semaphorin-like protein

Overview
Namesemaphorin-like protein (AJA72717.1)
Smed IDSMED30027306
Length (bp)3492
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of semaphorin-like protein (SMED30027306) t-SNE clustered cells

Violin plots show distribution of expression levels for semaphorin-like protein (SMED30027306) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of semaphorin-like protein (SMED30027306) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for semaphorin-like protein (SMED30027306) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027306

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30027306SMESG000016256.1 SMESG000016255.1 SMESG000010584.1 SMESG000009925.1 dd_Smed_v4_2090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30027306SMESG000016256.1 SMESG000016255.1 SMESG000010584.1 SMESG000009925.1 dd_Smed_v4_2090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027306SMESG000016256.1 SMESG000016255.1 SMESG000010584.1 SMESG000009925.1 dd_Smed_v4_2090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027306SMESG000016255.1 SMESG000010584.1 SMESG000016256.1 SMESG000009925.1 dd_Smed_v6_2090_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of semaphorin-like protein vs. TrEMBL
Match: A0A0K0LJ47 (Semaphorin-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=semal PE=2 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 286/295 (96.95%), Postives = 290/295 (98.31%), Query Frame = 2
Query: 1880 PTAERKQFSPLMIVNIISTHGHLYRVVLCDFDNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWQ 2764
            P AERKQFSPLMIVNIISTHGHLYRVVLCDFDNG+RNHGEDK SGQWYNWCIFRFTDQPYLYRQYTPMESR+RGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIK  NENVDTRT+KLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVY+G Q
Sbjct:    1 PIAERKQFSPLMIVNIISTHGHLYRVVLCDFDNGMRNHGEDKSSGQWYNWCIFRFTDQPYLYRQYTPMESRKRGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKTTNENVDTRTSKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYEGGQ 295          
BLAST of semaphorin-like protein vs. Planmine SMEST
Match: SMESG000016256.1 (SMESG000016256.1)

HSP 1 Score: 1546.95 bits (4004), Expect = 0.000e+0
Identity = 749/804 (93.16%), Postives = 769/804 (95.65%), Query Frame = 2
Query:  554 MSCSRYEDEPMVTYRDKLNNLYVASGWGLYRXXXXXXXXXXNNSTMLYADWKLYRNLFTLPSAMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKNDLGFKYLPSDILNTLKRLTSKEYASPTFYPPDTMVQEDFMVSLTHEYIDFNSDWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRGISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDSSLGCTGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGGSYRERPFAEVGKCQTPSFYKNLNAEKFLKIQNFSNLAWPNELPNRLSSISSSFCQYSAAELYSFNASFVLPGIKFKKLFLVRENISNYAMNDIKNPTMPTAERKQFSPLMIVNIISTHGHLYRVVLCDFDNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAKNQRVPLNESAQESKNPKIV 2965
