Hepatoma derived growth factor protein

Overview
NameHepatoma derived growth factor protein
Smed IDSMED30027313
Length (bp)900
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hepatoma derived growth factor protein (SMED30027313) t-SNE clustered cells

Violin plots show distribution of expression levels for Hepatoma derived growth factor protein (SMED30027313) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hepatoma derived growth factor protein (SMED30027313) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hepatoma derived growth factor protein (SMED30027313) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027313

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027313h1SMcG0016007 SmedASXL_010526SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30027313h1SMcG0016007 dd_Smed_v4_14527_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hepatoma derived growth factor protein vs. Ensembl Human
Match: HDGFL3 (HDGF like 3 [Source:HGNC Symbol;Acc:HGNC:24937])

HSP 1 Score: 90.8929 bits (224), Expect = 2.825e-21
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Human
Match: HDGFL2 (HDGF like 2 [Source:HGNC Symbol;Acc:HGNC:14680])

HSP 1 Score: 78.1814 bits (191), Expect = 8.734e-18
Identity = 37/74 (50.00%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   13 TFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
             F  G+  FAK+KG+PHWPARI+ + +  VK P  KYPIFF+GTHE  FL    +FPY+K K K+       GF
Sbjct:    4 AFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Human
Match: HDGFL2 (HDGF like 2 [Source:HGNC Symbol;Acc:HGNC:14680])

HSP 1 Score: 83.1889 bits (204), Expect = 3.674e-17
Identity = 37/74 (50.00%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   13 TFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
             F  G+  FAK+KG+PHWPARI+ + +  VK P  KYPIFF+GTHE  FL    +FPY+K K K+       GF
Sbjct:    4 AFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Human
Match: HDGFL2 (HDGF like 2 [Source:HGNC Symbol;Acc:HGNC:14680])

HSP 1 Score: 83.1889 bits (204), Expect = 3.711e-17
Identity = 37/74 (50.00%), Postives = 47/74 (63.51%), Query Frame = 1
Query:   13 TFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
             F  G+  FAK+KG+PHWPARI+ + +  VK P  KYPIFF+GTHE  FL    +FPY+K K K+       GF
Sbjct:    4 AFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Human
Match: PSIP1 (PC4 and SFRS1 interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9527])

HSP 1 Score: 81.6481 bits (200), Expect = 3.941e-17
Identity = 44/101 (43.56%), Postives = 58/101 (57.43%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQ 315
            F  G+  FAK+KG+PHWPAR++ +P+  VK P  K PIFF+GTHE  FL    IFPY + K K+       GF         N  +++   +PK VKF SQ
Sbjct:    5 FKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGF---------NEGLWEIDNNPK-VKFSSQ 95          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Celegans
Match: C06A5.3 (pep chromosome:WBcel235:I:5986492:5990581:1 gene:WBGene00015501.1 transcript:C06A5.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A5.3)

HSP 1 Score: 48.521 bits (114), Expect = 3.757e-6
Identity = 22/56 (39.29%), Postives = 32/56 (57.14%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPY 183
            F  G+  +AK+KGFP WPA++    ED   P  + P+ F+GT E  F+  N +  Y
Sbjct:   13 FQPGDLIWAKMKGFPPWPAKVLERSEDA--PARRIPVMFFGTLETSFMKPNDLSDY 66          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Celegans
Match: C06A5.3 (pep chromosome:WBcel235:I:5986443:5990581:1 gene:WBGene00015501.1 transcript:C06A5.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A5.3)

HSP 1 Score: 48.521 bits (114), Expect = 4.038e-6
Identity = 22/56 (39.29%), Postives = 32/56 (57.14%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPY 183
            F  G+  +AK+KGFP WPA++    ED   P  + P+ F+GT E  F+  N +  Y
Sbjct:   13 FQPGDLIWAKMKGFPPWPAKVLERSEDA--PARRIPVMFFGTLETSFMKPNDLSDY 66          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Celegans
Match: C06A5.3 (pep chromosome:WBcel235:I:5986492:5990581:1 gene:WBGene00015501.1 transcript:C06A5.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A5.3)

HSP 1 Score: 48.521 bits (114), Expect = 4.038e-6
Identity = 22/56 (39.29%), Postives = 32/56 (57.14%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPY 183
            F  G+  +AK+KGFP WPA++    ED   P  + P+ F+GT E  F+  N +  Y
Sbjct:   13 FQPGDLIWAKMKGFPPWPAKVLERSEDA--PARRIPVMFFGTLETSFMKPNDLSDY 66          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Fly
Match: CG7946 (gene:FBgn0039743 transcript:FBtr0085561)

