Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30027302
Length (bp)1242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin alpha chain (SMED30027302) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30027302) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin alpha chain (SMED30027302) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30027302) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 1.562e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3D (tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:24071])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 1.562e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  128 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 405          

HSP 2 Score: 108.227 bits (269), Expect = 2.726e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   62 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 140          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          

HSP 2 Score: 107.842 bits (268), Expect = 4.803e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          

HSP 2 Score: 107.842 bits (268), Expect = 4.803e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 257/278 (92.45%), Postives = 274/278 (98.56%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KK+KLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDC+FMVDNEAIYDICRRNLDIERP+YTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLAT++PVISAEKAYHEQLSV+EITN CFEP+NQMVKCDPRHGKYMA C+L+RGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKV RA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DS+
Sbjct:  163 KKAKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSM 440          

HSP 2 Score: 102.834 bits (255), Expect = 9.195e-24
Identity = 61/79 (77.22%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DL LDRIR+L+D C+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-9 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q20221])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 245/277 (88.45%), Postives = 266/277 (96.03%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEF +YPAPQ++T++VEPYNSILTTHTTLEHSDC+FMVDNEAIYDICRRNLD+ RPTYTNLNRLI Q++SS+TASLRFDGALNVDLTEFQTNLVPYPRIHFPL TYAP+ISAEKAYHEQ++V+EIT  CFEP  QMVKCDPR GKYMACC+LYRGDVVPKDVNAAIAS+KTKRSIQFVDWCPTGFKVGINYQPPT VPG DL+K+QRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+D+
Sbjct:  168 KKSKLEFCIYPAPQVSTSMVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDLARPTYTNLNRLIAQVISSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLTTYAPIISAEKAYHEQMTVAEITQQCFEPGAQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIASVKTKRSIQFVDWCPTGFKVGINYQPPTVVPGADLSKLQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGLDA 444          

HSP 2 Score: 98.2117 bits (243), Expect = 3.450e-22
Identity = 54/67 (80.60%), Postives = 64/67 (95.52%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            EDAANN+ARGHYT+GKEI+D+V+DR+R+L + C GLQGFL+FHSFGGGTGSGFT+LLMERLSVDYGK
Sbjct:  102 EDAANNYARGHYTIGKEIIDVVMDRVRRLVENCRGLQGFLVFHSFGGGTGSGFTALLMERLSVDYGK 168          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 248/277 (89.53%), Postives = 266/277 (96.03%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLD+ERP+YTNLNR+I Q+VSSITASLRFDGALNVDL EFQTNLVPYPRIHFPLA Y P+ISAEKAYHE LSVS+ITN+CFEP NQMVKCDPRHGKYMA C+LYRGDVVPKDVN AIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKV RA+CMLSNTTAIAEAW+RLD+KFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALEKDYEEVG DS
Sbjct:  161 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          

HSP 2 Score: 102.064 bits (253), Expect = 1.760e-23
Identity = 61/79 (77.22%), Postives = 68/79 (86.08%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYTVGKE++D VLDRIR+L+D CSGLQGF +FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   95 EDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 173          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 248/277 (89.53%), Postives = 266/277 (96.03%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLD+ERP+YTNLNR+I Q+VSSITASLRFDGALNVDL EFQTNLVPYPRIHFPLA Y P+ISAEKAYHE LSVS+ITN+CFEP NQMVKCDPRHGKYMA C+LYRGDVVPKDVN AIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKV RA+CMLSNTTAIAEAW+RLD+KFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALEKDYEEVG DS
Sbjct:  161 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          

HSP 2 Score: 102.064 bits (253), Expect = 1.760e-23
Identity = 61/79 (77.22%), Postives = 68/79 (86.08%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYTVGKE++D VLDRIR+L+D CSGLQGF +FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   95 EDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 173          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 248/277 (89.53%), Postives = 266/277 (96.03%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLD+ERP+YTNLNR+I Q+VSSITASLRFDGALNVDL EFQTNLVPYPRIHFPLA Y P+ISAEKAYHE LSVS+ITN+CFEP NQMVKCDPRHGKYMA C+LYRGDVVPKDVN AIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKV RA+CMLSNTTAIAEAW+RLD+KFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALEKDYEEVG DS
Sbjct:  161 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          