            MSCSRYEDEPMVTYRDKLNNLYVASGWGLYRPDKKDPDVPDNNSTMLYADWKLYRNLFTLPS+MAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICK+DLGFKYLP ++L  L  +TS  Y+  TFYPPDT   EDFMVS  H  IDFNS WYDGTAHLPKTHFVTPIKVNFGCYIGRRPR ISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGD SLGC GKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIG  Y++  FAEVGKCQTPSFYK LN EKFLKIQNFSNLAWPNELPNRLSS+ SSFCQYSAAELYSFNASFVLPG++FKKLFLV+ENISNYAM DIK+ T+P AERKQFSPLMIVNIISTHGHLYRVVLCDFDNG+RNHGEDK SGQWYNWCIFRFTDQPYLYRQYTPME+R+RGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHV+TTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIK   E++DTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITK DYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAKNQRVPLNESAQESKNPKIV
Sbjct:    1 MSCSRYEDEPMVTYRDKLNNLYVASGWGLYRPDKKDPDVPDNNSTMLYADWKLYRNLFTLPSSMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKDDLGFKYLPREMLTDLNPITSVYYSMATFYPPDTTSMEDFMVSPNHANIDFNSSWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRAISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDISLGCKGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGDPYKDGSFAEVGKCQTPSFYKILNVEKFLKIQNFSNLAWPNELPNRLSSMPSSFCQYSAAELYSFNASFVLPGLRFKKLFLVKENISNYAMKDIKSETIPIAERKQFSPLMIVNIISTHGHLYRVVLCDFDNGMRNHGEDKSSGQWYNWCIFRFTDQPYLYRQYTPMENRKRGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVVTTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKTVYESIDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKGDYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAKNQRVPLNESAQESKNPKIV 804          
BLAST of semaphorin-like protein vs. Planmine SMEST
Match: SMESG000016256.1 (SMESG000016256.1)

HSP 1 Score: 1540.4 bits (3987), Expect = 0.000e+0
Identity = 748/805 (92.92%), Postives = 769/805 (95.53%), Query Frame = 2
Query:  554 MSCSRYEDEPMVTYRDKLNNLYVASGWGLYRXXXXXXXXXXNNSTMLYADWKLYRNLFTLPSAMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKNDLGFKYLPSDILNTLKRLTSKEYASPTFYPPDTMVQEDFMVSLTHEYIDFNSDWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRGISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDSSLGCTGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGGSYRERPFAEVGKCQTPSFYKNLNAEKFLKIQNFSNLAWPNELPNRLSSISSSFCQYSAAELYSFNASFVLPGIKFKKLFLVRENISNYAMNDIKNPTMPTAERKQFSPLMIVNIISTHGHLYRVVLCDFDNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAKN-QRVPLNESAQESKNPKIV 2965
