L  + E S QT + + E   QT                 Y+  +  PK+  + E Q + E+   KGKK+Q+G   + +  E   QI   +  S +QTD         N++S   GLEL DE  Q+     D        + K +Q G+ +L   L+ SCQ G+V  E   QT      EEL+  E    +  E+QS    +ES  K     E+           KGKK+QVG+P+  + ++VECQ + S  E   +T      I   RN+ E                M +  +T+   K T+ K  Q+G  R++ D++TSCQ GH+V++ E QT+ +  +     +TM      VK Q++ + +                           T+ IE+ + P  +++   +   V+                G  RLN + +  CQ+G ++NE+E QTE                   +E ++ +  +Y ++  +P +    TKGKK+Q G   +    +   Q    +TES +QT+      +I  E  + N+++         E +D+E+Q    + D  G      + K VQ G P+L +++   CQ   V    + QT+N+    E+VI   ++A L ++ ++ E+ +  +    +QP     K    GKK+QVG  +L    +  CQ+   +++   QTEI+E V    IE     NE   +  ++ I    ++   DD   F++      + K  QVG+PR+    D  CQ+G ++ ++ +Q + + F   E +   ++  L  ++++   T++ ++ V+    S + +K KK+QVG PRL+ + +V CQ+G ++ + E QT+L++ +  +T  I  +    SE++ +E ++  YE E       +     +K N K KK+Q G  RL    D  CQ+G ++ +  VQ E DEF  + +KE  L  E +QF  +L+    +Y D+ V+L I   T  I      KK+QVG  ++N  +   CQ+  ++ + + QT+    ND+L          E  L+   K+  ++  QC    D +  H+       KK+QVG  RL    D  CQ+G+I+ D   Q E++E            + E +E   + S+ + ++     Q DD P  G  +N +   K KK+QVG PRL+   +V CQ+G I+ D
Sbjct: 1212 DATIQTDSI-EEYINPMTLTDGE-----IQWNDVEEGSQSSSGLKSKKLQAGSSRLNADYEASCQTGHIVNEIETQTE--------------FFYKTESILPKEYSNKETQPESEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKEMINQRS--FGLELIDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITE----VQAELQSQNVLMESKKKEYTEKEIQPILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITM------VKDQLESQNI-----------------------VRTTTEFIEKEVQPDFVSEKSRKSKKVQ---------------VGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQL--DIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNF--DLMQP--HDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSV--ETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKAN-KSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNL--EASQFIEDLIDEATQYDDEPVKLTIVSQTKKIG-----KKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNK--ANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDE----------FMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGI-INSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKD 2379          

HSP 12 Score: 231.491 bits (589), Expect = 3.507e-60
Identity = 324/1153 (28.10%), Postives = 519/1153 (45.01%), Query Frame = -2
Query:  279 IGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILTQEPKQTIDVEIQSDL---EIVKQ----KGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGL---ELKDESTQWGIIPIDNEI-EHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTEELL----------FME-PM-----GLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQV---------------------QSSFFEAETETISLARNEFEMNEREWTV-----KTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTE-------------------------NDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMT------------LTDGEIQWNDVEEXXXXXXXXXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESILP----------------KEYSNKETQPESEMA-------ITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQ----IGSEKEMINQRSFGLELIDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPIL---TFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITM--VKDQLESQNIVRTTTEFIEKE-VQPDFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDID-DFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQT 3365