HSP 2 Score: 102.064 bits (253), Expect = 1.760e-23
Identity = 61/79 (77.22%), Postives = 68/79 (86.08%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYTVGKE++D VLDRIR+L+D CSGLQGF +FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   95 EDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 173          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 266/277 (96.03%), Postives = 274/277 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPL TYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DS
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          

HSP 2 Score: 108.997 bits (271), Expect = 9.154e-26
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 266/277 (96.03%), Postives = 273/277 (98.56%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEFAVYPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPL TYAPVISAEKAYHEQLSV+EITNACFEP NQMVK DPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DS
Sbjct:  163 KKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          

HSP 2 Score: 108.997 bits (271), Expect = 1.057e-25
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 263/277 (94.95%), Postives = 272/277 (98.19%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTY NLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIS EKAYHEQL+V+EITNACFEP NQMVKCDPR GKYMACCMLYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALEKDYEEVGIDS
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGIDS 439          

HSP 2 Score: 107.842 bits (268), Expect = 2.739e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVD+VLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 457.988 bits (1177), Expect = 1.639e-159
Identity = 201/277 (72.56%), Postives = 245/277 (88.45%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KK KL+FAVYP+P+++TAVVEPYN++LTTH+T++HSDC FMVDNEAIYDIC  +L ++RP Y NLNRLI QIVSS TASLRF G++NVDL EFQTNLVP+PRIHFPL  YAP++SAE++ HEQ +++ +TNACFE +N MVKCDPR GK+MACCMLYRGDVVPKDVNAA+++IK+KR IQFVDWCPTGFK+GINY+ P  VP GDLAK  RA CMLSNTTAI+ A++ L +KFDLM+ KRAFVHWYVGEGMEEGEF+EARE++A LE+D+EEVG+D+
Sbjct:  174 KKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVGLDN 450          

HSP 2 Score: 81.6481 bits (200), Expect = 1.586e-16
Identity = 47/67 (70.15%), Postives = 58/67 (86.57%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            EDAANN+ARG Y++GKE++D V  R++K+++QC  LQGFLIFHS GGGTGSGFTSLL+ERLS DY K
Sbjct:  108 EDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSK 174          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 327.405 bits (838), Expect = 2.422e-108
Identity = 146/273 (53.48%), Postives = 195/273 (71.43%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEV 1024
            K + +EF VYP+P I+  +VEPYN++L  H +++ +D +F+VDNEA+YDIC   L++  PTYTNLNR+I Q+VSS TAS RF G   V   E QTNLVPYPRIH+PL  YAP++    +    +S +++T  CF+ +NQMV+C+P HGKYMA  +LYRGD+ P ++N A+ +IK  RS +FVDW PTGFK+G++  PP  VPGGDLA   RA   +SN T I  AW RL +KFD +Y +RAFV+ YVGEG+EEG F+EA E++  L  DY EV
Sbjct:  164 KMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLEV 436          

HSP 2 Score: 63.1586 bits (152), Expect = 1.852e-10
Identity = 33/86 (38.37%), Postives = 58/86 (67.44%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSNSLYILPPKSLQPLL 266
            +D+ +NFARG+  +  E++D  ++ IR+++D+C  L+GFL+F + GGG+GSG  + +MERL  D+GK  +     + P  S+ P++
Sbjct:   97 DDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVI 182          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 266/278 (95.68%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV++ITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVN+AIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:   10 KKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 287          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1a (tubulin, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-090507-4])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DS+
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSI 440          

HSP 2 Score: 107.842 bits (268), Expect = 2.997e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 266/278 (95.68%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV++ITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVN+AIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 106.686 bits (265), Expect = 9.206e-25
Identity = 63/79 (79.75%), Postives = 70/79 (88.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDR RKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch211-114n24.6 (si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214-26])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVN+AIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 106.686 bits (265), Expect = 7.741e-25
Identity = 63/79 (79.75%), Postives = 70/79 (88.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDR RKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba7l (tubulin, alpha 7 like [Source:ZFIN;Acc:ZDB-GENE-040704-78])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 273/278 (98.20%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KK+KLEFAVYPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPL TYAPVISAEKAYHEQLSV EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAI SIKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALEKDYEEVG+D++
Sbjct:  163 KKAKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVVEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIGSIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGVDTI 440          

HSP 2 Score: 107.842 bits (268), Expect = 3.398e-25
Identity = 61/67 (91.04%), Postives = 65/67 (97.01%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            EDAANN+ARGHYT+GKEIVDLVLDR+RKL DQC+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRVRKLCDQCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGK 163          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  162 KKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 439          