            MSCSRYEDEPMVTYRDKLNNLYVASGWGLYRPDKKDPDVPDNNSTMLYADWKLYRNLFTLPS+MAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICK+DLGFKYLP ++L  L  +TS  Y+  TFYPPDT   EDFMVS  H  IDFNS WYDGTAHLPKTHFVTPIKVNFGCYIGRRPR ISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGD SLGC GKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIG  Y++  FAEVGKCQTPSFYK LN EKFLKIQNFSNLAWPNELPNRLSS+ SSFCQYSAAELYSFNASFVLPG++FKKLFLV+ENISNYAM DIK+ T+P AERKQFSPLMIVNIISTHGHLYRVVLCDFDNG+RNHGEDK SGQWYNWCIFRFTDQPYLYRQYTPME+R+RGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHV+TTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIK   E++DTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITK DYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAKN +RVPLNESAQESKNPKIV
Sbjct:    1 MSCSRYEDEPMVTYRDKLNNLYVASGWGLYRPDKKDPDVPDNNSTMLYADWKLYRNLFTLPSSMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKDDLGFKYLPREMLTDLNPITSVYYSMATFYPPDTTSMEDFMVSPNHANIDFNSSWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRAISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDISLGCKGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGDPYKDGSFAEVGKCQTPSFYKILNVEKFLKIQNFSNLAWPNELPNRLSSMPSSFCQYSAAELYSFNASFVLPGLRFKKLFLVKENISNYAMKDIKSETIPIAERKQFSPLMIVNIISTHGHLYRVVLCDFDNGMRNHGEDKSSGQWYNWCIFRFTDQPYLYRQYTPMENRKRGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVVTTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKTVYESIDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKGDYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAKNPERVPLNESAQESKNPKIV 805          
BLAST of semaphorin-like protein vs. Planmine SMEST
Match: SMESG000016292.1 (SMESG000016292.1)

HSP 1 Score: 1362.05 bits (3524), Expect = 0.000e+0
Identity = 666/967 (68.87%), Postives = 781/967 (80.77%), Query Frame = 2
Query:   29 VIIALTALYLCIRFSKAYTMIKQIDNYIYIGGKNVLDKYIEDNGKLELKVRYQYVWDSQIMNGSDIGFQFHIKQWPVNYSRGPQGYAFDTCLNWKQEHLNATVRDSAFDFQHWRYHTPSGDWLVMNYSCMNSFIKSVEKYDNNTLWVCGTFGAFPRAFSVDINTLKFIKFVDVNVMSCSRYEDEPMVTYRDKLNNLYVASGWGLYRXXXXXXXXXXNNSTMLYADWKLYRNLFTLPSAMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKNDLGFKYLPSDILNTLKRLTSKEYASPTFYPPDTMVQEDFMVSLTHEYIDFNSDWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRGISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDSSLGCTGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGGS----YRERPFAEVGKCQTPSFYKNLNAEKFLKIQNFSNLAWPNELPNRLSSISSSFCQYSAAELYSFNASFVLPGIKFKKLFLVRENISNYAMNDIKNPTMPT-AERKQFSPLMIVNIISTHGHLYRVVLCDFDNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWQPVNGWKVT--AICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAK 2908
