PBX

Overview
NamePBX (AGH32779.1)
Smed IDSMED30027299
Length (bp)1524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PBX (SMED30027299) t-SNE clustered cells

Violin plots show distribution of expression levels for PBX (SMED30027299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PBX (SMED30027299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PBX (SMED30027299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
FACS sorted cell population asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30027299SMESG000022232.1 SMESG000001913.1 dd_Smed_v4_3098_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
sigma neoblastSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351.1smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30027299SMESG000022232.1 SMESG000001913.1 KC353351smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gamma neoblastSMED30027299SMESG000022232.1 SMESG000001913.1 dd_Smed_v6_3098_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PBX vs. Ensembl Human
Match: PBX3 (PBX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:8634])

HSP 1 Score: 382.874 bits (982), Expect = 6.327e-130
Identity = 190/274 (69.34%), Postives = 217/274 (79.20%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV+G      +     +      S  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   40 DGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 307          
BLAST of PBX vs. Ensembl Human
Match: PBX3 (PBX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:8634])

HSP 1 Score: 385.956 bits (990), Expect = 7.699e-130
Identity = 190/274 (69.34%), Postives = 217/274 (79.20%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV+G      +     +      S  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   40 DGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 307          
BLAST of PBX vs. Ensembl Human
Match: PBX2 (PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633])

HSP 1 Score: 380.948 bits (977), Expect = 4.641e-128
Identity = 196/308 (63.64%), Postives = 226/308 (73.38%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ----SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGG 1204
            Q  G  LQ I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R      S  +    DPQL+RLD ML+AEGV G          +          S  N IEH+DYR+KLAQIR IYHSELEKY+ ACNEFT HV+NLLREQSR+RP++P E+E MV II +KF AI+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y       A   +V+V   G    S PT  +S   GG
Sbjct:   51 QDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIR------SSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY-------AVKTAVSVTQGGHSRTSSPTPPSSAGSGG 345          
BLAST of PBX vs. Ensembl Human
Match: PBX2 (PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633])

HSP 1 Score: 380.948 bits (977), Expect = 4.641e-128
Identity = 196/308 (63.64%), Postives = 226/308 (73.38%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ----SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGG 1204
            Q  G  LQ I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R      S  +    DPQL+RLD ML+AEGV G          +          S  N IEH+DYR+KLAQIR IYHSELEKY+ ACNEFT HV+NLLREQSR+RP++P E+E MV II +KF AI+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y       A   +V+V   G    S PT  +S   GG
Sbjct:   51 QDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIR------SSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY-------AVKTAVSVTQGGHSRTSSPTPPSSAGSGG 345          
BLAST of PBX vs. Ensembl Human
Match: PBX2 (PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633])

HSP 1 Score: 380.948 bits (977), Expect = 4.641e-128
Identity = 196/308 (63.64%), Postives = 226/308 (73.38%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ----SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGG 1204
            Q  G  LQ I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R      S  +    DPQL+RLD ML+AEGV G          +          S  N IEH+DYR+KLAQIR IYHSELEKY+ ACNEFT HV+NLLREQSR+RP++P E+E MV II +KF AI+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y       A   +V+V   G    S PT  +S   GG
Sbjct:   51 QDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIR------SSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY-------AVKTAVSVTQGGHSRTSSPTPPSSAGSGG 345          
BLAST of PBX vs. Ensembl Celegans
Match: ceh-20 (Homeobox protein ceh-20 [Source:UniProtKB/Swiss-Prot;Acc:P41779])

HSP 1 Score: 311.227 bits (796), Expect = 1.801e-102
Identity = 156/263 (59.32%), Postives = 193/263 (73.38%), Query Frame = 2
Query:  311 LQNILSVAHQSLDE-AQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            L  +L +  Q+LD+    +K  L  H ++ AL+ V CE KEKT L++RN        D    DPQL+RLD ML+AEGV G +    G + S+  G        + ADYR KL QIR +Y+ EL KY+ ACNEFT HV +LL++QS+ RPI+  EIE MV II++KF  I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFY HL+NPYPSEEAK++LA++C ITVSQVSNWFGNKRIRYKKN+ KAQEEA++Y
Sbjct:   13 LDAVLKINEQTLDDNDSAKKQELQCHPMRQALFDVLCETKEKTVLTVRNQV------DETPEDPQLMRLDNMLVAEGVAGPDKG--GSLGSDASGG-------DQADYRQKLHQIRVLYNEELRKYEEACNEFTQHVRSLLKDQSQVRPIAHKEIERMVYIIQRKFNGIQVQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYGHLSNPYPSEEAKEDLARQCNITVSQVSNWFGNKRIRYKKNMAKAQEEASMY 260          
BLAST of PBX vs. Ensembl Celegans
Match: ceh-40 (Homeobox protein ceh-40 [Source:UniProtKB/Swiss-Prot;Acc:Q19503])