            + + K K++Q G SKL  + E S QT   ++ +  QT    +   T++     + +I  Q+ K  ++ E+Q D     ++K+    K  KVQ+G +++ E  E  CQ G ++ +  +Q D     +I++ E+     L   +L DE+TQ+  + ++  I      K KKLQ+G+ RLE + + SCQ GH+V +   QTE             F E P        + KEIQ ++       I      K VQVG  +  +  DVECQ                      + + FE E   + L  +E      E  V     K  +NK+ Q+G SRLD D E SCQTG+ + D E QTE                          ++ E +IQ   ++   +   SQ+    +QVG  +LN   E   Q    + +  +QT++ E  I   T            L +  +Q+N  E+ +++   LK KKLQ G+  L++D E SCQTGH++ E E QTE   + ++I+                 KE+  KE Q E+  +       +   K++QVG   + +  E   Q E  + +  ++T++    I   K      S   E+I+E +QY+      +  +   +GK +Q+GS +L  E+D  CQ G++  + ECQT+   +++  ++   Q EL +         K  + +E Q  L   T     N+   +QVG PKL++  E+ CQS +   +  VQ+E      EE + K +L     E MIEE+VQY+ D   +I     T+++  Q GN RI+ D D S Q      +   QTD   +   E QI +    +Q ++  +V   +  I+ + +    V E +R+   VQ+G  R+N    ++ Q+     ++ +Q  LDE +I +TTQ N +     E++I E +Q+     R  ++K ++KGKKLQ G+SRL +D D   QT              E     + E     +   FQN      + D+EV+   D +   P     K   VQVGYPRLN  +  E Q        DI  +  +      I+  + +     E+I+E  Q +  +        + + KKLQVG+SRLE D D SCQT
Sbjct: 4596 LKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKI--QQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEIIESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFE-ERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQV----IQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYN--EDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSYEMIEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTND--IMENFQNELNADESF---PTKSLSNQESQYDLCEETVLSCQNQA--LQVGFPKLHQSQEISCQSTVETVDAVVQSE-SVLTNEEYQLKKQLCQ---EVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTD---YSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRS-SIKKDSKGKKLQVGNSRLLDDSDEFTQT--------------ELNDSRNIEDLCIQQVQSFQNTNTIS-FSDKEVEPLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSF-----DIDFDGSDHFESSEIEDRVFSKEQFDELIDETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 5704          

HSP 13 Score: 123.635 bits (309), Expect = 1.636e-27
Identity = 335/1439 (23.28%), Postives = 600/1439 (41.70%), Query Frame = -2
Query:   24 IDSMTQIGCFTESVSTQANLEKKTLSQNAFQ-MDAMTQISTLVNDRIVQTVAKSKPKKMKRDCQTQIGTLKNEMVTQTNIHCKSKAIQKSTLQLDAITQLSI----LNKDADLQTDPIGEDFLDEVDLLRSG-------PRKTVIYIRDN------STDMDSIGQRKNK--RIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSEN-----GMLEYEILTQEPKQTIDVEIQSDLEIVKQ-KGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDEST------QWGIIPIDNEI--EHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQT---------------EELLFMEPMGLLSKEIQSDIESADKYQI-RLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETET-------ISLARNEF----------EMNEREWTVKTTEN-----------KETQIGCSRLDGDFETSCQTGHIVKDFESQTEND----------YTEHQIQLVTMANNLQ----------AVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWNDVEEXXXXXXX------------------XXXXXXXXXXSRLNADYEASCQTGHIVNEIETQTEFFYKTESILPKEYSN-----------KETQPESE-----MAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKEMI----NQRSFGLEL--------IDEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYK---------ASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTE--IDEFVIEEIRNK-NELAALFVEEMIEESVQY-MADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQA-----GHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKSRKS----KKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENL-RPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFG--GKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRL------------EYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQS 3797
            +D   Q GC  + +  Q  LE+  + +N  + ++A   I  L+ +                  Q   G L   + T  +   K K +Q  T +LD+  ++S     L  +++ QT+   ++ +DE+  L +        P+++V    +       S D  SI  + NK  ++Q G +KL    E   Q+ Y + E  VQ   E++++  +          L  E L +E  Q  D  +   + ++K+ KGKK+Q+G SKL E  E SCQ G ++ NSE QT+   + +I  N   SP   +LK +        +     +DN +  E+ + K+ K+Q+G +R+    E  CQ+G ++D+   Q                E  LF++   L+ +  Q D  S +   I + E KGKK+QVG P+     D+ CQV    F++E +T       I+  R++F          +  E+E   +  E+           K  Q+G +RL    +  CQ   +  D   Q E D          + E +  L  M +             +++  +K KK+QVG  +L++  E   Q G+ + D+  QT+ +E+  + + +T    Q+ + EE  +                        S+ +Q G S+LN   E  CQ+  IV E+  QTE   K   I+     N           +ET   +E         KGKK+QVG P+++  SE   Q    + ES  QT ++G E + I    + + F  EL        +++E+Q+  +             K VQ G  +L    +  CQ  Y+ ++   +T+    + E  I E +   ++ +V  E          I+ I+ ++             KGKK+Q G  +L   +++ CQ+   + +   QT       ++E  +N+ N   +   + +  +  QY + ++          Q +  QVG P++    + SCQ+       +V+   + T++E           +K QL  + ++  T +++     PD     S K     + +Q G+ R+  ++D   Q+    N+   QT+  E   +   +I  N  Q++E ++   ++ +S+ L   + L+ N +   +Q G SR+     + C+T     +S+ Q   ++ G  G +D+ + +   Q    ++L+F++ + +E+Q +       I +++K KK+QVG  RL        Q+E+     D +   D  + +V   +N      + + +       FD         +     +QVG  RL            + DFD S        D  + +EIE+ V S     K   +E  + T + SI +     Q+  +P  SV +     +KK+QVG  RL    D  CQ+
Sbjct: 4373 LDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEEST----------------QYDEGNLN--ITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTE--FDEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQC--ELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMN---SPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEIIESRERKIEASLFID--DLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTE-VEDSTDMILITH---QFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTE--AKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQT-ELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETE----ERECWIMEAKYNQENLSVSYEM---------IEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVL-----SCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSESVLTNEE---------YQLKKQLCQEVMIEETVQYV-----PDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRI-----NLCRT----IDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTEL----NDSRNIEDLCIQQVQSFQNTNTISFSDKEVEPL----FDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGS--------DHFESSEIEDRVFS-----KEQFDELIDETVQYSIGM-----QSSTYPS-SVKV-----NKKLQVGSSRLEVDHDQSCQT 5704          
BLAST of SMED30027315 vs. Planmine SMEST
Match: SMESG000022272.1 (SMESG000022272.1)

HSP 1 Score: 129.798 bits (325), Expect = 1.170e-29