            +  A+  L +    S  Y+++K+ID  +Y+GG+N L  Y   N KL   V   Y +  +I NGSDIGF+F I ++P   +  P   AFDTCLNWKQ HLN + R+SAFD+QH  YHTPSGDW  M++ CMNSFIK +EK DN TLWVCGTFG+FPRAFSV  ++LKFIKF+DVN+MSC+RY DEPMV+YRD+L+NLY+ SGWGLY+PDK +PDVP+NNSTM+Y+DW+L+RNLFTLPSAMAWVLSSDV+FINVVKET+ HLYFFGHEINNQYGLNNQEDR+AWQSFMVRICKND+GFK +P      +K      + S  FY   ++ + D+ +S TH+    N DW+  T HLP  HF +  K+NFGCYIG+RPR ISDN+ WG TNV+Y+N L DVIFDP++ I+F TK+ +   GC+ + HEQIPL+G+FN  G+ GT +  +GALCQLQIN NIF E+GS+++ Y + N     +AYE++M  +S S SNFYSRT+HRT+G T++PYWNQGV IG +    Y +  F  +GKCQ  SF+K L  +KFLKI NFSN  WPNELPNRLSSI S+ CQ+SAAELYSFNA+ ++PG++F+ +FLV +NI+NY M++++  T      RK FSPLM V IISTHGHLYRVVLCDFDNG+RNHGEDK SGQWYNWCIFRFTDQPYLYRQYTPMESR+RGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCA+FIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGW PVN WK+T     +I L L+A IGAL+Y FRN+ N       +PP   ++
Sbjct:    2 IFSAIMFLEILSFISTDYSVVKEIDGVVYVGGRNSLSSYQSINEKLLPLVNETYKFPPEIFNGSDIGFEFKILEFPSEITNNPTSLAFDTCLNWKQNHLNDSYRNSAFDYQHRNYHTPSGDWETMDFICMNSFIKGIEKLDNTTLWVCGTFGSFPRAFSVWKDSLKFIKFIDVNLMSCARYTDEPMVSYRDQLDNLYIGSGWGLYKPDKSNPDVPNNNSTMMYSDWRLFRNLFTLPSAMAWVLSSDVHFINVVKETEKHLYFFGHEINNQYGLNNQEDRNAWQSFMVRICKNDVGFKSVP------MKEAWLMRHMSGHFYNIGSIGEFDYTLSPTHDEAGHNPDWFHNTVHLPTKHFTSSQKINFGCYIGKRPRSISDNYFWGQTNVLYLNMLVDVIFDPNKTIKFKTKNNNKYFGCSKEPHEQIPLIGLFNSPGIRGTAMSSTGALCQLQINSNIFNEIGSKKKPYHLTNILKANDAYEELMLLNSVSVSNFYSRTLHRTSGLTIYPYWNQGVLIGDNVHRKYYKNVFDNIGKCQNSSFFKTLTKDKFLKIMNFSNTGWPNELPNRLSSIPSAVCQFSAAELYSFNATVLIPGVEFRNVFLVADNITNYYMHELEIATTENPGHRKIFSPLMTVIIISTHGHLYRVVLCDFDNGMRNHGEDKSSGQWYNWCIFRFTDQPYLYRQYTPMESRKRGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAKFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWHPVNKWKLTAIFFIIITLILIAVIGALLYWFRNHPNYHQGRTDEPPGAVSE 962          
BLAST of semaphorin-like protein vs. Planmine SMEST
Match: SMESG000016292.1 (SMESG000016292.1)

HSP 1 Score: 1360.13 bits (3519), Expect = 0.000e+0
Identity = 664/953 (69.67%), Postives = 776/953 (81.43%), Query Frame = 2
Query:   71 SKAYTMIKQIDNYIYIGGKNVLDKYIEDNGKLELKVRYQYVWDSQIMNGSDIGFQFHIKQWPVNYSRGPQGYAFDTCLNWKQEHLNATVRDSAFDFQHWRYHTPSGDWLVMNYSCMNSFIKSVEKYDNNTLWVCGTFGAFPRAFSVDINTLKFIKFVDVNVMSCSRYEDEPMVTYRDKLNNLYVASGWGLYRXXXXXXXXXXNNSTMLYADWKLYRNLFTLPSAMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKNDLGFKYLPSDILNTLKRLTSKEYASPTFYPPDTMVQEDFMVSLTHEYIDFNSDWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRGISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDSSLGCTGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGGS----YRERPFAEVGKCQTPSFYKNLNAEKFLKIQNFSNLAWPNELPNRLSSISSSFCQYSAAELYSFNASFVLPGIKFKKLFLVRENISNYAMNDIKNPTMPT-AERKQFSPLMIVNIISTHGHLYRVVLCDFDNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWQPVNGWKVT--AICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAK 2908