HSP 2 Score: 108.997 bits (271), Expect = 2.120e-25
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   96 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 174          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 2.139e-25
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: faah.3 (fatty acid amide hydrolase, gene 3 [Source:Xenbase;Acc:XB-GENE-997956])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 266/278 (95.68%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPL TY+P+ISAEKAYHEQLSVSEITNACFEP+NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT+VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG DS+
Sbjct:  164 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTAVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSI 441          

HSP 2 Score: 106.686 bits (265), Expect = 1.013e-24
Identity = 63/79 (79.75%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYTVGKEI+DLVL+R+RKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   98 EDAANNYARGHYTVGKEIIDLVLERVRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 176          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  173 KKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 450          

HSP 2 Score: 100.523 bits (249), Expect = 1.745e-22
Identity = 65/90 (72.22%), Postives = 71/90 (78.89%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKL-----------SDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL           +DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   96 EDAANNYARGHYTIGKEIIDLVLDRIRKLLVSKLSFCPNKADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 185          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 267/278 (96.04%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 2.139e-25
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 1.073e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3b (tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:1095408])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 1.073e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          

HSP 2 Score: 107.842 bits (268), Expect = 3.297e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLI QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          

HSP 2 Score: 107.842 bits (268), Expect = 3.204e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 265/277 (95.67%), Postives = 274/277 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLI QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVGIDS
Sbjct:  192 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDS 468          

HSP 2 Score: 106.686 bits (265), Expect = 1.025e-24
Identity = 64/79 (81.01%), Postives = 70/79 (88.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+D VLDRIRKLSDQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:  126 EDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 204          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q68FR8|TBA3_RAT (Tubulin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tuba3a PE=2 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 7.503e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P05214|TBA3_MOUSE (Tubulin alpha-3 chain OS=Mus musculus OX=10090 GN=Tuba3a PE=1 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 7.503e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P0DPH8|TBA3D_HUMAN (Tubulin alpha-3D chain OS=Homo sapiens OX=9606 GN=TUBA3D PE=1 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 7.503e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P0DPH7|TBA3C_HUMAN (Tubulin alpha-3C chain OS=Homo sapiens OX=9606 GN=TUBA3C PE=1 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 7.503e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q32KN8|TBA3_BOVIN (Tubulin alpha-3 chain OS=Bos taurus OX=9913 GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 267/278 (96.04%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHK DLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKLDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 106.301 bits (264), Expect = 7.290e-24
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A091DWL7 (Tubulin alpha-3 chain OS=Fukomys damarensis OX=885580 GN=H920_03871 PE=3 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  378 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 655          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: L5LLI6 (Tubulin alpha-3 chain OS=Myotis davidii OX=225400 GN=MDA_GLEAN10020126 PE=3 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  504 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 781          

HSP 2 Score: 106.301 bits (264), Expect = 7.513e-21
Identity = 63/79 (79.75%), Postives = 69/79 (87.34%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+D C+GLQGFLIFHSFGGGTGSGF SLLMERLSVDYGK      ++Y  P
Sbjct:  438 EDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAP 516          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: B4GMN3 (GL12416 OS=Drosophila persimilis OX=7234 GN=Dper\GL12416 PE=3 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 266/277 (96.03%), Postives = 274/277 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPL TYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DS
Sbjct:  929 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 1205          

HSP 2 Score: 110.538 bits (275), Expect = 3.702e-22
Identity = 63/67 (94.03%), Postives = 67/67 (100.00%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK
Sbjct:  863 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK 929          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: M7BJB6 (Tubulin alpha chain OS=Chelonia mydas OX=8469 GN=UY3_04770 PE=3 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  128 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 405          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A493TML7 (Tubulin alpha chain OS=Anas platyrhynchos platyrhynchos OX=8840 PE=3 SV=1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  257 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 534          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000049713.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:103046666])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 266/278 (95.68%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          

HSP 2 Score: 107.842 bits (268), Expect = 2.614e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DS+
Sbjct:  174 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSI 451          

HSP 2 Score: 107.842 bits (268), Expect = 2.954e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:  108 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 186          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DS+
Sbjct:  174 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSI 451          