Identity = 79/278 (28.42%), Postives = 141/278 (50.72%), Query Frame = -1
Query: 4915 SLKYLGGISNLENLYSELTGNIGACALHQSV---NQNFSENMLVNKSLSNNVNDCWNYITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPKGTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQNKVLGQCLYSYSSPEISVHDREEVVILNN---------------SNP--LTWKIQNNKGEVGEIPSVCIWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNEPNIS 5688
            +L++   IS+LE L+S++T  I   AL  S+    ++F  ++ V K     V  CWN I   + L+ +H ++A+ YHQF+H+ +EI  L+++RW++ +  I     KG +K++ ++    K   +    L  +I NL+  S  IVPI+LR   +++       L  +   ++ +   E V +L+N               S P  + W ++   G+   IPS+ +WIPGPD  +S     L+ QL+  WE+ +     V I+ Y  LF ++ ++  I+
Sbjct:   78 ALEFYDSISSLEELFSQVTTQIADRALKDSLMSTTKDFESDVSVPK-----VKQCWNRILHYSELTSIHTKDAADYHQFYHECSEIRRLIERRWQLTTKSINQLNIKGVMKDAKEIIKITKGTTNELHSLADQIMNLKRRSANIVPIYLRTSSIAEQGKKAFLLADFKIGDLQLKKSEHVTVLDNWGKDGSTNSDSNISGSIPSRINWLVETRNGDKLLIPSIALWIPGPDSETSLVLNELQNQLSATWEELIQMLREVNINFYQRLFGKIFSKSEIT 350          
The following BLAST results are available for this feature:
BLAST of SMED30027315 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEC1.973e-822.70plectin [Source:HGNC Symbol;Acc:HGNC:9069][more]
PLEC4.144e-822.70plectin [Source:HGNC Symbol;Acc:HGNC:9069][more]
PLEC4.279e-822.70plectin [Source:HGNC Symbol;Acc:HGNC:9069][more]
PLEC4.810e-822.70plectin [Source:HGNC Symbol;Acc:HGNC:9069][more]
PLEC4.811e-822.70plectin [Source:HGNC Symbol;Acc:HGNC:9069][more]
back to top
BLAST of SMED30027315 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027315 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shot3.892e-1626.25gene:FBgn0013733 transcript:FBtr0273223[more]
shot3.928e-1626.25gene:FBgn0013733 transcript:FBtr0304853[more]
shot3.928e-1626.25gene:FBgn0013733 transcript:FBtr0304847[more]
shot3.996e-1626.25gene:FBgn0013733 transcript:FBtr0301593[more]
shot3.996e-1626.25gene:FBgn0013733 transcript:FBtr0304852[more]
back to top
BLAST of SMED30027315 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plecb4.675e-923.58plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
plecb4.675e-923.58plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
plecb5.040e-923.58plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
plecb5.083e-923.58plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
pleca5.627e-924.05plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984][more]
back to top
BLAST of SMED30027315 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11fip26.375e-724.03RAB11 family interacting protein 2 (class I) [Sour... [more]
MACF17.358e-722.52microtubule actin crosslinking factor 1 [Source:NC... [more]
rab11fip28.504e-722.64RAB11 family interacting protein 2 (class I) [Sour... [more]
rab11fip28.794e-723.61RAB11 family interacting protein 2 (class I) [Sour... [more]
rab11fip28.848e-722.64RAB11 family interacting protein 2 (class I) [Sour... [more]
back to top
BLAST of SMED30027315 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dst2.418e-622.64dystonin [Source:MGI Symbol;Acc:MGI:104627][more]
Plec3.363e-622.16plectin [Source:MGI Symbol;Acc:MGI:1277961][more]
Plec3.536e-622.16plectin [Source:MGI Symbol;Acc:MGI:1277961][more]
Plec3.840e-622.16plectin [Source:MGI Symbol;Acc:MGI:1277961][more]
