Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30027311
Length (bp)367
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027311

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30027311SMESG000009421.1 Contig6429_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30027311SMESG000009421.1 Contig6429_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30027311SMESG000009421.1 Contig6429_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 49.6766 bits (117), Expect = 2.078e-7
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  479 VGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEE 518          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 49.2914 bits (116), Expect = 2.564e-7
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA8 (tubulin alpha 8 [Source:HGNC Symbol;Acc:HGNC:12410])

HSP 1 Score: 46.9802 bits (110), Expect = 1.316e-6
Identity = 18/30 (60.00%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+ +D
Sbjct:  343 VGEGMEEGEFSEAREDLAALEKDYEEVGTD 372          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 46.9802 bits (110), Expect = 1.758e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+  D   + DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 46.595 bits (109), Expect = 1.889e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+  D   + DE  +
Sbjct:  394 VGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 433          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-6 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:P91873])

HSP 1 Score: 48.9062 bits (115), Expect = 1.276e-7
Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDE-GGNIDEAS 118
            VGEGMEEGEF+EA+++M +L +DYEEI  DE   +ID+ S
Sbjct:  415 VGEGMEEGEFSEAREDMAALEKDYEEIGEDELPDDIDDQS 454          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 46.595 bits (109), Expect = 8.472e-7
Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF EA++++ +L +DYEE+ +D
Sbjct:  412 VGEGMEEGEFTEAREDLAALEKDYEEVGAD 441          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-4 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5EDD4])

HSP 1 Score: 46.595 bits (109), Expect = 8.787e-7
Identity = 19/37 (51.35%), Postives = 29/37 (78.38%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDE 112
            VGEGMEEGEF EA++++ +L +DYEE+ +D    ++E
Sbjct:  407 VGEGMEEGEFTEAREDLAALEKDYEEVGADSNEGLEE 443          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-5 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q19490])

HSP 1 Score: 46.2098 bits (108), Expect = 9.675e-7
Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDE 112
            VGEGMEEGEF+EA+++M +L +DYEE+  D     DE
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGVDSFDPNDE 445          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 46.2098 bits (108), Expect = 9.872e-7
Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF EA++++ +L +DYEE+ +D
Sbjct:  407 VGEGMEEGEFTEAREDLAALEKDYEEVGAD 436          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 45.4394 bits (106), Expect = 2.851e-6
Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+  D
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 45.4394 bits (106), Expect = 2.906e-6
Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+  D
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 44.2838 bits (103), Expect = 7.491e-6
Identity = 19/37 (51.35%), Postives = 27/37 (72.97%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDE 112
            VGEGMEEGEF EA++++ +L +DYEE+  D    + E
Sbjct:  409 VGEGMEEGEFAEAREDLAALEKDYEEVGIDSTTELGE 445          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba4l (tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-030131-5588])

HSP 1 Score: 48.521 bits (114), Expect = 2.602e-7
Identity = 21/37 (56.76%), Postives = 30/37 (81.08%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDE 112
            VGEGMEEGEF+EA+++M +L +DYEE+A+D   +  E
Sbjct:  415 VGEGMEEGEFSEAREDMAALEKDYEEVAADSTDDCGE 451          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch211-114n24.6 (si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214-26])

HSP 1 Score: 47.7506 bits (112), Expect = 5.265e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 47.7506 bits (112), Expect = 5.471e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l3 (tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-040801-77])

HSP 1 Score: 47.3654 bits (111), Expect = 6.325e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba2 (tubulin, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1970])

HSP 1 Score: 46.595 bits (109), Expect = 1.164e-6
Identity = 19/30 (63.33%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+  D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: gpr137c (G protein-coupled receptor 137C [Source:Xenbase;Acc:XB-GENE-989120])

HSP 1 Score: 48.9062 bits (115), Expect = 2.629e-7
Identity = 21/30 (70.00%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEEIA D
Sbjct:  402 VGEGMEEGEFSEAREDMAALEKDYEEIACD 431          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1c (tubulin alpha 1c [Source:NCBI gene;Acc:394675])