HSP 2 Score: 107.842 bits (268), Expect = 2.926e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:  108 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 186          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch211-114n24.6 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:103034569])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 265/278 (95.32%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVN+AIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 106.686 bits (265), Expect = 6.560e-25
Identity = 63/79 (79.75%), Postives = 70/79 (88.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDR RKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR+NLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV++ITNACFEP+NQMVKCDPRHGKYMACC+LYRGDVVPKDVN+AIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 106.686 bits (265), Expect = 7.158e-25
Identity = 63/79 (79.75%), Postives = 70/79 (88.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDR RKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 391.734 bits (1005), Expect = 1.136e-135
Identity = 182/189 (96.30%), Postives = 188/189 (99.47%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGF 772
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGF
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGF 351          

HSP 2 Score: 108.612 bits (270), Expect = 8.063e-27
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.525 bits (911), Expect = 2.119e-121
Identity = 161/189 (85.19%), Postives = 180/189 (95.24%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGF 772
            KKSKLEF +YPAPQ++TAVVEPYN+ILTTHTTLEHSDC+FMVDNEAIYDICR+ LDI+ P+Y NLNRLI Q+VSSITASLRFDGALNVDL EFQTNLVPYPRIHFPL TYAPVISAEKAYHEQLSV+EITNACFEP+NQMVKCDPR+GKYMACC+LYRGD+VPKDVN AIA IK++R+++FVDWCPTGF
Sbjct:  168 KKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTGF 356          

HSP 2 Score: 57.3806 bits (137), Expect = 1.824e-9
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            E  ++   RG    G++I   VL R R  S++C+GLQGFL+FHSFGGGTGSGFTSLLMERLS DYGK
Sbjct:  102 EVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGK 168          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 186.422 bits (472), Expect = 2.475e-57
Identity = 83/230 (36.09%), Postives = 135/230 (58.70%), Query Frame = 2
Query:  236 PAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKR 925
            P+P+++  VVEPYN+ L+ H  +E++D  + +DNEA+YDIC R L +  PTY +LN L+   +S +T  LRF G LN DL +   N+VP+PR+HF +  +AP+ S     +  L+V E+T   F+  N M  CDPRHG+Y+    ++RG +  K+V+  + +++ K S  FV+W P   K  +   PP          ++ +   + N+TAI E + R+  +F  M+ ++
Sbjct:  154 PSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG--------LKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          

HSP 2 Score: 53.5286 bits (127), Expect = 2.475e-57
Identity = 23/41 (56.10%), Postives = 30/41 (73.17%), Query Frame = 3
Query:   15 AANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFH 137
            A NN+A+GHYT G E+VD VLD +RK ++ C  LQGF + H
Sbjct:   79 AGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 119          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 1.216e-42
Identity = 85/293 (29.01%), Postives = 148/293 (50.51%), Query Frame = 2
Query:  215 KLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRR----------------------NLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVG-EGMEEGEFSEAREDLAALEKDYEEV 1024
            +   A+YP+ +    V  PYNS+L      EH+DC   ++N+A+ DI  +                       L  +   +  +N ++  ++ ++T+S RF+G+LNVDL E   NLVP+PR+H+ +++  P+ +          + ++ +  F   NQ+++ DPR   Y+AC ++ RG+V   DV   I  +K   S+ FVDW   G+K G+   PP   P         +L  L+N T +   +A +  +F  +Y ++A +H Y   EGME   F+EA   LA++ ++Y ++
Sbjct:  176 RFVMALYPSAE-DDVVTSPYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKPFDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERLKP--SLHFVDWNEEGWKTGLCSVPPVGYP--------HSLLALANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQL 457          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007934.1 (pep scaffold:Pmarinus_7.0:GL478704:39282:40875:1 gene:ENSPMAG00000007178.1 transcript:ENSPMAT00000007934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 7.691e-37
Identity = 52/178 (29.21%), Postives = 109/178 (61.24%), Query Frame = -3
Query:  242 LESSRTPINKLNRSFGFD*CDSCINVFWYNISSIKHTTCHVFSMSWIAFNHLIIWFKTSICYFRNT*LFMISLFC*NYWRISC*WKVNSRIWN*ICLEFS*INI*STVKSKRRSDRTDNLTN*SV*ICVSRSFYIEISSTNIINGFIINHKSTI*MFQSCVGC*N*IIRFNNGCSDLG 775
            LE+S TP++KL+R+FGF+  DS I+V  +++SS++H   HVF+++ +A +HL+ W K  I   R+  L M+     +   +    +V++R+ N + LE   I++  TV+++R  D   +L + +V + V  +  +++++ ++++G +++H+  + + Q  VG  + ++  ++G  DLG
Sbjct:    3 LEASGTPVHKLDRTFGFNGRDSSIDVLGHHVSSVQHAARHVFAVARVALHHLVGWLKAGIGDLRHRQLLMVCFLGRDDRGVGDQREVDARVGNQVGLELGEIDVEGTVEAQRGRDGRHDLADEAVEVGVGGALDVQVAAADVVDGLVVDHEGAVRVLQGGVGGEHRVVGLHHGRGDLG 180          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 474.937 bits (1221), Expect = 3.445e-167
Identity = 213/277 (76.90%), Postives = 245/277 (88.45%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEFAVYPAPQ++T+VVEPYN++LTTHTTLEH+DC FMVDNEAIYD+C+RNLDI RP++ NLN LI Q+VSS+TASLRFDG+LNVDL EFQTNLVPYPRIHFPL +Y+PV+S  KA+HE  SVSEITNACFEP NQMVKCDPR GKYMA C+LYRGDVV +DV  A+  +K K+++Q VDWCPTGFK+GI Y+PPT+ P   LA V RA+CMLSNTT+IAEAW R+D KFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALE+DY EVG DS
Sbjct:  164 KKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADS 440          