Plec3.898e-622.16plectin [Source:MGI Symbol;Acc:MGI:1277961][more]
back to top
BLAST of SMED30027315 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q15149|PLEC_HUMAN1.990e-722.70Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3[more]
sp|P30427|PLEC_RAT6.715e-723.24Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1... [more]
sp|Q03001|DYST_HUMAN9.993e-723.27Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4[more]
back to top
BLAST of SMED30027315 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1R4A3Q61.804e-5732.69Mucin-like protein (Fragment) OS=Schistosoma manso... [more]
A0A4Z2DBR96.716e-5532.85SH3_10 domain-containing protein (Fragment) OS=Sch... [more]
A0A430QC585.308e-5433.17SH3_10 domain-containing protein (Fragment) OS=Sch... [more]
A0A5K4F4893.477e-5333.01Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
G7YKJ42.778e-5131.71SH3_10 domain-containing protein OS=Clonorchis sin... [more]
back to top
BLAST of SMED30027315 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plecb1.223e-1123.79plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
pleca6.171e-1124.86plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984][more]
ENSAMXT00000038112.17.713e-824.22pep primary_assembly:Astyanax_mexicanus-2.0:25:365... [more]
evplb8.781e-826.82envoplakin b [Source:ZFIN;Acc:ZDB-GENE-030131-212][more]
MACF14.027e-722.40microtubule actin crosslinking factor 1 [Source:HG... [more]
back to top
BLAST of SMED30027315 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007587.12.235e-826.04pep scaffold:Pmarinus_7.0:GL476641:205588:235369:-... [more]
ENSPMAT00000004845.15.671e-720.08pep scaffold:Pmarinus_7.0:GL477442:57807:78762:-1 ... [more]
ENSPMAT00000008465.11.839e-621.88pep scaffold:Pmarinus_7.0:GL476656:166292:202932:-... [more]
back to top
BLAST of SMED30027315 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027315 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO377081.752e-734.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027315 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042543.11.585e-1326.40epiplakin [Source:NCBI gene;Acc:101165224][more]
pleca5.959e-1222.41plectin [Source:NCBI gene;Acc:101160251][more]
pleca1.552e-1122.95plectin [Source:NCBI gene;Acc:101160251][more]
pleca1.566e-1122.95plectin [Source:NCBI gene;Acc:101160251][more]
pleca1.591e-1122.95plectin [Source:NCBI gene;Acc:101160251][more]
back to top
BLAST of SMED30027315 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023005.12.192e-14199.76SMESG000023005.1[more]
SMESG000022272.11.170e-2928.42SMESG000022272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027315 ID=SMED30027315|Name=SMED30027315|organism=Schmidtea mediterranea sexual|type=transcript|length=6618bp
CCGATGTCATCCATTATGTATCCTGACTGACATTCGACATCTAGAATTTC
ATTCAACCTTGGATGACCCACTTGGACTTTCTTTGATTTATTCATATTAA
TTATGTTTACTGAAAATCCTGGGAAATCGTCAGTTTGTATTTCAATCTCT
CTTAATGAAATTGAATCTTTGGAAGTCATTTCTTGAAATTCATTGAGTGC
TAATTTGGATTCGATAAGTATTGAACCAACCGTTTCCTCAATCTCCGTTT
GATCGCAATCGTCTTTCACTATATGGCCAGTTTGACAGGATGCATCAAAA
TCGTATTCCAGTCGTGATGTGCCTACTTGTAATTTTTTTCCTATTCCCAT
TAATTTACCATCATGAGGTTGCATTAGATCAAAGTTGCATTGAGTTGCTT
CATTGATCATTTCTTTATTCACTAAAAATGCTTCTAAATTTCTATCTATT