HSP 1 Score: 50.0618 bits (118), Expect = 1.227e-6
Identity = 24/68 (35.29%), Postives = 38/68 (55.88%), Query Frame = 1
Query:   13 TFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVAR 216
            +++ G+  FAKVKG+P WPA+I     +      KY ++FYGT E   +    +FPY   K +F+  +
Sbjct:    9 SYSIGDLVFAKVKGYPPWPAKITKSNNN-----KKYNVYFYGTGETANIKLEDLFPYASNKERFATEK 71          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Fly
Match: CG7946 (gene:FBgn0039743 transcript:FBtr0310420)

HSP 1 Score: 50.0618 bits (118), Expect = 1.227e-6
Identity = 24/68 (35.29%), Postives = 38/68 (55.88%), Query Frame = 1
Query:   13 TFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVAR 216
            +++ G+  FAKVKG+P WPA+I     +      KY ++FYGT E   +    +FPY   K +F+  +
Sbjct:    9 SYSIGDLVFAKVKGYPPWPAKITKSNNN-----KKYNVYFYGTGETANIKLEDLFPYASNKERFATEK 71          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Zebrafish
Match: psip1a (PC4 and SFRS1 interacting protein 1a [Source:ZFIN;Acc:ZDB-GENE-050522-104])

HSP 1 Score: 79.337 bits (194), Expect = 3.424e-16
Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKG-KYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F +G+  FAK+KG+PHWPARI+ +P+    P   K+PIFF+GTHE  FL    IFPY   K K+       GF
Sbjct:    5 FKAGDLIFAKMKGYPHWPARIDEIPDGAVKPSNIKFPIFFFGTHETAFLGPKDIFPYLTNKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Zebrafish
Match: hdgfl2 (HDGF like 2 [Source:NCBI gene;Acc:80965])

HSP 1 Score: 77.411 bits (189), Expect = 1.935e-15
Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPARI  + +  VK P  K PIFF+GTHE  FL+   +F YEK + +F       GF
Sbjct:    5 FRPGDLVFAKMKGYPHWPARIEDVADGAVKPPPNKIPIFFFGTHETAFLAPKDLFAYEKNQERFGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Zebrafish
Match: hdgfl2 (HDGF like 2 [Source:NCBI gene;Acc:80965])

HSP 1 Score: 77.411 bits (189), Expect = 1.935e-15
Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPARI  + +  VK P  K PIFF+GTHE  FL+   +F YEK + +F       GF
Sbjct:    5 FRPGDLVFAKMKGYPHWPARIEDVADGAVKPPPNKIPIFFFGTHETAFLAPKDLFAYEKNQERFGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Zebrafish
Match: hdgfl2 (HDGF like 2 [Source:NCBI gene;Acc:80965])

HSP 1 Score: 77.411 bits (189), Expect = 2.041e-15
Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPARI  + +  VK P  K PIFF+GTHE  FL+   +F YEK + +F       GF
Sbjct:    5 FRPGDLVFAKMKGYPHWPARIEDVADGAVKPPPNKIPIFFFGTHETAFLAPKDLFAYEKNQERFGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Zebrafish
Match: CABZ01088864.1 (pep scaffold:GRCz11:KN150039.1:79:763:-1 gene:ENSDARG00000101464.1 transcript:ENSDART00000168136.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01088864.1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.342e-13
Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHE 147
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHE 53          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Xenopus
Match: hdgfl3 (HDGF like 3 [Source:NCBI gene;Acc:100125195])

HSP 1 Score: 90.8929 bits (224), Expect = 2.583e-21
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +GE  FAK+KG+PHWPARI+ LPE  VK P  K+PIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGELVFAKMKGYPHWPARIDELPEGAVKPPANKFPIFFFGTHETAFLGPKDLFPYKEYKEKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Xenopus
Match: hdgfl3 (HDGF like 3 [Source:NCBI gene;Acc:100125195])

HSP 1 Score: 90.5077 bits (223), Expect = 5.445e-21
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +GE  FAK+KG+PHWPARI+ LPE  VK P  K+PIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGELVFAKMKGYPHWPARIDELPEGAVKPPANKFPIFFFGTHETAFLGPKDLFPYKEYKEKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Xenopus
Match: hdgfl2 (HDGF like 2 [Source:NCBI gene;Acc:394783])

HSP 1 Score: 87.0409 bits (214), Expect = 1.647e-18
Identity = 39/75 (52.00%), Postives = 49/75 (65.33%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + F  G+  FAK+KG+PHWPARI+ + +  VK P  KYPIFFYGTHE  FL+   +FPYEK K K+       GF
Sbjct:   39 LNFKPGDLVFAKMKGYPHWPARIDDVKDGAVKPPPNKYPIFFYGTHETAFLAPKDLFPYEKCKDKYGKPNKRKGF 113          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Xenopus
Match: znf711 (zinc finger protein 711 [Source:Xenbase;Acc:XB-GENE-956382])

HSP 1 Score: 85.8853 bits (211), Expect = 4.236e-18
Identity = 37/73 (50.68%), Postives = 48/73 (65.75%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPAR++ LP+  VK P  K PIFF+GTHE  FL    IFPY++ K K++      GF
Sbjct:    5 FKPGDLIFAKMKGYPHWPARVDELPDGAVKPPTNKMPIFFFGTHETAFLGPKDIFPYDENKEKYAKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Xenopus
Match: znf711 (zinc finger protein 711 [Source:Xenbase;Acc:XB-GENE-956382])