            S  Y+++K+ID  +Y+GG+N L  Y   N KL   V   Y +  +I NGSDIGF+F I ++P   +  P   AFDTCLNWKQ HLN + R+SAFD+QH  YHTPSGDW  M++ CMNSFIK +EK DN TLWVCGTFG+FPRAFSV  ++LKFIKF+DVN+MSC+RY DEPMV+YRD+L+NLY+ SGWGLY+PDK +PDVP+NNSTM+Y+DW+L+RNLFTLPSAMAWVLSSDV+FINVVKET+ HLYFFGHEINNQYGLNNQEDR+AWQSFMVRICKND+GFK +P      +K      + S  FY   ++ + D+ +S TH+    N DW+  T HLP  HF +  K+NFGCYIG+RPR ISDN+ WG TNV+Y+N L DVIFDP++ I+F TK+ +   GC+ + HEQIPL+G+FN  G+ GT +  +GALCQLQIN NIF E+GS+++ Y + N     +AYE++M  +S S SNFYSRT+HRT+G T++PYWNQGV IG +    Y +  F  +GKCQ  SF+K L  +KFLKI NFSN  WPNELPNRLSSI S+ CQ+SAAELYSFNA+ ++PG++F+ +FLV +NI+NY M++++  T      RK FSPLM V IISTHGHLYRVVLCDFDNG+RNHGEDK SGQWYNWCIFRFTDQPYLYRQYTPMESR+RGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCA+FIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGW PVN WK+T     +I L L+A IGAL+Y FRN+ N       +PP   ++
Sbjct:   10 STDYSVVKEIDGVVYVGGRNSLSSYQSINEKLLPLVNETYKFPPEIFNGSDIGFEFKILEFPSEITNNPTSLAFDTCLNWKQNHLNDSYRNSAFDYQHRNYHTPSGDWETMDFICMNSFIKGIEKLDNTTLWVCGTFGSFPRAFSVWKDSLKFIKFIDVNLMSCARYTDEPMVSYRDQLDNLYIGSGWGLYKPDKSNPDVPNNNSTMMYSDWRLFRNLFTLPSAMAWVLSSDVHFINVVKETEKHLYFFGHEINNQYGLNNQEDRNAWQSFMVRICKNDVGFKSVP------MKEAWLMRHMSGHFYNIGSIGEFDYTLSPTHDEAGHNPDWFHNTVHLPTKHFTSSQKINFGCYIGKRPRSISDNYFWGQTNVLYLNMLVDVIFDPNKTIKFKTKNNNKYFGCSKEPHEQIPLIGLFNSPGIRGTAMSSTGALCQLQINSNIFNEIGSKKKPYHLTNILKANDAYEELMLLNSVSVSNFYSRTLHRTSGLTIYPYWNQGVLIGDNVHRKYYKNVFDNIGKCQNSSFFKTLTKDKFLKIMNFSNTGWPNELPNRLSSIPSAVCQFSAAELYSFNATVLIPGVEFRNVFLVADNITNYYMHELEIATTENPGHRKIFSPLMTVIIISTHGHLYRVVLCDFDNGMRNHGEDKSSGQWYNWCIFRFTDQPYLYRQYTPMESRKRGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAKFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWHPVNKWKLTAIFFIIITLILIAVIGALLYWFRNHPNYHQGRTDEPPGAVSE 956          
BLAST of semaphorin-like protein vs. Planmine SMEST
Match: SMESG000016292.1 (SMESG000016292.1)

HSP 1 Score: 1344.72 bits (3479), Expect = 0.000e+0
Identity = 663/980 (67.65%), Postives = 776/980 (79.18%), Query Frame = 2
Query:   71 SKAYTMIKQIDNYIYIGGKNVLDKYIEDNGKLELKVRYQYVWDSQIMNGSDIGFQFHIKQWPVNYSRGPQGYAFDTCLNWKQEHLNATVRDSAFDFQHWRYHTPSGDWLVMNYSCMNSFIKSVEKYDNNTLWVCGTFGAFPRAFSVDINTLKFIKFVDVNVMSCSRYEDEPMVTYRDKLNNLYVASGWGLYRXXXXXXXXXXNNSTMLYADWKLYRNLFTLPSAMAWVLSSDVNFINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKNDLGFKYLPSDILNTLKRLTSKEYASPTFYPPDTMVQEDFMVSLTHEYIDFNSDWYDGTAHLPKTHFVTPIKVNFGCYIGRRPRGISDNHHWGDTNVIYMNQLADVIFDPDRKIRFSTKSGDSSLGCTGKMHEQIPLVGIFNREGLSGTNVEPSGALCQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRTIHRTNGYTLHPYWNQGVSIGGS----YRERPFAEVGKCQTPSFYKNLNAEKFLKIQNFSNLAWPNELPNRLSSISSSFCQYSAAELYSFNASFVLPGIKFKKLFLVRENISNYAMNDIKNPTMPT-AERKQFSPLMIVNIISTHGHLYRVVLCDFDNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINE---------------------------KLVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWQPVNGWKVT--AICLILLFLLAPIGALIYRFRNNLNDLLRSKQKPPSPTAK 2908