ACAACTTCGTGAAGCAATTCATCATTTTCCGTTTGAATATCTTCATTTTG
TAGAACGATTTCTGACTGGCACTCCGCATGAATTTGAAGATTCAGCCTAG
GATAACCAACTTGAACCTTTTTGCATTTAGTATTTCTTGGTATCGGTCCA
GTGAAATCATCTATGTCTAGCTGGACTTCTTGATCGACATATTCTTTGAA
TAGCAATTCATTTTGAAATTGAGTTTGTTCATTAGCTAATCTAATTTCTT
TATCGATTTTACCACCAAATTCATCGTTCTCCGTTTGCACTTCTGATTCA
GTTACCAAATGCCCGGTTTGACACGAAGAATCGAAGTCATTTTCTAATCT
TGAACTGCCAGTTTGTAATTTTTTTCCCTTTGTATTGGTTTTCAAAGTAA
TCGGTCTAAGATTTTCGCTTTCATATTGAACTAGTTCTTCAATCATTTCT
TCGGAACTTTGTGTTAAGTTTTCATTTATTTGAGTAGTTTGTTCGATTAT
AAATTCGTCTAGCTCAGTTTGGATTTCCATTTCATTTAGAAGTGTGCCCG
ATTGACATTCAACGTCTAAATTATCATTTAACCTTGGATGACCAACCTGA
ACTTTCTTGGATTTTCGAGATTTTTCAGAAACAAAATCTGGCTGCACTTC
TTTTTCTATGAATTCAGTTGTTGTTCGTACTATATTTTGTGATTCTAATT
GATCTTTAACCATTGTAATTTGGGTTTCGAATCCATCAAATGGCTCTTGG
TCGGTTTGGATTTCTAACTCTCTCACTAAATGGCCTGCTTGACACGATGT
ATCATAGTCTATTTCGATTCTTGGGTTTCCTACTTGAAAGTTTTTTTCTT
GTGTTTCTTTTGGATATTGGATAGTAAATATATCATCAGCCATATATTGA
ACACTTTCTTCAATCATTTCTTCGACAAATAATGCAGCTAGTTCATTTTT
ATTTCGAATCTCTTCTATCACGAATTCATCTATTTCCGTTTGAACAGCAA
TCTCCTCTATTGAGATTTCGGATTGACATTCAACTTCAACGAACTCATTC
AGTTTCGGATGACCAACTTGAATCTTTTTTCCTTTATTTGACGCTTTATA
AAAGGTGAGTATCGGTTGGATTTCTTTTTCTGTATATTCTTTTTTCTTTG
ACTCCATTAGAACGTTTTGAGATTGGAGTTCAGCTTGAACTTCAGTTATA
ACTAACTCTTCATCAGAAAATTCATTATCCGTTTGACATTCAGCTTCGTG
TTTTACATATCCAATCTGACAGGATTCATCTAATTCCATAAACAGTTTCG
GAGAACCACTTTGAACATTTTTGCCCTCATAAAACAACTCATTTCCCAGT
CTATCCTGCAAACTTCCGTAGTACTGTAATTCTTCGTCAATCAATTCCAA
TCCGAACGATCTTTGATTTATCATTTCTTTTTCACTGCCTATTTGATCGG
TTTGTATTGAACTTTCAGTTATGTCAATTTCGATTTGGATTTCTTTCTCA
GAGATTTTATTTATATGAGGATATCCAACTTGAATCTTTTTGCCTTTAGT
TATAGCCATTTCTGATTCCGGTTGTGTTTCTTTGTTAGAATACTCCTTCG
GTAATATGCTTTCGGTCTTATAAAAGAATTCGGTTTGAGTTTCAATTTCG
TTTACGATATGTCCGGTTTGACAGGAAGCTTCATAATCAGCATTTAATCT
CGAACTGCCGGCTTGTAATTTCTTCGATTTTAGACCGGAGCTCGACTGTG
AACCTTCTTCAACATCATTCCATTGAATTTCTCCATCAGTCAAAGTCATT
GGATTAATATACTCTTCAATTGAATCAGTTTGAATGGTAGCGTCGTTTAA
ATCATCCCCAAACTGACTACCAAATTCGAAGCTCATGTTCAATTGAGGAT
AGCCAACTTGTACTTTCTTTCCTTTCATTTGAGATTTAACTGCTTGTAAA
TTATTTGCCATTGTGACCAGTTGGATTTGGTGTTCGGTATAGTCGTTTTC
GGTTTGAGATTCAAAATCCTTGACTATATGGCCAGTTTGACAAGATGTTT
CAAAATCTCCATCCAATCTCGAGCATCCGATTTGAGTCTCTTTATTTTCA
GTAGTTTTCACTGTCCATTCTCTTTCATTCATCTCGAATTCGTTTCTTGC
AAGTGAAATAGTTTCAGTTTCAGCCTCAAAAAACGACGATTGGACTTGAC
ATTCTACGTCGATACGATCATATGTTTGAGGATAGCCGACCTGTACTTTC
TTTCCTTTCATTTCCAGTCTGATTTGATATTTATCAGCTGATTCAATATC
GGACTGAATTTCTTTGCTTAACAAGCCCATTGGTTCCATAAACAATAGCT
CTTCGGTTTGCGTGTGAAATTCATCAACGACATGTCCCGTTTGACAAGAC
GACTCGAGATTTCCCTCCAATCGAGAATTTCCTATTTGAAGTTTTTTATT
TTTTTTCATTCCGTGCTCGATTTCATTGTCAATCGGAATAATACCCCATT
GAGTACTTTCATCTTTTAATTCCAATCCGATTGGACTTGACTTTTCATTG
GCTTGTATGACAAATTTCAATTTATCATCGGTTTGTAATTCGGAATTATG
TAAAACGGTTCCAATTTGACAGGAGGATTCACAGGTTTCCAGTAATTTAG
AGCTTCCGATTTGTACTTTCTTTCCTTTCTGTTTGACAATTTCCAGATCC
GATTGTATTTCCACATCAATTGTTTGTTTTGGCTCCTGAGTCAAAATTTC
ATACTCAAGCATTCCGTTTTCCGATAGTGTTGCGTAATCCTCGACTTCGT
TATTAGTTTGCACATTGGCTTCGATTAGATGGTAATTGGTTTGAGATGAA
AACTCTCCTTCACCGAATAATTTACTTTTACCGAATTGTATACGTTTGTT
TTTCCTCTGGCCAATAGAATCCATATCTGTCGAATTGTCTCTGATGTAGA
TTACCGTTTTTCTCGGTCCACTTCTCAACAAATCCACTTCGTCCAAGAAA
TCCTCTCCAATCGGATCGGTTTGTAAATCGGCATCTTTATTCAAAATCGA
CAGCTGGGTAATCGCATCGAGTTGTAAGGTGGATTTTTGAATTGCTTTTG
ATTTGCAGTGGATATTCGTTTGGGTTACCATTTCGTTTTTTAGAGTTCCG