HSP 1 Score: 48.9062 bits (115), Expect = 3.108e-7
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSADAEDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 48.1358 bits (113), Expect = 6.387e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  419 VGEGMEEGEFSEAREDMAALEKDYEEVGTD 448          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 47.7506 bits (112), Expect = 7.288e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: ENSXETT00000053522.1 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:100497157])

HSP 1 Score: 47.7506 bits (112), Expect = 7.427e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  408 VGEGMEEGEFSEAREDMAALEKDYEEVGTD 437          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 48.9062 bits (115), Expect = 2.199e-7
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 46.9802 bits (110), Expect = 1.207e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+  D   + DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba8 (tubulin, alpha 8 [Source:MGI Symbol;Acc:MGI:1858225])

HSP 1 Score: 46.595 bits (109), Expect = 1.423e-6
Identity = 18/30 (60.00%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGTD 438          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 46.595 bits (109), Expect = 1.424e-6
Identity = 19/30 (63.33%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+  D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 46.595 bits (109), Expect = 1.424e-6
Identity = 19/30 (63.33%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+  D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q9BQE3|TBA1C_HUMAN (Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.231e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEE 448          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q6AYZ1|TBA1C_RAT (Tubulin alpha-1C chain OS=Rattus norvegicus OX=10116 GN=Tuba1c PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.509e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEE 448          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68373|TBA1C_MOUSE (Tubulin alpha-1C chain OS=Mus musculus OX=10090 GN=Tuba1c PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.538e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEE 448          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68365|TBA1C_CRIGR (Tubulin alpha-1C chain OS=Cricetulus griseus OX=10029 GN=TUBA1C PE=2 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.538e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEE 448          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P08537|TBA_XENLA (Tubulin alpha chain OS=Xenopus laevis OX=8355 GN=tuba PE=2 SV=2)

HSP 1 Score: 48.9062 bits (115), Expect = 1.646e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSADAEDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch73-199e17.1 (tubulin alpha chain-like [Source:NCBI gene;Acc:103038622])

HSP 1 Score: 51.6026 bits (122), Expect = 2.072e-8
Identity = 22/37 (59.46%), Postives = 31/37 (83.78%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDE 112
            VGEGMEEGEF+EA+++M +L +DYEE+ +D  G+ DE
Sbjct:  408 VGEGMEEGEFSEAREDMAALEKDYEEVGTDSMGDEDE 444          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch211-114n24.6 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:103034569])

HSP 1 Score: 48.9062 bits (115), Expect = 1.695e-7
Identity = 20/34 (58.82%), Postives = 29/34 (85.29%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGN 103
            VGEGMEEGEF+EA+++M +L +DYEE+ +D  G+
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDSVGD 442          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000025205.2 (tubulin alpha-8 chain-like [Source:NCBI gene;Acc:103041851])

HSP 1 Score: 48.9062 bits (115), Expect = 2.017e-7
Identity = 20/34 (58.82%), Postives = 28/34 (82.35%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGN 103
            VGEGMEEGEF+EA+++M +L +DYEE+ +D   N
Sbjct:  408 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAEN 441          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000004574.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14655015:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000004574.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 2.721e-7
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  436 VGEGMEEGEFSEAREDMAALEKDYEEVGADSLEGEDEGEE 475          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000008906.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14653607:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000008906.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.823e-7
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D     DE  +
Sbjct:  412 VGEGMEEGEFSEAREDMAALEKDYEEVGADSLEGEDEGEE 451          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO45429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT99])

HSP 1 Score: 48.521 bits (114), Expect = 7.722e-8
Identity = 22/38 (57.89%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD-EGGNIDE 112
            VGEGMEEGEF+EA++++ +L +DYEE+ +D +GG  DE
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGADYDGGEEDE 446          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S698])