HSP 1 Score: 85.5001 bits (210), Expect = 4.973e-18
Identity = 37/73 (50.68%), Postives = 48/73 (65.75%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPAR++ LP+  VK P  K PIFF+GTHE  FL    IFPY++ K K++      GF
Sbjct:    5 FKPGDLIFAKMKGYPHWPARVDELPDGAVKPPTNKMPIFFFGTHETAFLGPKDIFPYDENKEKYAKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Mouse
Match: Hdgfl3 (HDGF like 3 [Source:MGI Symbol;Acc:MGI:1352760])

HSP 1 Score: 90.5077 bits (223), Expect = 2.169e-21
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Mouse
Match: Hdgfl3 (HDGF like 3 [Source:MGI Symbol;Acc:MGI:1352760])

HSP 1 Score: 90.5077 bits (223), Expect = 3.090e-21
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Mouse
Match: Psip1 (PC4 and SFRS1 interacting protein 1 [Source:MGI Symbol;Acc:MGI:2142116])

HSP 1 Score: 77.0258 bits (188), Expect = 1.351e-17
Identity = 36/73 (49.32%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPAR++ +P+  VK P  K PIFF+GTHE  FL    IFPY + K K+       GF
Sbjct:    5 FKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Mouse
Match: Psip1 (PC4 and SFRS1 interacting protein 1 [Source:MGI Symbol;Acc:MGI:2142116])

HSP 1 Score: 82.0333 bits (201), Expect = 2.080e-17
Identity = 44/101 (43.56%), Postives = 58/101 (57.43%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQ 315
            F  G+  FAK+KG+PHWPAR++ +P+  VK P  K PIFF+GTHE  FL    IFPY + K K+       GF         N  +++   +PK VKF SQ
Sbjct:    5 FKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGF---------NEGLWEIDNNPK-VKFSSQ 95          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Mouse
Match: Psip1 (PC4 and SFRS1 interacting protein 1 [Source:MGI Symbol;Acc:MGI:2142116])