ATTTGTGTTTGACAATCTCGTTTCATTTTTTTCGGTTTCGATTTAGCCAC
TGTCTGAACGATTCGATCATTGACAAGTGTACTGATTTGGGTCATTGCAT
CCATTTGAAATGCATTCTGTGATAGGGTTTTCTTTTCCAAATTTGCTTGT
GTACTCACGGATTCGGTGAAGCATCCGATTTGTGTCATGCTATCGATTAG
GAGTTTTTTTGGGTTTCTTTCTTGTTGGATTAGAAACTGGCACGGAGAAA
GTTGAATTCATTTCACTTTGTGTACTGGAATCTTTAAATAGCACTCCGAT
TTGCGTTTGAGCATCTAATTGGTATTTCTGTGGACTCATCGATTTTGAGA
ATTGTTTACTGGAAGCGATTGAAGATCCGGTTGTGGAGAATATTTCATCC
TGAATGAAAGTTGATACGTCGTACATTGTGGGATTGCATTGGATTTTACT
GTCTCTCACTGTAACTCCGAGTTGAGTTTGCGAATCGACTTTCCAGGTTT
TCTTTTTCGGTGGATGATGCGATTTCGATTTTATAGATTGAATGTCTGTG
TTGTTTAACGCCATCGGTAGAGAATAACTGGCTTTGACATGTTCACTGTA
TTCCTGATTCAATTCCGCTTCATTGTCAATAAAATTATCACTGGAATAGA
AATTATGGGCATCTCTTGCATCGTGTCTATTGAGTTGTGCGTCTGACACA
GATAATGAGGTAGAAGGAGAAAAGACTTCGGAATGGACATTTCTTCGGTC
GGGCTTAAGTTGAGTGTGAGATTCCAAATGACTGGAATTCAAATGGTAGT
GATGGGAATGCGACAAGTCAGAAGCACTTAAATATTGACGATGATCTCGA
TTGGTATGATCATGGAATTTTGAATGATGGATAAATTCTTGGCTATGACG
ATGTTTGTAGGTTTCATTTGGCATTGACTCGATGCTTTGCAATAGTCTGT
TTAATTCGTTTTTATTGTCAGAATGCAATTTGTTCAACATGTCTAAGTTA
CTAGAGTATCGCTTATCTCCCGTTTCCCGTGAAATATTTTGGGAATCCAT
CTGATTGAATTGAACAGAATCTCGTAATGATCGCAAATTTTTTAAATGAT
CTATATATCTTAACATTGGAGTATGCATTTTGATGATCTCACTCTCTTTA
TAAACATGACTATTTCTTGAATCATTGGAATTTCTTGAATTCACCCTCTT
CTGTAACTCTACTAACAATGCACCAAGTTCTTTGCTTTTTACATCTGTCA
AATTCATTAGAAGGACTTCCTGTACATCTCGCAGCAAGTTGTTGAAATAA
TCAATTTTAGAAACCGAGATATTGGGTTCATTGAGTAGTCGTTCGAATAG
ATTTATGTAATGATCAATCAACACTATTGAAAATCTATTGAGGCATTGTT
CCCAATTTTTTGTCAACTGAGTGCGCAGGCTGATAGGTTTTTCGGAGGAA
ATTACGTCTGGGCCCGGAATCCATATACAAACGGAAGGAATTTCGCCAAC
TTCGCCTTTATTATTTTGAATTTTCCAGGTTAATGGATTGGAATTATTAA
GGATGACGACTTCCTCTCGATCGTGAACCGATATTTCTGGACTGGAATAT
GAATATAAACATTGCCCTAATACTTTATTTTGACTGACTGGATCTTGTCT
GAGATGAATAGGGACAATTTTTTTCGATTCAATTTGTAGGTTGTCTATTC
TCGTCCATAAGTGCAAAAAATAAGATTGATGATCTTTTAAATTATTTGCC
AATTGATCTGATTCTTTGATTGTTCCTTTTGGTTCGAAATTCGCTATCTG
ATTAGAAATAACTTTCCAACGCTTTTTCAACAATGCTGAAATTTCATTGA
TATCATGATGAAATTGATGGTATTGTGAAGCATTCCGTAAATGAACTTGT
GATAGATATGCCAATTTTGTAATATAATTCCAACAGTCATTTACATTGTT
TGACAAAGACTTGTTCACTAGCATATTTTCTGAAAAATTTTGATTTACAC
TTTGGTGCAATGCACATGCCCCAATATTTCCCGTTAATTCAGAATAAAGA
TTTTCTAAATTGGAAATTCCTCCTAAATATTTCAGCGATGAAATGCCGGA
CTCCACTTCATCTTTTATGTCCAAAATCTGTGCAGCTGTTCGATTTGTTC
TATCATCCTGTAAACGAGAGTGGTAAAAGTTGTTGAGAAAATTATTTGTA
AGTACTTTATATTTTAAGTTGTTTTCCAATTCTCGCAGTTCTTGTAAAAT
TAATTGTTGTCGGTGTTCTTCAACTTTTAGTGATTTTGATGAAACGCCAA
AATGCAAATTCTGTGATCGATCTTTACAGTCAGCCAATCTGTTTCGAAAA
ACGTCCAGATCTATGTCCAATGCCATGCACTATTATGTTTAAATATTTCT
TAGGAGGCTATTTACAAAAGGCGTTGTTGTGGTTTAATAGATTGAAAAAA
AGTCAATCAAATTGAAAATTGAGTTGATATTGACTGAAACTGACTTTTTA
TAATTGACAAATGCGCACACTGGGTGAATGAGTACGGATTGTTTGATTTG
GAATGAAGCTGAATTACAACAACGACTAGAGTTCTATGATCAAAATAGTA
TCGATCAGTGCCGTAGGTGCTGTGCTTGTGTAAATAGTTGATCGTGTACA
TCGCATTCTTAATTAGTTGATGTGAATTGTAGAAATTCAGTACAAAAATA
CAATATACAAGTATTTACACAGCTTTCTTCTATATTGTCTATTTTGTGTT
GTGCTGTGCTATGAGGTGCAGTGCGGTGCTGTGCGCTTGTTGTTTATTTC
AATGTGCCGAATTGAGTTGCTGAATATGCACATTTAGAACTGGATTAGTG
TGGCAAATATTATTACTAATTAATAGATCAGTTTTATTGATTTTTTTTAA
AATGAAAATTAATTAAATCTGAAATAATTACAGAATCAACCGTAAAATAA
TAGCTAGATGTTTAGAATCAGTTTCAATGTGGTTTTTAAACAAATAAATT
ATACATATATTTTTTTTA
back to top

protein sequence of SMED30027315-orf-1

>SMED30027315-orf-1 ID=SMED30027315-orf-1|Name=SMED30027315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1262bp