HSP 2 Score: 76.2554 bits (186), Expect = 1.345e-15
Identity = 51/67 (76.12%), Postives = 57/67 (85.07%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            EDAANN+ARGHYTVG+EI+  VLDRIRKL+DQC GLQGFL  HS GGGTGSG  SLL+E LS +YGK
Sbjct:   98 EDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGK 164          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 468.774 bits (1205), Expect = 8.046e-165
Identity = 209/277 (75.45%), Postives = 245/277 (88.45%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 1036
            KKSKLEFAVYPAPQ++T+VVEPYN++LTTHTTLEH+DC FMVDNEAIYDIC+RNL I RP+++NLN LI Q++SS+TASLRFDG+LNVDL EFQTNLVPYPRIHFPL +YAP++S ++A HE  SVSEITNACFEP NQMVKCDP  GKYMA C+LYRGDVV +DV  A+  +K K+++Q VDWCPTGFK+GI Y+PP+ +P  +LA V RA+CMLSNTTAIA+AW R+D KFDLMYAKRAFVHWYVGEGMEEGEF+EAREDLAALE+DY EVG DS
Sbjct:  164 KKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADS 440          

HSP 2 Score: 82.4185 bits (202), Expect = 1.359e-17
Identity = 53/82 (64.63%), Postives = 62/82 (75.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSNSLYILPPKSL 254
            EDAANN+ARGHYTVG+EIVD V +RIRK++DQC GLQGFL  HS GGGTGSG  SLL+E LS +YGK +S     + P   L
Sbjct:   98 EDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGK-KSKLEFAVYPAPQL 178          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 225.713 bits (574), Expect = 7.545e-70
Identity = 103/266 (38.72%), Postives = 161/266 (60.53%), Query Frame = 2
Query:  224 FAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEE 1021
            F+V P+P+ +  VVEPYN+ L+ H  +EHSD  F +DNEA+YDIC+R L + +P+Y +LN L+  ++S +T SLR+ G LN DL +   NLVP+PR+HF +  YAP+ +        L+V E+T   F+  N M   DPR+G+Y+     +RG V  K+V   +  +++K S  FV+W P   +  +    P    G D+A        ++N+T+I E + R+  +F  M+ ++AF+HWY  EGM+E EFSEA  ++  L  +Y++
Sbjct:  167 FSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQ---GLDMAAT-----FIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQ 424          