HSP 1 Score: 82.0333 bits (201), Expect = 2.204e-17
Identity = 44/101 (43.56%), Postives = 58/101 (57.43%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQ 315
            F  G+  FAK+KG+PHWPAR++ +P+  VK P  K PIFF+GTHE  FL    IFPY + K K+       GF         N  +++   +PK VKF SQ
Sbjct:    5 FKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGF---------NEGLWEIDNNPK-VKFSSQ 95          
BLAST of Hepatoma derived growth factor protein vs. UniProt/SwissProt
Match: sp|Q9Y3E1|HDGR3_HUMAN (Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.357e-20
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. UniProt/SwissProt
Match: sp|Q923W4|HDGR3_RAT (Hepatoma-derived growth factor-related protein 3 OS=Rattus norvegicus OX=10116 GN=Hdgfl3 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.517e-20
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. UniProt/SwissProt
Match: sp|Q9JMG7|HDGR3_MOUSE (Hepatoma-derived growth factor-related protein 3 OS=Mus musculus OX=10090 GN=Hdgfl3 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.517e-20
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    +FPY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. UniProt/SwissProt
Match: sp|Q6P4K1|HDGR2_XENTR (Hepatoma-derived growth factor-related protein 2 OS=Xenopus tropicalis OX=8364 GN=hdgfl2 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.421e-18
Identity = 39/75 (52.00%), Postives = 49/75 (65.33%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + F  G+  FAK+KG+PHWPARI+ + +  VK P  KYPIFFYGTHE  FL+   +FPYEK K K+       GF
Sbjct:    3 LNFKPGDLVFAKMKGYPHWPARIDDVKDGAVKPPPNKYPIFFYGTHETAFLAPKDLFPYEKCKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. UniProt/SwissProt
Match: sp|Q32N87|HDGR2_XENLA (Hepatoma-derived growth factor-related protein 2 OS=Xenopus laevis OX=8355 GN=hdgfl2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.383e-17
Identity = 38/73 (52.05%), Postives = 48/73 (65.75%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F  G+  FAK+KG+PHWPARI+ + +  VK P  K PIFFYGTHE  FL+   +FPY+KYK K+       GF
Sbjct:    5 FKPGDLVFAKMKGYPHWPARIDDVKDGAVKPPPNKCPIFFYGTHETAFLAPKDLFPYDKYKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. TrEMBL
Match: A0A183K4N0 (PWWP domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS9950 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.685e-32
Identity = 66/106 (62.26%), Postives = 78/106 (73.58%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            M ++ G+K FAKVKG PHWP+RIN LPEDV IPKGKYPIFFYGTHEV FL+   IFPYEK+K K+ V RN   F  GL E+E N  +  Y  DP+A  FL+QFY+F
Sbjct:    3 MAYSPGDKIFAKVKGHPHWPSRINLLPEDVPIPKGKYPIFFYGTHEVYFLAPKDIFPYEKFKHKYGVPRNKAVFQAGLREIEENPDVLLYKKDPEAETFLAQFYSF 108          
BLAST of Hepatoma derived growth factor protein vs. TrEMBL
Match: A0A430Q9B4 (PWWP domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0006739 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.810e-32
Identity = 66/106 (62.26%), Postives = 78/106 (73.58%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            M ++ G+K FAKVKG PHWP+RIN LPEDV IPKGKYPIFFYGTHEV FL+   IFPYEK+K K+ V RN   F  GL E+E N  +  Y  DP+A  FL+QFY+F
Sbjct:    1 MAYSPGDKIFAKVKGHPHWPSRINLLPEDVPIPKGKYPIFFYGTHEVYFLAPKDIFPYEKFKHKYGVPRNKAVFQAGLREIEENPDVLLYKKDPEAETFLAQFYSF 106          
BLAST of Hepatoma derived growth factor protein vs. TrEMBL
Match: A0A3Q0KKU6 (Hepatoma derived growth factor, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.899e-32
Identity = 66/106 (62.26%), Postives = 78/106 (73.58%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            M ++ G+K FAKVKG PHWP+RIN LPEDV IPKGKYPIFFYGTHEV FL+   IFPYEK+K K+ V RN   F  GL E+E N  +  Y  DP+A  FL+QFY+F
Sbjct:    1 MAYSPGDKIFAKVKGHPHWPSRINLLPEDVPIPKGKYPIFFYGTHEVYFLAPKDIFPYEKFKHKYGVPRNKAVFQAGLREIEENPDVLLYKKDPEAETFLAQFYSF 106          
BLAST of Hepatoma derived growth factor protein vs. TrEMBL
Match: A0A094ZJD6 (Hepatoma-derived growth factor-related protein 2 OS=Schistosoma haematobium OX=6185 GN=MS3_01167 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.900e-32
Identity = 66/106 (62.26%), Postives = 78/106 (73.58%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            M ++ G+K FAKVKG PHWP+RIN LPEDV IPKGKYPIFFYGTHEV FL+   IFPYEK+K K+ V RN   F  GL E+E N  +  Y  DP+A  FL+QFY+F
Sbjct:    1 MAYSPGDKIFAKVKGHPHWPSRINLLPEDVPIPKGKYPIFFYGTHEVYFLAPKDIFPYEKFKHKYGVPRNKAVFQAGLREIEENPDVLLYKKDPEAETFLAQFYSF 106          
BLAST of Hepatoma derived growth factor protein vs. TrEMBL
Match: G4LXX2 (Hepatoma derived growth factor, putative OS=Schistosoma mansoni OX=6183 GN=Smp_125050 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.164e-32
Identity = 66/106 (62.26%), Postives = 78/106 (73.58%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            M ++ G+K FAKVKG PHWP+RIN LPEDV IPKGKYPIFFYGTHEV FL+   IFPYEK+K K+ V RN   F  GL E+E N  +  Y  DP+A  FL+QFY+F
Sbjct:    3 MAYSPGDKIFAKVKGHPHWPSRINLLPEDVPIPKGKYPIFFYGTHEVYFLAPKDIFPYEKFKHKYGVPRNKAVFQAGLREIEENPDVLLYKKDPEAETFLAQFYSF 108          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Cavefish
Match: ENSAMXT00000035815.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000680.1:36607:53562:-1 gene:ENSAMXG00000044093.1 transcript:ENSAMXT00000035815.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 8.146e-22
Identity = 41/73 (56.16%), Postives = 51/73 (69.86%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F+SG+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    + PY++YK KF  +    GF
Sbjct:    5 FSSGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLLPYKEYKDKFGKSNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Cavefish
Match: ENSAMXT00000035361.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000680.1:25149:53477:-1 gene:ENSAMXG00000044093.1 transcript:ENSAMXT00000035361.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 2.504e-20
Identity = 39/73 (53.42%), Postives = 50/73 (68.49%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    + PY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLLPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Cavefish
Match: ENSAMXT00000042912.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000680.1:36200:53477:-1 gene:ENSAMXG00000044093.1 transcript:ENSAMXT00000042912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 5.946e-20
Identity = 39/73 (53.42%), Postives = 50/73 (68.49%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            + +G+  FAK+KG+PHWPARI+ LPE  VK P  KYPIFF+GTHE  FL    + PY++YK KF  +    GF
Sbjct:    9 YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLLPYKEYKDKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Cavefish
Match: psip1a (PC4 and SFRS1-interacting protein-like [Source:NCBI gene;Acc:103040307])