HSP 1 Score: 46.2098 bits (108), Expect = 5.101e-7
Identity = 18/30 (60.00%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGAD 438          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX8])

HSP 1 Score: 46.2098 bits (108), Expect = 6.535e-7
Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+  D
Sbjct:  399 VGEGMEEGEFSEAREDLAALEKDYEEVGVD 428          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO46332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB6])

HSP 1 Score: 45.8246 bits (107), Expect = 7.581e-7
Identity = 18/30 (60.00%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGAD 438          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT1])

HSP 1 Score: 45.4394 bits (106), Expect = 1.106e-6
Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA++++ +L +DYEE+  D
Sbjct:  409 VGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000003572.2 (tubulin alpha chain [Source:NCBI gene;Acc:101171518])

HSP 1 Score: 50.447 bits (119), Expect = 4.737e-8
Identity = 22/40 (55.00%), Postives = 31/40 (77.50%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEF+EA+++M +L +DYEE+ +D  G  DE  +
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDSVGEEDEGEE 448          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020554.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 48.521 bits (114), Expect = 2.706e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020553.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 48.521 bits (114), Expect = 2.706e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020548.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 48.521 bits (114), Expect = 2.706e-7
Identity = 19/30 (63.33%), Postives = 27/30 (90.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+ +D
Sbjct:  409 VGEGMEEGEFSEAREDMAALEKDYEEVGAD 438          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000017742.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 48.1358 bits (113), Expect = 3.466e-7
Identity = 19/30 (63.33%), Postives = 26/30 (86.67%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASD 91
            VGEGMEEGEF+EA+++M +L +DYEE+  D
Sbjct:  454 VGEGMEEGEFSEAREDMAALEKDYEEVGVD 483          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000009421.1 (SMESG000009421.1)

HSP 1 Score: 89.3521 bits (220), Expect = 9.402e-22
Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASKGPSK 133
            VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASKGPSK
Sbjct:  408 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASKGPSK 451          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000057667.1 (SMESG000057667.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.680e-9
Identity = 25/40 (62.50%), Postives = 32/40 (80.00%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASK 121
            VGEGMEEGEFNEA+D + S+I+DYEE+A  E   I+ AS+
Sbjct:  408 VGEGMEEGEFNEARDNLDSIIKDYEEVALTEEEFINSASE 447          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000016878.1 (SMESG000016878.1)

HSP 1 Score: 50.447 bits (119), Expect = 3.776e-8
Identity = 23/31 (74.19%), Postives = 28/31 (90.32%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIASDE 94
            VGEGMEEGEFNEAKDE+ +LIQDY +I+ D+
Sbjct:  267 VGEGMEEGEFNEAKDEVNALIQDYADISLDD 297          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000019721.1 (SMESG000019721.1)

HSP 1 Score: 48.521 bits (114), Expect = 1.634e-7
Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEIAS 88
            VGEGMEEGEFNEA+DEM +LI D+ EIA+
Sbjct:  408 VGEGMEEGEFNEARDEMANLILDFMEIAT 436          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000081292.1 (SMESG000081292.1)