            S  Y+++K+ID  +Y+GG+N L  Y   N KL   V   Y +  +I NGSDIGF+F I ++P   +  P   AFDTCLNWKQ HLN + R+SAFD+QH  YHTPSGDW  M++ CMNSFIK +EK DN TLWVCGTFG+FPRAFSV  ++LKFIKF+DVN+MSC+RY DEPMV+YRD+L+NLY+ SGWGLY+PDK +PDVP+NNSTM+Y+DW+L+RNLFTLPSAMAWVLSSDV+FINVVKET+ HLYFFGHEINNQYGLNNQEDR+AWQSFMVRICKND+GFK +P      +K      + S  FY   ++ + D+ +S TH+    N DW+  T HLP  HF +  K+NFGCYIG+RPR ISDN+ WG TNV+Y+N L DVIFDP++ I+F TK+ +   GC+ + HEQIPL+G+FN  G+ GT +  +GALCQLQIN NIF E+GS+++ Y + N     +AYE++M  +S S SNFYSRT+HRT+G T++PYWNQGV IG +    Y +  F  +GKCQ  SF+K L  +KFLKI NFSN  WPNELPNRLSSI S+ CQ+SAAELYSFNA+ ++PG++F+ +FLV +NI+NY M++++  T      RK FSPLM V IISTHGHLYRVVLCDFDNG+RNHGEDK SGQWYNWCIFRFTDQPYLYRQYTPMESR+RGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCA+FIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINE                           +LVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGW PVN WK+T     +I L L+A IGAL+Y FRN+ N       +PP   ++
Sbjct:   10 STDYSVVKEIDGVVYVGGRNSLSSYQSINEKLLPLVNETYKFPPEIFNGSDIGFEFKILEFPSEITNNPTSLAFDTCLNWKQNHLNDSYRNSAFDYQHRNYHTPSGDWETMDFICMNSFIKGIEKLDNTTLWVCGTFGSFPRAFSVWKDSLKFIKFIDVNLMSCARYTDEPMVSYRDQLDNLYIGSGWGLYKPDKSNPDVPNNNSTMMYSDWRLFRNLFTLPSAMAWVLSSDVHFINVVKETEKHLYFFGHEINNQYGLNNQEDRNAWQSFMVRICKNDVGFKSVP------MKEAWLMRHMSGHFYNIGSIGEFDYTLSPTHDEAGHNPDWFHNTVHLPTKHFTSSQKINFGCYIGKRPRSISDNYFWGQTNVLYLNMLVDVIFDPNKTIKFKTKNNNKYFGCSKEPHEQIPLIGLFNSPGIRGTAMSSTGALCQLQINSNIFNEIGSKKKPYHLTNILKANDAYEELMLLNSVSVSNFYSRTLHRTSGLTIYPYWNQGVLIGDNVHRKYYKNVFDNIGKCQNSSFFKTLTKDKFLKIMNFSNTGWPNELPNRLSSIPSAVCQFSAAELYSFNATVLIPGVEFRNVFLVADNITNYYMHELEIATTENPGHRKIFSPLMTVIIISTHGHLYRVVLCDFDNGMRNHGEDKSSGQWYNWCIFRFTDQPYLYRQYTPMESRKRGQSVQFRASSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTVNMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLDRGFKCAKFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEIVQFYDFIFLVEIYFFPILLISFHNVAELVGNDPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKRDYSTQLLSVYKGWHPVNKWKLTAIFFIIITLILIAVIGALLYWFRNHPNYHQGRTDEPPGAVSE 983          
The following BLAST results are available for this feature:
BLAST of semaphorin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A0K0LJ470.000e+096.95Semaphorin-like protein (Fragment) OS=Schmidtea me... [more]
back to top
BLAST of semaphorin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of semaphorin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016256.10.000e+093.16SMESG000016256.1[more]
SMESG000016256.10.000e+092.92SMESG000016256.1[more]
SMESG000016292.10.000e+068.87SMESG000016292.1[more]
SMESG000016292.10.000e+069.67SMESG000016292.1[more]
SMESG000016292.10.000e+067.65SMESG000016292.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027306
GenBankAJA72717.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027306 ID=SMED30027306|Name=semaphorin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3492bp