HSP 1 Score: 75.485 bits (184), Expect = 6.940e-15
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKG-KYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            +  G+  FAK+KG+PHWPARI+ +P+    P   K+PIFF+GTHE  FL    IFPY   K K+       GF
Sbjct:    5 YKPGDLIFAKMKGYPHWPARIDEVPDGAVKPANIKFPIFFFGTHETAFLGPKDIFPYLPNKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Cavefish
Match: psip1a (PC4 and SFRS1-interacting protein-like [Source:NCBI gene;Acc:103040307])

HSP 1 Score: 75.485 bits (184), Expect = 7.746e-15
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKG-KYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            +  G+  FAK+KG+PHWPARI+ +P+    P   K+PIFF+GTHE  FL    IFPY   K K+       GF
Sbjct:    5 YKPGDLIFAKMKGYPHWPARIDEVPDGAVKPANIKFPIFFFGTHETAFLGPKDIFPYLPNKDKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010402.1 (pep scaffold:Pmarinus_7.0:GL477087:153717:159376:-1 gene:ENSPMAG00000009421.1 transcript:ENSPMAT00000010402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 2.187e-18
Identity = 38/73 (52.05%), Postives = 47/73 (64.38%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            +  G+  FAK+KG+PHWPARI+ + E  VK P  KYPIFFYGTHE  FL    IFPY + K+K+       GF
Sbjct:    5 YKPGDLIFAKMKGYPHWPARIDEVAEGAVKPPSSKYPIFFYGTHETAFLGVKDIFPYLQTKNKYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Nematostella
Match: EDO42006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2I6])

HSP 1 Score: 81.2629 bits (199), Expect = 9.974e-20
Identity = 37/74 (50.00%), Postives = 49/74 (66.22%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            MT+  G+  +AK++G+PHWPARI+   +D  IP  KYPIFFYGTHE   +    +FPYEK+K KF+      GF
Sbjct:    1 MTYQPGDLIWAKMRGYPHWPARIDLAAKDEVIPAKKYPIFFYGTHETAVMLPKDLFPYEKHKHKFAKPCKRKGF 74          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Medaka
Match: HDGFL3 (hepatoma-derived growth factor-related protein 3 [Source:NCBI gene;Acc:101175133])

HSP 1 Score: 87.0409 bits (214), Expect = 4.739e-20
Identity = 38/73 (52.05%), Postives = 48/73 (65.75%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            F +G+  FAK+KG+PHWPARI+ LP+  VK P  K+PIFF+GTHE  FL    + PY  YK KF  +    GF
Sbjct:    9 FKAGDLVFAKMKGYPHWPARIDELPDGAVKPPSNKHPIFFFGTHETAFLGPKDLLPYGDYKEKFGKSNKRKGF 81          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Medaka
Match: ENSORLT00000046328.1 (heparin binding growth factor [Source:NCBI gene;Acc:101161288])

HSP 1 Score: 87.0409 bits (214), Expect = 6.016e-20
Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 1
Query:   25 GEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            G+  FAK+KG+PHWPARI+ LPE  VK P  KY +FF+GTHE  FL +  +FPYE+ K KF  A    GF
Sbjct:   13 GDLVFAKMKGYPHWPARIDELPEGAVKSPSNKYQVFFFGTHETAFLGAKDLFPYEECKEKFGKANKRKGF 82          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Medaka
Match: HDGFL3 (hepatoma-derived growth factor-related protein 3 [Source:NCBI gene;Acc:101175133])

HSP 1 Score: 83.9593 bits (206), Expect = 1.430e-19
Identity = 39/75 (52.00%), Postives = 49/75 (65.33%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            M F +G+  FAK+KG+PHWPARI+ LP+  VK P  K+PIFF+GTHE  FL    + PY  YK KF  +    GF
Sbjct:    1 MYFKAGDLVFAKMKGYPHWPARIDELPDGAVKPPSNKHPIFFFGTHETAFLGPKDLLPYGDYKEKFGKSNKRKGF 75          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Medaka
Match: ENSORLT00000021204.3 (HDGF like 2 [Source:NCBI gene;Acc:101158434])

HSP 1 Score: 83.9593 bits (206), Expect = 9.359e-18
Identity = 36/74 (48.65%), Postives = 49/74 (66.22%), Query Frame = 1
Query:   13 TFASGEKCFAKVKGFPHWPARINCLPED-VKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            +F  G+  FAK+KG+PHWPARI  + +  VK P  K PIFF+GTHE  FL++  +FPYEKY+ ++       GF
Sbjct:    4 SFMPGDLVFAKMKGYPHWPARIEDVADGAVKPPPNKIPIFFFGTHETAFLAAKDLFPYEKYRERYGKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Ensembl Medaka
Match: ENSORLT00000025330.2 (pep primary_assembly:ASM223467v1:1:16538339:16540560:1 gene:ENSORLG00000020443.2 transcript:ENSORLT00000025330.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 5.606e-16
Identity = 35/70 (50.00%), Postives = 44/70 (62.86%), Query Frame = 1
Query:   25 GEKCFAKVKGFPHWPARINCLPEDVKIPKG-KYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGF 231
            G+  FAK+KG+PHWPARI+ +P+    P   KYPIFF+GTHE  FL    IFPY   K K++      GF
Sbjct:    8 GDLIFAKMKGYPHWPARIDEVPDGAVKPSNIKYPIFFFGTHETAFLGPKDIFPYLLNKEKYAKPNKRKGF 77          
BLAST of Hepatoma derived growth factor protein vs. Planmine SMEST
Match: SMESG000069102.1 (SMESG000069102.1)