MTQIGCFTESVSTQANLEKKTLSQNAFQMDAMTQISTLVNDRIVQTVAKS
KPKKMKRDCQTQIGTLKNEMVTQTNIHCKSKAIQKSTLQLDAITQLSILN
KDADLQTDPIGEDFLDEVDLLRSGPRKTVIYIRDNSTDMDSIGQRKNKRI
QFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILT
QEPKQTIDVEIQSDLEIVKQKGKKVQIGSSKLLETCESSCQIGTVLHNSE
LQTDDKLKFVIQANEKSSPIGLELKDESTQWGIIPIDNEIEHGMKKNKKL
QIGNSRLEGNLESSCQTGHVVDEFHTQTEELLFMEPMGLLSKEIQSDIES
ADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNE
FEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDY
TEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDA
TIQTDSIEEYINPMTLTDGEIQWNDVEEGSQSSSGLKSKKLQAGSSRLNA
DYEASCQTGHIVNEIETQTEFFYKTESILPKEYSNKETQPESEMAITKGK
KIQVGYPHINKISEKEIQIEIDITESSIQTDQIGSEKEMINQRSFGLELI
DEELQYYGSLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAE
CQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILTFYKAS
NKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNEL
AALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQ
AGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQP
DFVSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQ
TTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLEN
DFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEY
VDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNED
IQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIG
KKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNE
FQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILD
VECQSGYIMDDI
back to top

protein sequence of SMED30027315-orf-2

>SMED30027315-orf-2 ID=SMED30027315-orf-2|Name=SMED30027315-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=729bp
MALDIDLDVFRNRLADCKDRSQNLHFGVSSKSLKVEEHRQQLILQELREL
ENNLKYKVLTNNFLNNFYHSRLQDDRTNRTAAQILDIKDEVESGISSLKY
LGGISNLENLYSELTGNIGACALHQSVNQNFSENMLVNKSLSNNVNDCWN
YITKLAYLSQVHLRNASQYHQFHHDINEISALLKKRWKVISNQIANFEPK
GTIKESDQLANNLKDHQSYFLHLWTRIDNLQIESKKIVPIHLRQDPVSQN
KVLGQCLYSYSSPEISVHDREEVVILNNSNPLTWKIQNNKGEVGEIPSVC
IWIPGPDVISSEKPISLRTQLTKNWEQCLNRFSIVLIDHYINLFERLLNE
PNISVSKIDYFNNLLRDVQEVLLMNLTDVKSKELGALLVELQKRVNSRNS
NDSRNSHVYKESEIIKMHTPMLRYIDHLKNLRSLRDSVQFNQMDSQNISR
ETGDKRYSSNLDMLNKLHSDNKNELNRLLQSIESMPNETYKHRHSQEFIH
HSKFHDHTNRDHRQYLSASDLSHSHHYHLNSSHLESHTQLKPDRRNVHSE
VFSPSTSLSVSDAQLNRHDARDAHNFYSSDNFIDNEAELNQEYSEHVKAS
YSLPMALNNTDIQSIKSKSHHPPKKKTWKVDSQTQLGVTVRDSKIQCNPT
MYDVSTFIQDEIFSTTGSSIASSKQFSKSMSPQKYQLDAQTQIGVLFKDS
STQSEMNSTFSVPVSNPTRKKPKKTPNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR041615Desmoplakin_SH3
IPR043197Plakin
IPR001849PH_domain
Vocabulary: biological process
TermDefinition
GO:0045104intermediate filament cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 33..53
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 162..321
e-value: 2.1E-28
score: 101.3
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 243..308
e-value: 2.1E-28
score: 101.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 700..716
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 529..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 529..548
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 700..728
IPR041615Desmoplakin, SH3 domainPFAMPF17902SH3_10coord: 239..304
e-value: 4.1E-12
score: 46.0
IPR043197PlakinPANTHERPTHR23169ENVOPLAKINcoord: 160..307