AATTTCAAATTTATTAAAATAGATGAATGTTATAATTGCTCTAACTGCAT
TATATCTCTGCATTAGATTCTCAAAAGCATATACGATGATCAAGCAGATT
GATAATTATATCTATATCGGGGGCAAGAACGTGTTAGATAAATATATCGA
AGATAATGGGAAATTGGAACTGAAGGTTCGTTACCAATATGTTTGGGATA
GTCAAATTATGAACGGATCAGACATTGGATTTCAGTTCCATATTAAACAA
TGGCCTGTTAATTACTCCCGGGGTCCGCAAGGATATGCATTTGACACTTG
TCTCAACTGGAAACAGGAACACTTGAATGCCACCGTGAGAGATAGCGCAT
TTGATTTCCAGCATTGGAGATATCACACGCCCAGTGGCGATTGGTTAGTT
ATGAATTACAGCTGTATGAATAGCTTTATCAAATCTGTCGAAAAATACGA
CAATAATACCCTCTGGGTTTGTGGGACATTTGGAGCTTTTCCGCGGGCAT
TCTCAGTGGATATAAATACTCTGAAATTTATTAAATTTGTCGATGTGAAC
GTAATGAGCTGTAGCAGATATGAGGATGAGCCAATGGTTACATACAGAGA
TAAATTAAATAACTTGTATGTAGCTTCTGGCTGGGGTTTATATCGGCCGG
ATAAAAAGGATCCGGATGTACCAGATAATAATTCCACAATGCTCTATGCC
GACTGGAAACTGTATAGGAATTTATTTACTCTCCCATCTGCAATGGCCTG
GGTGTTGTCCAGTGATGTCAACTTCATAAACGTAGTGAAAGAAACAGACA
ACCATCTATACTTTTTTGGACATGAAATAAACAATCAGTACGGTTTGAAT
AATCAAGAGGATAGGCATGCTTGGCAAAGCTTCATGGTTAGGATTTGCAA
AAATGATCTCGGATTCAAATATCTTCCAAGCGATATTTTAAACACTCTGA
AACGGTTAACATCAAAAGAATATGCAAGTCCCACATTTTATCCGCCAGAT
ACTATGGTTCAGGAGGATTTTATGGTTTCACTAACTCATGAATATATTGA
CTTCAACAGTGACTGGTATGATGGCACAGCTCATTTGCCAAAAACTCATT
TTGTTACTCCTATTAAAGTCAATTTCGGTTGCTATATTGGCAGGAGGCCC
CGTGGTATTAGTGATAATCATCACTGGGGTGACACAAATGTCATTTATAT
GAATCAATTGGCTGATGTTATTTTTGATCCCGATCGTAAAATACGATTCT
CGACAAAATCTGGAGATAGTTCTTTGGGATGCACAGGTAAAATGCACGAG
CAGATTCCTCTGGTAGGCATTTTCAATCGAGAAGGATTATCGGGGACAAA
TGTCGAACCTTCTGGAGCTCTTTGTCAATTACAGATCAACGAAAATATTT
TCGTTGAAATGGGTTCTCAAAGGGAACAATATCGAGTACAAAATTACAAT
GGTGTAGAAAATGCATATGAGGATATAATGAGATTTAGTTCCACCAGTTA
TTCAAATTTCTACAGTAGAACTATCCACAGAACAAATGGTTACACATTGC
ATCCATATTGGAACCAAGGAGTATCAATAGGTGGTTCCTATAGGGAAAGA
CCATTTGCTGAAGTGGGAAAATGTCAAACTCCATCATTTTACAAAAACTT
AAACGCCGAGAAATTTCTTAAAATCCAAAATTTCTCCAACCTCGCCTGGC
CTAATGAATTACCGAACAGATTAAGCTCGATATCTTCAAGCTTTTGTCAA
TATTCTGCAGCTGAACTGTACAGTTTCAATGCCAGTTTCGTTTTGCCCGG
AATTAAATTCAAGAAATTATTTCTTGTCCGAGAAAATATTTCAAATTATG
CAATGAATGACATAAAAAATCCAACAATGCCCACTGCTGAGAGAAAACAA
TTTTCACCGCTTATGATTGTTAACATTATTTCAACTCATGGCCATTTGTA
TCGAGTTGTTCTCTGTGATTTCGACAATGGAATACGGAATCATGGAGAGG
ATAAATACTCAGGTCAATGGTACAATTGGTGCATTTTCCGGTTCACTGAT
CAACCGTATCTATATCGGCAATATACGCCAATGGAAAGTAGGGAAAGAGG
TCAATCCGTTCAGTTTCGAGCAAGTTCTTTATTACTGGACAAGAAAATTG
TCACTAGTGAAGACGAGTCGAGATTTCCAATAAATCGAGATCCACAATTC
CATGTTGTGAAGGATGTTTTGAGAAAGGGAAATCATTTGCATGTGATAAC
AACAAATAATATCCGCACGGTCAATATGGAGATCAATTGTGCAAAGGATT
ACGCAACATGTATTGATTGTGCCAGTGATCCTGACTGCATGTGGAATAAT
GGCAACAAGAAATGCATCAAATATAATGAGGCTGAATCTCAGAAGGAATC
AATTGTGCAAGATGTGCTGGATCGCGGTTTCAAATGCGCACAATTTATTA
AGGCAGCCAATGAAAATGTAGATACGAGAACCAATAAACTTCCCTTGACC
ATTTATTGTAACAATTCGGAATATTGGCGAGGAGAAATCCAATGGAAAAT
AAATGAAAAGCTCGTGGGAAATGATCCGGATCAGTTCATCATTCACACGG