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 275/275 (100.00%), Postives = 275/275 (100.00%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTFSVPKKRRHXXXXXXXXXXXXXDENLDTLEQDIKMELISNDECPVLKLETEVATLPIESDIVGHVEQNNEFKNPNEYIKLNVQPENFPMTINNNICNISATSNPVHRKKSNVIKCQTDEYANDFTNLLLEIRKYSWSKTKISDIKRLMKKNKTDSRVRIFFPWYQSLTKK 834
            MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFNNGLEELENNSTIYQYGIDPKAVKFLSQFYTFSVPKKRRHKSKSSNNKSSTSNDENLDTLEQDIKMELISNDECPVLKLETEVATLPIESDIVGHVEQNNEFKNPNEYIKLNVQPENFPMTINNNICNISATSNPVHRKKSNVIKCQTDEYANDFTNLLLEIRKYSWSKTKISDIKRLMKKNKTDSRVRIFFPWYQSLTKK
Sbjct:    1 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKFSVARNTVGFNNGLEELENNSTIYQYGIDPKAVKFLSQFYTFSVPKKRRHKSKSSNNKSSTSNDENLDTLEQDIKMELISNDECPVLKLETEVATLPIESDIVGHVEQNNEFKNPNEYIKLNVQPENFPMTINNNICNISATSNPVHRKKSNVIKCQTDEYANDFTNLLLEIRKYSWSKTKISDIKRLMKKNKTDSRVRIFFPWYQSLTKK 275          
BLAST of Hepatoma derived growth factor protein vs. Planmine SMEST
Match: SMESG000057564.1 (SMESG000057564.1)

HSP 1 Score: 118.627 bits (296), Expect = 1.458e-29
Identity = 61/105 (58.10%), Postives = 77/105 (73.33%), Query Frame = 1
Query:   16 FASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPY-EKYKSKFSVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            + SG+K FAKVKGF +WPAR+N LP D+ IP  K PIFFYGTHEV F+S  + +PY EK K+K+   ++   FN G++E+EN STIYQYG DP A  FL+QFY F
Sbjct:    7 YNSGDKIFAKVKGFVYWPARVNPLPVDIVIPPNKIPIFFYGTHEVFFISPTSCWPYDEKNKAKWGKPKSRAHFNQGMDEIENQSTIYQYGADPSAEDFLAQFYEF 111          
BLAST of Hepatoma derived growth factor protein vs. Planmine SMEST
Match: SMESG000052118.1 (SMESG000052118.1)

HSP 1 Score: 117.472 bits (293), Expect = 3.708e-29
Identity = 55/108 (50.93%), Postives = 76/108 (70.37%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKF-SVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTFS 330
            M    G KC+ K+KG+P WPARIN LP DVK+P+GK PIFFYGTHE+ +  +  IF +EK++ K+ S    +  FN+ L E++ N TI+Q G D +A++FLSQFY F+
Sbjct:    1 MNLKPGSKCWVKMKGYPPWPARINVLPSDVKLPRGKLPIFFYGTHEISYAKAKDIFDFEKFRHKYCSYKGKSAKFNDALLEVDENPTIFQLGSDTRAIEFLSQFYKFN 108          
BLAST of Hepatoma derived growth factor protein vs. Planmine SMEST
Match: SMESG000052118.1 (SMESG000052118.1)

HSP 1 Score: 117.087 bits (292), Expect = 3.988e-29
Identity = 55/107 (51.40%), Postives = 75/107 (70.09%), Query Frame = 1
Query:   10 MTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKF-SVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            M    G KC+ K+KG+P WPARIN LP DVK+P+GK PIFFYGTHE+ +  +  IF +EK++ K+ S    +  FN+ L E++ N TI+Q G D +A++FLSQFY F
Sbjct:    1 MNLKPGSKCWVKMKGYPPWPARINVLPSDVKLPRGKLPIFFYGTHEISYAKAKDIFDFEKFRHKYCSYKGKSAKFNDALLEVDENPTIFQLGSDTRAIEFLSQFYKF 107          
BLAST of Hepatoma derived growth factor protein vs. Planmine SMEST
Match: SMESG000052118.1 (SMESG000052118.1)

