X1.A.B7.1

Overview
NameX1.A.B7.1 (AHD24738.1)
Smed IDSMED30027307
Length (bp)947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of X1.A.B7.1 (SMED30027307) t-SNE clustered cells

Violin plots show distribution of expression levels for X1.A.B7.1 (SMED30027307) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of X1.A.B7.1 (SMED30027307) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for X1.A.B7.1 (SMED30027307) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027307

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 SmedASXL_012471SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v4_750_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 Contig36800uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 Contig36800newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027307SMESG000067264.1 SMESG000064571.1 SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 Contig15896uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027307SMESG000067264.1 SMESG000064571.1 SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 Contig15896newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 Contig50302newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 Contig50302uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 OX_Smed_1.0.05346ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 OX_Smed_1.0.11925ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30027307SMESG000048213.1 SMESG000048212.1 SMESG000048209.1 SMESG000048206.1 SMESG000048204.1 dd_Smed_v6_750_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of X1.A.B7.1 vs. TrEMBL
Match: V9XRM1 (X1.A.B7.1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 2.737e-82
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 2
Query:  551 MKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 925
            MKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR
Sbjct:    1 MKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 125          
BLAST of X1.A.B7.1 vs. Planmine SMEST
Match: SMESG000048209.1 (SMESG000048209.1)

HSP 1 Score: 260.766 bits (665), Expect = 2.169e-88
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 2
Query:  542 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 925
            MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR
Sbjct:    1 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 128          
BLAST of X1.A.B7.1 vs. Planmine SMEST
Match: SMESG000048204.1 (SMESG000048204.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.022e-87
Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 2
Query:  542 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 925
            MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDN MAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR
Sbjct:    1 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNFMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 128          
BLAST of X1.A.B7.1 vs. Planmine SMEST
Match: SMESG000048212.1 (SMESG000048212.1)

HSP 1 Score: 254.603 bits (649), Expect = 4.371e-86
Identity = 125/128 (97.66%), Postives = 127/128 (99.22%), Query Frame = 2
Query:  542 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 925
            MSNMKISIILLVCGLAIAAVNVKVDAIPT M++FPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR
Sbjct:    1 MSNMKISIILLVCGLAIAAVNVKVDAIPTGMDQFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 128          
BLAST of X1.A.B7.1 vs. Planmine SMEST
Match: SMESG000048213.1 (SMESG000048213.1)

HSP 1 Score: 253.062 bits (645), Expect = 1.748e-85
Identity = 124/128 (96.88%), Postives = 126/128 (98.44%), Query Frame = 2
Query:  542 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 925
            MSNMKISIILLVCGLAIAAVNVKVDAIPT M++FPEISRVEYDN MAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR
Sbjct:    1 MSNMKISIILLVCGLAIAAVNVKVDAIPTGMDQFPEISRVEYDNFMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 128          
BLAST of X1.A.B7.1 vs. Planmine SMEST
Match: SMESG000048206.1 (SMESG000048206.1)