HSP 2 Score: 51.2174 bits (121), Expect = 1.558e-7
Identity = 22/41 (53.66%), Postives = 29/41 (70.73%), Query Frame = 3
Query:   15 AANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFH 137
            A N +A+GHYT G E+VD V+D IR+ ++ C  LQGF I H
Sbjct:   97 AGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITH 137          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 97.4413 bits (241), Expect = 1.496e-22
Identity = 75/284 (26.41%), Postives = 140/284 (49.30%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRR-----NLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISA---EKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWY-VGEGME-----EGEFSEAREDLAALEKDY 1015
            KK    ++V+PA + +  VV+ YN+IL     +E SD   + DN ++ +I  +     N+D++       N+LI  I+SS+T S+RF   +   ++   + L+P P +HF   ++ P  S    +   H+  S  ++     +P+N +V     +  Y        G+V P+ ++ A+   K ++ I+F  W  +   V I  + P      +  +V  +  MLSN + +   +    + FD ++AK AF++ Y VG+  +     + EF+E+RE + +L +DY
Sbjct:  164 KKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHT-----NQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMT--KLQQRIKFPSWSSSAMHVNIGRRSPYLPLQPNENEV--SGMMLSNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDY 437          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO29379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T4])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRL+GQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:   10 KKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 287          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT0])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 3.721e-26
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYTVGKEI+DLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTVGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX8])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRL+GQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  153 KKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 430          

HSP 2 Score: 76.2554 bits (186), Expect = 3.394e-15
Identity = 50/63 (79.37%), Postives = 55/63 (87.30%), Query Frame = 3
Query:   57 EIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGF+SLLMERLSVDYGK      ++Y  P
Sbjct:  103 EIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAP 165          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY2])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 268/278 (96.40%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQI+TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRL+GQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 3.652e-26
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGF+SLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO29378 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T3])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 267/278 (96.04%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFA+YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:   43 KKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSV 320          

HSP 2 Score: 54.299 bits (129), Expect = 3.529e-8
Identity = 38/51 (74.51%), Postives = 43/51 (84.31%), Query Frame = 3
Query:   93 LSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            L+DQC+GLQGFLIFHSFGGGTGSGF+SLLMERLSVDYGK      ++Y  P
Sbjct:    5 LADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAP 55          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000037900.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYN+ILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DS+
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSI 440          

HSP 2 Score: 107.842 bits (268), Expect = 2.573e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020614.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYN+ILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DS+
Sbjct:  165 KKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSI 442          

HSP 2 Score: 107.842 bits (268), Expect = 2.641e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   99 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 177          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000003572.2 (tubulin alpha chain [Source:NCBI gene;Acc:101171518])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 266/278 (95.68%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV++ITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVN+AIASIKT+RSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  163 KKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIASIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 440          

HSP 2 Score: 107.071 bits (266), Expect = 5.768e-25
Identity = 64/79 (81.01%), Postives = 70/79 (88.61%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYTVGKEI+DLVLDR RKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTVGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000034557.1 (tubulin alpha chain [Source:NCBI gene;Acc:101168810])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEF++YPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERP+YTNLNRLI QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPKDVNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG+DS+
Sbjct:  163 KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSI 440          

HSP 2 Score: 107.842 bits (268), Expect = 2.500e-25
Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGK      S+Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP 175          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020468.2 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:101155224])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 264/278 (94.96%), Postives = 274/278 (98.56%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQ++TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYD+CRRNLDIERP+YTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPL TYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACC+LYRGDVVPK+VNAAIA+IKTKRSIQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED+AALEKDYEEVG DSV
Sbjct:  205 KKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDLCRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKEVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSV 482          

HSP 2 Score: 108.612 bits (270), Expect = 2.195e-25
Identity = 62/68 (91.18%), Postives = 67/68 (98.53%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKN 212
            EDAANN+ARGHYT+GKEI+DLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK 
Sbjct:  139 EDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKK 206          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000017936.1 (SMESG000017936.1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 275/278 (98.92%), Postives = 275/278 (98.92%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIAS KTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQR LCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV
Sbjct:  148 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPINQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASNKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRGLCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 425          

HSP 2 Score: 110.923 bits (276), Expect = 1.328e-26
Identity = 66/67 (98.51%), Postives = 67/67 (100.00%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGK 209
            EDAANN+ARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK
Sbjct:   82 EDAANNYARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK 148          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005505.1 (SMESG000005505.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 272/278 (97.84%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV
Sbjct:  163 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 8.901e-26
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005493.1 (SMESG000005493.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 272/278 (97.84%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV
Sbjct:  163 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 8.648e-26
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005487.1 (SMESG000005487.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 272/278 (97.84%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV
Sbjct:  163 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 8.648e-26
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005489.1 (SMESG000005489.1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 271/278 (97.48%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  206 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSV 1039
            KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSV+EITNACFEP NQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIA+IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLAKVQRA+CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DSV
Sbjct:  163 KKSKLEFAVYPAPQIATAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDSV 440          