HSP 1 Score: 105.531 bits (262), Expect = 3.955e-25
Identity = 50/95 (52.63%), Postives = 69/95 (72.63%), Query Frame = 1
Query:   46 VKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCFLSSNAIFPYEKYKSKF-SVARNTVGFXXXXXXXXXXSTIYQYGIDPKAVKFLSQFYTF 327
            +KG+P WPARIN LP DVK+P+GK PIFFYGTHE+ +  +  IF +EK++ K+ S    +  FN+ L E++ N TI+Q G D +A++FLSQFY F
Sbjct:    1 MKGYPPWPARINVLPSDVKLPRGKLPIFFYGTHEISYAKAKDIFDFEKFRHKYCSYKGKSAKFNDALLEVDENPTIFQLGSDTRAIEFLSQFYKF 95          
The following BLAST results are available for this feature:
BLAST of Hepatoma derived growth factor protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HDGFL32.825e-2154.79HDGF like 3 [Source:HGNC Symbol;Acc:HGNC:24937][more]
HDGFL28.734e-1850.00HDGF like 2 [Source:HGNC Symbol;Acc:HGNC:14680][more]
HDGFL23.674e-1750.00HDGF like 2 [Source:HGNC Symbol;Acc:HGNC:14680][more]
HDGFL23.711e-1750.00HDGF like 2 [Source:HGNC Symbol;Acc:HGNC:14680][more]
PSIP13.941e-1743.56PC4 and SFRS1 interacting protein 1 [Source:HGNC S... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C06A5.33.757e-639.29pep chromosome:WBcel235:I:5986492:5990581:1 gene:W... [more]
C06A5.34.038e-639.29pep chromosome:WBcel235:I:5986443:5990581:1 gene:W... [more]
C06A5.34.038e-639.29pep chromosome:WBcel235:I:5986492:5990581:1 gene:W... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG79461.227e-635.29gene:FBgn0039743 transcript:FBtr0085561[more]
CG79461.227e-635.29gene:FBgn0039743 transcript:FBtr0310420[more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psip1a3.424e-1647.95PC4 and SFRS1 interacting protein 1a [Source:ZFIN;... [more]
hdgfl21.935e-1547.95HDGF like 2 [Source:NCBI gene;Acc:80965][more]
hdgfl21.935e-1547.95HDGF like 2 [Source:NCBI gene;Acc:80965][more]
hdgfl22.041e-1547.95HDGF like 2 [Source:NCBI gene;Acc:80965][more]
CABZ01088864.12.342e-1364.44pep scaffold:GRCz11:KN150039.1:79:763:-1 gene:ENSD... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdgfl32.583e-2154.79HDGF like 3 [Source:NCBI gene;Acc:100125195][more]
hdgfl35.445e-2154.79HDGF like 3 [Source:NCBI gene;Acc:100125195][more]
hdgfl21.647e-1852.00HDGF like 2 [Source:NCBI gene;Acc:394783][more]
znf7114.236e-1850.68zinc finger protein 711 [Source:Xenbase;Acc:XB-GEN... [more]
znf7114.973e-1850.68zinc finger protein 711 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hdgfl32.169e-2154.79HDGF like 3 [Source:MGI Symbol;Acc:MGI:1352760][more]
Hdgfl33.090e-2154.79HDGF like 3 [Source:MGI Symbol;Acc:MGI:1352760][more]
Psip11.351e-1749.32PC4 and SFRS1 interacting protein 1 [Source:MGI Sy... [more]
Psip12.080e-1743.56PC4 and SFRS1 interacting protein 1 [Source:MGI Sy... [more]
Psip12.204e-1743.56PC4 and SFRS1 interacting protein 1 [Source:MGI Sy... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y3E1|HDGR3_HUMAN1.357e-2054.79Hepatoma-derived growth factor-related protein 3 O... [more]
sp|Q923W4|HDGR3_RAT1.517e-2054.79Hepatoma-derived growth factor-related protein 3 O... [more]
sp|Q9JMG7|HDGR3_MOUSE1.517e-2054.79Hepatoma-derived growth factor-related protein 3 O... [more]
sp|Q6P4K1|HDGR2_XENTR8.421e-1852.00Hepatoma-derived growth factor-related protein 2 O... [more]
sp|Q32N87|HDGR2_XENLA3.383e-1752.05Hepatoma-derived growth factor-related protein 2 O... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183K4N03.685e-3262.26PWWP domain-containing protein OS=Schistosoma cura... [more]
A0A430Q9B43.810e-3262.26PWWP domain-containing protein OS=Schistosoma bovi... [more]
A0A3Q0KKU63.899e-3262.26Hepatoma derived growth factor, putative OS=Schist... [more]
A0A094ZJD63.900e-3262.26Hepatoma-derived growth factor-related protein 2 O... [more]
G4LXX24.164e-3262.26Hepatoma derived growth factor, putative OS=Schist... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035815.18.146e-2256.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035361.12.504e-2053.42pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042912.15.946e-2053.42pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
psip1a6.940e-1546.58PC4 and SFRS1-interacting protein-like [Source:NCB... [more]
psip1a7.746e-1546.58PC4 and SFRS1-interacting protein-like [Source:NCB... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010402.12.187e-1852.05pep scaffold:Pmarinus_7.0:GL477087:153717:159376:-... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420069.974e-2050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HDGFL34.739e-2052.05hepatoma-derived growth factor-related protein 3 [... [more]
ENSORLT00000046328.16.016e-2055.71heparin binding growth factor [Source:NCBI gene;Ac... [more]
HDGFL31.430e-1952.00hepatoma-derived growth factor-related protein 3 [... [more]
ENSORLT00000021204.39.359e-1848.65HDGF like 2 [Source:NCBI gene;Acc:101158434][more]
ENSORLT00000025330.25.606e-1650.00pep primary_assembly:ASM223467v1:1:16538339:165405... [more]
back to top
BLAST of Hepatoma derived growth factor protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069102.10.000e+0100.00SMESG000069102.1[more]
SMESG000057564.11.458e-2958.10SMESG000057564.1[more]
SMESG000052118.13.708e-2950.93SMESG000052118.1[more]
SMESG000052118.13.988e-2951.40SMESG000052118.1[more]
SMESG000052118.13.955e-2552.63SMESG000052118.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027313 ID=SMED30027313|Name=Hepatoma derived growth factor protein|organism=Schmidtea mediterranea sexual|type=transcript|length=900bp
AATTGAATGATGACATTTGCTTCTGGTGAAAAATGCTTTGCGAAGGTAAA
AGGCTTTCCTCATTGGCCCGCAAGAATAAACTGTTTACCAGAGGATGTTA
AAATACCAAAAGGAAAGTATCCAATATTTTTTTATGGAACTCATGAAGTT
TGTTTCCTTTCATCAAATGCCATTTTTCCTTATGAGAAATACAAATCAAA
ATTCAGTGTAGCAAGAAATACAGTTGGTTTTAATAATGGATTAGAAGAAT
TGGAAAATAATTCTACAATTTATCAATATGGAATAGATCCCAAAGCGGTA
AAATTCTTATCCCAGTTTTATACGTTTTCTGTTCCTAAAAAGCGTCGTCA
CAAATCCAAATCTAGTAACAATAAATCGTCAACTAGTAACGATGAAAATT
TGGATACATTGGAACAGGATATCAAAATGGAATTAATCTCCAATGATGAA
TGTCCAGTATTGAAATTAGAAACCGAAGTCGCTACTCTTCCAATTGAATC
TGACATTGTTGGACATGTTGAACAGAATAATGAATTTAAAAATCCGAATG
AATACATAAAATTAAACGTACAACCAGAAAACTTTCCAATGACGATTAAT
AACAATATTTGCAATATATCTGCCACTTCCAATCCTGTACATAGGAAAAA
ATCAAATGTCATAAAATGCCAAACAGATGAATACGCAAACGATTTTACAA
ATTTACTTTTAGAAATTCGCAAATATTCCTGGTCAAAAACTAAGATTTCT
GATATTAAACGTTTGATGAAGAAAAATAAAACAGATTCTCGGGTTCGGAT
ATTTTTTCCTTGGTACCAATCATTGACGAAGAAATAGGCAAATATATTTT
TTCCATTTCAATCTCGATTTGACGGAAATAGATTTTTGTATGTTTGTAGG
back to top