HSP 1 Score: 253.062 bits (645), Expect = 1.748e-85
Identity = 124/128 (96.88%), Postives = 126/128 (98.44%), Query Frame = 2
Query:  542 MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 925
            MSNMKISIILLVCGLAIAAVNVKVDAIPT M++FPEISRVEYDN MAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR
Sbjct:    1 MSNMKISIILLVCGLAIAAVNVKVDAIPTGMDQFPEISRVEYDNFMAKISTLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVKPLMEIKDKYLPDLNLDDLFDADSNVESR 128          
The following BLAST results are available for this feature:
BLAST of X1.A.B7.1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
V9XRM12.737e-82100.00X1.A.B7.1 OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
back to top
BLAST of X1.A.B7.1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X1.A.B7.1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048209.12.169e-88100.00SMESG000048209.1[more]
SMESG000048204.11.022e-8799.22SMESG000048204.1[more]
SMESG000048212.14.371e-8697.66SMESG000048212.1[more]
SMESG000048213.11.748e-8596.88SMESG000048213.1[more]
SMESG000048206.11.748e-8596.88SMESG000048206.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027307
GenBankAHD24738.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027307 ID=SMED30027307|Name=X1.A.B7.1|organism=Schmidtea mediterranea sexual|type=transcript|length=947bp
TAACTGAATAACACTCAAAATAATAATATTGCTAATAATAATTAGTGATG
ACAATATTAGGCAATTCGTGCCTACAAAAATTTCATTTCAATCCAAATTA
TCGATTTGTGGTCAGGCGTCATTTATCCCAATTAGCCTTATGACCCGATC
CGGTCATCACCCCAAAACTACTAGGACTTGTACATCGACAAGAAATATGC
GTGTCGCCTCGACATGGTTTATTGATTTTCAGTTGAACATTCTCGCAACG
ATTTTTCGATTTTGGATTTATTTATGCTCGTTTTCGATTATGAATTTTTT
TCATTTAATCCAGAATTTCCCCAACATTTACATTCAATCCGTTGAGTTCA
AGGAGTTGAGTTCAAAGGGTCTTGGAAGGAATTCAGGCGAATTGACAAAG
TTTCGAGTGATAATTACCTCCTTCAAAAATGAATTATAATTCCTAGAGAT
TCTATGACACATTTCAAGTGTCTCATTAATATTTGTCAAGAGGTCACGGA
GATTATTTTTCAATATATAAATTGAAGTAAAATCATACAAAATGTCAAAC
ATGAAAATCTCAATCATTTTGCTAGTTTGTGGTCTCGCCATTGCGGCCGT
CAATGTCAAAGTTGATGCAATTCCTACAGAAATGAATGAATTCCCAGAAA
TTAGTCGAGTGGAATATGATAACATTATGGCGAAAATCTCAACACTTCTT
CCTGCCGATGTGTTCCAAAAAGTTCAGGGTTACGCAACACAATTAGCTGG
TCTGTATAAACAAGTCAAAGAAGCGTGGAGTGATCCAGCGAGAAAGGACG
AATTTAACGGTTTATTTGAGAAAGTTATGGCAATCGTCAAACCGTTGATG
GAAATAAAGGACAAATATTTGCCTGATCTGAATCTCGATGATTTATTTGA
TGCAGATTCTAATGTCGAATCCCGTTAATTGTGATAAAATATAGATC
back to top

protein sequence of SMED30027307-orf-1

>SMED30027307-orf-1 ID=SMED30027307-orf-1|Name=SMED30027307-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MSNMKISIILLVCGLAIAAVNVKVDAIPTEMNEFPEISRVEYDNIMAKIS
TLLPADVFQKVQGYATQLAGLYKQVKEAWSDPARKDEFNGLFEKVMAIVK
PLMEIKDKYLPDLNLDDLFDADSNVESR*
back to top

protein sequence of SMED30027307-orf-2

>SMED30027307-orf-2 ID=SMED30027307-orf-2|Name=SMED30027307-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MTRSGHHPKTTRTCTSTRNMRVASTWFIDFQLNILATIFRFWIYLCSFSI
MNFFHLIQNFPNIYIQSVEFKELSSKGLGRNSGELTKFRVIITSFKNEL*
back to top

protein sequence of SMED30027307-orf-3

>SMED30027307-orf-3 ID=SMED30027307-orf-3|Name=SMED30027307-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MLSYSTRLISGNSFISVGIASTLTLTAAMARPQTSKMIEIFMFDILYDFT
SIYILKNNLRDLLTNINETLEMCHRISRNYNSFLKEVIITRNFVNSPEFL
PRPFELNSLNSTD*
back to top
Aliases
The feature 'X1.A.B7.1' has the following synonyms
Synonym
X1.A.B7.1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000484secretory system
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR029013HP0062-like