HSP 2 Score: 108.997 bits (271), Expect = 8.168e-26
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query:    9 EDAANNFARGHYTVGKEIVDLVLDRIRKLSDQCSGLQGFLIFHXXXXXXXXXXXXLLMERLSVDYGKNQSSN-SLYILP 242
            EDAANN+ARGHYT+GKEIVDLVLDRIRKL+DQC+GLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGK      ++Y  P
Sbjct:   97 EDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAP 175          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C1.562e-2496.40tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA3D1.562e-2496.40tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:2407... [more]
TUBA1A2.726e-2595.32tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1A4.803e-2595.32tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1A4.803e-2595.32tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mec-129.195e-2492.45Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-93.450e-2288.45Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-21.760e-2389.53Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-21.760e-2389.53Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-21.760e-2389.53Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84B9.154e-2696.03gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub84D1.057e-2596.03gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub85E2.739e-2594.95gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub67C1.639e-15972.56gene:FBgn0087040 transcript:FBtr0076393[more]
CG77942.422e-10853.48gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l40.000e+095.68tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba1a2.997e-2594.96tubulin, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-090507... [more]
tuba8l49.206e-2595.68tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-114n24.67.741e-2595.32si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214... [more]
tuba7l3.398e-2594.96tubulin, alpha 7 like [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pex12.120e-2596.40peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
pex12.139e-2596.40peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
faah.31.013e-2495.68fatty acid amide hydrolase, gene 3 [Source:Xenbase... [more]
pex11.745e-2296.40peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
pex12.139e-2596.04peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba3a1.073e-2496.40tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3b1.073e-2496.40tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1a3.297e-2595.32tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
Tuba1b3.204e-2595.32tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba4a1.025e-2495.67tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q68FR8|TBA3_RAT7.503e-2496.40Tubulin alpha-3 chain OS=Rattus norvegicus OX=1011... [more]
sp|P05214|TBA3_MOUSE7.503e-2496.40Tubulin alpha-3 chain OS=Mus musculus OX=10090 GN=... [more]
sp|P0DPH8|TBA3D_HUMAN7.503e-2496.40Tubulin alpha-3D chain OS=Homo sapiens OX=9606 GN=... [more]
sp|P0DPH7|TBA3C_HUMAN7.503e-2496.40Tubulin alpha-3C chain OS=Homo sapiens OX=9606 GN=... [more]
sp|Q32KN8|TBA3_BOVIN7.290e-2496.04Tubulin alpha-3 chain OS=Bos taurus OX=9913 GN=TUB... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091DWL70.000e+096.40Tubulin alpha-3 chain OS=Fukomys damarensis OX=885... [more]
L5LLI67.513e-2196.40Tubulin alpha-3 chain OS=Myotis davidii OX=225400 ... [more]
B4GMN33.702e-2296.03GL12416 OS=Drosophila persimilis OX=7234 GN=Dper\G... [more]
M7BJB60.000e+096.40Tubulin alpha chain OS=Chelonia mydas OX=8469 GN=U... [more]
A0A493TML70.000e+095.32Tubulin alpha chain OS=Anas platyrhynchos platyrhy... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049713.12.614e-2595.68tubulin alpha-1A chain [Source:NCBI gene;Acc:10304... [more]
tuba1a2.954e-2595.32tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
tuba1a2.926e-2595.32tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
si:ch211-114n24.66.560e-2595.32tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000042562.17.158e-2594.96tubulin alpha chain [Source:NCBI gene;Acc:10303831... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C1.136e-13596.30tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.12.119e-12185.19pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb22.475e-5736.09tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001368.11.216e-4229.01pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