HSP 1 Score: 48.1358 bits (113), Expect = 2.361e-7
Identity = 20/27 (74.07%), Postives = 26/27 (96.30%), Query Frame = 2
Query:    2 VGEGMEEGEFNEAKDEMTSLIQDYEEI 82
            VGEGMEEGEFNEA+DE++++I DYEE+
Sbjct:  408 VGEGMEEGEFNEARDEISTIIIDYEEV 434          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA1C2.078e-752.50tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1C2.564e-752.50tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA81.316e-660.00tubulin alpha 8 [Source:HGNC Symbol;Acc:HGNC:12410... [more]
TUBA4A1.758e-652.50tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA4A1.889e-652.50tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-61.276e-760.00Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-18.472e-760.00Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-48.787e-751.35Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-59.675e-756.76Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-19.872e-760.00Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
alphaTub84B2.851e-660.00gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub84D2.906e-660.00gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub85E7.491e-651.35gene:FBgn0003886 transcript:FBtr0082087[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba4l2.602e-756.76tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
si:ch211-114n24.65.265e-763.33si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214... [more]
tuba8l45.471e-763.33tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba8l36.325e-763.33tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba21.164e-663.33tubulin, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr137c2.629e-770.00G protein-coupled receptor 137C [Source:Xenbase;Ac... [more]
tuba1c3.108e-752.50tubulin alpha 1c [Source:NCBI gene;Acc:394675][more]
pex16.387e-763.33peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
pex17.288e-763.33peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
ENSXETT00000053522.17.427e-763.33tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba1c2.199e-752.50tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba4a1.207e-652.50tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba81.423e-660.00tubulin, alpha 8 [Source:MGI Symbol;Acc:MGI:185822... [more]
Tuba1b1.424e-663.33tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba1a1.424e-663.33tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BQE3|TBA1C_HUMAN1.231e-652.50Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=... [more]
sp|Q6AYZ1|TBA1C_RAT1.509e-652.50Tubulin alpha-1C chain OS=Rattus norvegicus OX=101... [more]
sp|P68373|TBA1C_MOUSE1.538e-652.50Tubulin alpha-1C chain OS=Mus musculus OX=10090 GN... [more]
sp|P68365|TBA1C_CRIGR1.538e-652.50Tubulin alpha-1C chain OS=Cricetulus griseus OX=10... [more]
sp|P08537|TBA_XENLA1.646e-652.50Tubulin alpha chain OS=Xenopus laevis OX=8355 GN=t... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-199e17.12.072e-859.46tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
si:ch211-114n24.61.695e-758.82tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000025205.22.017e-758.82tubulin alpha-8 chain-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000004574.22.721e-752.50pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
ENSAMXT00000008906.23.823e-752.50pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454297.722e-857.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407795.101e-760.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380646.535e-760.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463327.581e-760.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448041.106e-660.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003572.24.737e-855.00tubulin alpha chain [Source:NCBI gene;Acc:10117151... [more]
ENSORLT00000020554.22.706e-763.33tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020553.22.706e-763.33tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020548.22.706e-763.33tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000017742.23.466e-763.33tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009421.19.402e-22100.00SMESG000009421.1[more]
SMESG000057667.13.680e-962.50SMESG000057667.1[more]
SMESG000016878.13.776e-874.19SMESG000016878.1[more]
SMESG000019721.11.634e-775.86SMESG000019721.1[more]
SMESG000081292.12.361e-774.07SMESG000081292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027311 ID=SMED30027311|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=367bp
CGTTGGAGAAGGAATGGAGGAAGGCGAATTTAATGAGGCTAAGGATGAAA
TGACAAGTCTTATTCAAGATTATGAGGAGATAGCGTCAGATGAGGGAGGT
AATATCGATGAGGCTTCTAAAGGACCTTCAAAGGCTGAACAAGCACCTCC
TGCGGTTCAAGAATATGCTGAAGAACCAGAAGAAGCAGAAGCAGGAGGCG
AAACTGAGGAAGAACCAACTGAGGTTGAAGAAGCAGATGATGGTGTTGGT
GGTGAAGAAGTCAACGAGCCTGACGAAGTTGGAGAAACTGACGAAGGAGA
AGCGGAAAACGAGGATGAGCTATATTAATATCAATCCAGCCTTAATGATC
TCCATAATTTCATCAAG
back to top

protein sequence of SMED30027311-orf-1

>SMED30027311-orf-1 ID=SMED30027311-orf-1|Name=SMED30027311-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
VGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGGNIDEASKGPSKAEQAPP
AVQEYAEEPEEAEAGGETEEEPTEVEEADDGVGGEEVNEPDEVGETDEGE
AENEDELY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0007017microtubule-based process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 1..41
e-value: 4.1E-9
score: 38.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..21
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 1..27