ATCAGAAATATCTGACAATATTACATGTGAATAACTCGATCAAGTCTGTC
AAATGTCACGGAGTGAAGGAGGATCATGACAAGCTGTTTAATGGCGCTGA
ATATGACTGGATCACAAAGCGGGATTATTCCACTCAGCTCTTATCAGTTT
ATAAAGGTTGGCAGCCAGTGAATGGATGGAAGGTGACGGCCATTTGCCTT
ATTCTATTATTTCTCCTAGCTCCCATTGGAGCATTAATATATCGGTTTCG
GAATAACCTAAATGATCTGCTAAGAAGTAAGCAGAAACCTCCAAGTCCTA
CAGCTAAAAACCAGAGGGTGCCACTCAATGAAAGTGCCCAAGAATCCAAA
AATCCCAAAATTGTTTAGAACGCGATTAATTGTTCAAATTGAATTAGTGA
GTAAAATAATTTTGTGATAAAAGTTTGCATTTAATATCGTTGATCTGATA
TTTGTGGTAATCATTGGTTTTGGTTTTGATGTGTTCATTGAGTCGTGTGC
AGTCGGTTACATGCAATTCACCTTTGTAATTTGTTTTTATTATGTGAGTT
TGTGATCAATGTTTCGGTGGGGTGGGGATTGCAGCATTTAGCAATTAAAT
GGCTTTTTATCATGGATAAAACATTTAGAATAATTAGAAATTCTCAATAA
TTTTGATCTTGTCATAAACCTGATTTAAAGTTTATCTACTTTATTCTCTC
TCAACTGTTGCAGTTGCACAAACCTTTCATGGTTGGCATAGAGAACATCA
CAGACAGCTAGATGAATGTCATGGCCATAACAAAGCTGTTCACATTCCAT
CAACTTTCTAAACTTTATCATGACTAAATTTAGAGTTTTAGAAGTGTTTT
TATATTTGTAATTTTCTTCCAAAATTAAATATAATTAAATAC
back to top

protein sequence of SMED30027306-orf-1

>SMED30027306-orf-1 ID=SMED30027306-orf-1|Name=SMED30027306-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=982bp
MNVIIALTALYLCIRFSKAYTMIKQIDNYIYIGGKNVLDKYIEDNGKLEL
KVRYQYVWDSQIMNGSDIGFQFHIKQWPVNYSRGPQGYAFDTCLNWKQEH
LNATVRDSAFDFQHWRYHTPSGDWLVMNYSCMNSFIKSVEKYDNNTLWVC
GTFGAFPRAFSVDINTLKFIKFVDVNVMSCSRYEDEPMVTYRDKLNNLYV
ASGWGLYRPDKKDPDVPDNNSTMLYADWKLYRNLFTLPSAMAWVLSSDVN
FINVVKETDNHLYFFGHEINNQYGLNNQEDRHAWQSFMVRICKNDLGFKY
LPSDILNTLKRLTSKEYASPTFYPPDTMVQEDFMVSLTHEYIDFNSDWYD
GTAHLPKTHFVTPIKVNFGCYIGRRPRGISDNHHWGDTNVIYMNQLADVI
FDPDRKIRFSTKSGDSSLGCTGKMHEQIPLVGIFNREGLSGTNVEPSGAL
CQLQINENIFVEMGSQREQYRVQNYNGVENAYEDIMRFSSTSYSNFYSRT
IHRTNGYTLHPYWNQGVSIGGSYRERPFAEVGKCQTPSFYKNLNAEKFLK
IQNFSNLAWPNELPNRLSSISSSFCQYSAAELYSFNASFVLPGIKFKKLF
LVRENISNYAMNDIKNPTMPTAERKQFSPLMIVNIISTHGHLYRVVLCDF
DNGIRNHGEDKYSGQWYNWCIFRFTDQPYLYRQYTPMESRERGQSVQFRA
SSLLLDKKIVTSEDESRFPINRDPQFHVVKDVLRKGNHLHVITTNNIRTV
NMEINCAKDYATCIDCASDPDCMWNNGNKKCIKYNEAESQKESIVQDVLD
RGFKCAQFIKAANENVDTRTNKLPLTIYCNNSEYWRGEIQWKINEKLVGN
DPDQFIIHTDQKYLTILHVNNSIKSVKCHGVKEDHDKLFNGAEYDWITKR
DYSTQLLSVYKGWQPVNGWKVTAICLILLFLLAPIGALIYRFRNNLNDLL
RSKQKPPSPTAKNQRVPLNESAQESKNPKIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036352Semap_dom_sf
IPR001627Semap_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 127..308
e-value: 5.4E-12
score: 46.8
IPR001627Sema domainPFAMPF01403Semacoord: 130..297
e-value: 1.5E-6
score: 27.3
NoneNo IPR availableGENE3DG3DSA:3.30.1680.10coord: 756..809
e-value: 3.8E-5
score: 25.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 952..978
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.705
NoneNo IPR availableTMHMMTMhelixcoord: 919..941
IPR036352Sema domain superfamilySUPERFAMILYSSF101912Sema domaincoord: 130..297