ENSPMAT00000007934.17.691e-3729.21pep scaffold:Pmarinus_7.0:GL478704:39282:40875:1 g... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB13.445e-16776.90Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB38.046e-16575.45Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB27.545e-7038.72Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB41.496e-2226.41Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO293790.000e+096.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448033.721e-2696.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380643.394e-1596.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380663.652e-2696.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293783.529e-896.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037900.12.573e-2594.96tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020614.22.641e-2594.96tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000003572.25.768e-2595.68tubulin alpha chain [Source:NCBI gene;Acc:10117151... [more]
ENSORLT00000034557.12.500e-2594.96tubulin alpha chain [Source:NCBI gene;Acc:10116881... [more]
ENSORLT00000020468.22.195e-2594.96tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017936.11.328e-2698.92SMESG000017936.1[more]
SMESG000005505.18.901e-2697.84SMESG000005505.1[more]
SMESG000005493.18.648e-2697.84SMESG000005493.1[more]
SMESG000005487.18.648e-2697.84SMESG000005487.1[more]
SMESG000005489.18.168e-2697.48SMESG000005489.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027302 ID=SMED30027302|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=1242bp
CCGATCTAGAAGATGCAGCAAATAATTTCGCAAGAGGTCATTATACTGTT
GGGAAAGAAATAGTCGATCTAGTATTGGACAGGATTCGGAAATTAAGTGA
TCAGTGTTCTGGTTTACAAGGTTTTCTAATTTTTCATTCCTTTGGTGGAG
GTACTGGGTCAGGATTCACATCACTGTTAATGGAAAGGTTAAGTGTTGAT
TATGGAAAAAATCAAAGCTCGAATTCGCTGTATATCCTGCCCCCCAAATC
GCTACAGCCGTTGTTGAACCTTATAATTCAATTTTAACAACCCACACAAC
TCTGGAACATTCAGATTGTGCTTTTATGGTTGATAATGAAGCCATTTATG
ATATTTGTAGACGAAATCTCGATATAGAACGACCGACTTACACAAATTTA
AACCGATTAATTGGTCAGATTGTCAGTTCTATCACTGCGTCTCTTAGATT
TGACGGTGCTCTAAATGTTGATTTAACTGAATTCCAAACAAATTTAGTTC
CATATCCGCGAATTCACTTTCCATTAGCAACTTATGCGCCAGTAATTTCA
GCAGAAAAGGCTTATCATGAACAATTAAGTGTTTCTGAAATAACAAATGC
TTGTTTTGAACCAAATAATCAAATGGTTAAATGCGATCCACGACATGGAA
AATACATGGCATGTTGTATGCTTTATCGAGGAGATGTTGTACCAAAAGAC
GTTAATGCAGCTATCGCATCAATCAAAACCAAACGATCGATTCAGTTTGT
TGATTGGTGTCCTACTGGATTCAAGGTTGGAATAAATTATCAACCTCCGA
CTTCGGTGCCAGGTGGTGATCTTGCCAAAGTACAACGAGCCCTATGTATG
CTTAGTAACACAACAGCTATTGCAGAGGCATGGGCACGACTTGATCATAA
ATTTGATTTAATGTACGCTAAAAGAGCTTTTGTGCATTGGTATGTTGGAG
AAGGAATGGAAGAAGGTGAATTTTCTGAAGCTAGAGAAGACCTAGCAGCT
TTAGAAAAGGATTATGAAGAAGTAGGAATTGATAGTGTTGAAGGTGGTGA
AGAGGAAGGCGAAGAATATTAACGTTTTCAATTAAATACATTTTGAATTG
AAAAAATTTCTATAGGTGATTTTAGGCTTTGATTTTTTACTAAAGTCATA
TTTTCGTTTAATCATTAAATTTTTCAAAATAAAAACGTCTGAGTGATATA
TTTATTTATGTTTATTATTTTCAATACAAATGTTGATCTGAC
back to top

protein sequence of SMED30027302-orf-1

>SMED30027302-orf-1 ID=SMED30027302-orf-1|Name=SMED30027302-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDL
TEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQM
VKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFK
VGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKR
AFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSVEGGEEEGEEY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR037103Tubulin/FtsZ_C_sf
IPR002452Alpha_tubulin
IPR000217Tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR003008Tubulin_FtsZ_GTPase
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
IPR017975Tubulin_CS
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0036064ciliary basal body
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 216..236
NoneNo IPR availablePANTHERPTHR11588:SF290TUBULIN ALPHA-3 CHAINcoord: 1..244
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 119..140
score: 84.45
coord: 145..158
score: 93.16
coord: 220..236
score: 88.83
coord: 183..199
score: 83.89
coord: 12..24
score: 88.95
coord: 72..87
score: 85.61
coord: 158..177
score: 80.67
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 46..191
e-value: 1.3E-58
score: 210.7
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 61..190
e-value: 3.7E-52
score: 175.8
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 182..247
e-value: 1.1E-34
score: 120.1
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..66
e-value: 7.2E-26
score: 93.2
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..43
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 67..181
e-value: 3.4E-67
score: 225.6
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..244
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 44..234