protein sequence of SMED30027313-orf-1

>SMED30027313-orf-1 ID=SMED30027313-orf-1|Name=SMED30027313-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MMTFASGEKCFAKVKGFPHWPARINCLPEDVKIPKGKYPIFFYGTHEVCF
LSSNAIFPYEKYKSKFSVARNTVGFNNGLEELENNSTIYQYGIDPKAVKF
LSQFYTFSVPKKRRHKSKSSNNKSSTSNDENLDTLEQDIKMELISNDECP
VLKLETEVATLPIESDIVGHVEQNNEFKNPNEYIKLNVQPENFPMTINNN
ICNISATSNPVHRKKSNVIKCQTDEYANDFTNLLLEIRKYSWSKTKISDI
KRLMKKNKTDSRVRIFFPWYQSLTKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000313PWWP_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000313PWWP domainSMARTSM00293PWWP_4coord: 3..59
e-value: 3.4E-6
score: 36.6
IPR000313PWWP domainPFAMPF00855PWWPcoord: 3..82
e-value: 1.8E-8
score: 34.6
IPR000313PWWP domainPROSITEPS50812PWWPcoord: 5..61
score: 9.767
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 1..88
e-value: 1.7E-21
score: 78.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 111..131
NoneNo IPR availablePANTHERPTHR12550HEPATOMA-DERIVED GROWTH FACTOR-RELATEDcoord: 3..133
NoneNo IPR availablePANTHERPTHR12550:SF42PC4 AND SFRS1-INTERACTING PROTEINcoord: 3..133
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 2..86