HSP 1 Score: 169.088 bits (427), Expect = 5.551e-48
Identity = 93/229 (40.61%), Postives = 138/229 (60.26%), Query Frame = 2
Query:  398 ALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEE 1084
            A+  V  E K K  LS +    + ++++         RLD ML AEGV G + +++  I    G +Q E        YR +L ++R+   +E + +   C ++  +V ++L++Q   RPI+    E  +  +  KF  +   LKQ+ CE V+ L+ R+LDARRKRRNFSK +TEILNEYF +++ +PYPSEE K  LA +C I+V+QVSNWFGNKRIRYKK + K ++E
Sbjct:   43 AVQDVLVEQKSKIDLSTKMMKDLEAQENDE-------RLDTMLKAEGVAGPD-DSLLRIQEAAGTDQYE--------YRQQLLKVRRELENETKAFDKHCKKWCEYVEDVLQQQGEFRPITQQSTEKFMNKMSGKFNKVCFVLKQTACEEVIQLKKRYLDARRKRRNFSKTSTEILNEYFLANINHPYPSEEVKQALAMQCNISVAQVSNWFGNKRIRYKKTMAKNEDE 255          
BLAST of PBX vs. Ensembl Celegans
Match: ceh-60 (C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:Q45EK2])

HSP 1 Score: 102.834 bits (255), Expect = 9.647e-24
Identity = 48/120 (40.00%), Postives = 71/120 (59.17%), Query Frame = 2
Query:  725 LLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEE 1084
            +LR     RPI   +   +   I K+F   +  ++      +++LR       RKRRNF K  T+IL  +F+ H  NPYPS++ K ELAK+C I +SQV+NWFGN+RIR K+  ++ QE+
Sbjct:  129 VLRNHRDFRPIDEKDFSNIRQSISKRFEHSKNNIRGEAATKILVLRREIEQQGRKRRNFDKNTTDILQNWFHDHRQNPYPSDQEKAELAKQCNIKISQVNNWFGNQRIRTKQQALRMQED 248          
BLAST of PBX vs. Ensembl Celegans
Match: irx-1 (Putative iroquois-class homeodomain protein irx-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93348])

HSP 1 Score: 64.6994 bits (156), Expect = 5.293e-11
Identity = 29/58 (50.00%), Postives = 39/58 (67.24%), Query Frame = 2
Query:  887 KRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKK 1060
            K+RN ++EAT  L ++ +SH  NPYPS+  K  LA   G+T++QVS WF N R R KK
Sbjct:  118 KKRNATREATAPLKDWLHSHRKNPYPSKADKVMLAVGTGMTLTQVSTWFANARRRLKK 175          
BLAST of PBX vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 63.5438 bits (153), Expect = 1.465e-10
Identity = 28/62 (45.16%), Postives = 42/62 (67.74%), Query Frame = 2
Query:  884 RKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIV 1069
            R R  F K+AT  L ++ + +L +PYPSEE K +LAK+ G+T+ QV+NWF N R R  + ++
Sbjct:  316 RGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 377          
BLAST of PBX vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0074137)

HSP 1 Score: 390.193 bits (1001), Expect = 1.023e-132
Identity = 194/273 (71.06%), Postives = 216/273 (79.12%), Query Frame = 2
Query:  302 GRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ--------SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            G  LQ I+S++ QSLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+RNT       +   PDPQL+RLD MLIAEGV G      G   +                 N IEH+DYRAKLAQIRQIYH ELEKY+ ACNEFT HV+NLLREQSR+RPI+P EIE MV II KKF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   44 GEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 310          
BLAST of PBX vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0074135)

HSP 1 Score: 390.193 bits (1001), Expect = 1.023e-132
Identity = 194/273 (71.06%), Postives = 216/273 (79.12%), Query Frame = 2
Query:  302 GRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ--------SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            G  LQ I+S++ QSLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+RNT       +   PDPQL+RLD MLIAEGV G      G   +                 N IEH+DYRAKLAQIRQIYH ELEKY+ ACNEFT HV+NLLREQSR+RPI+P EIE MV II KKF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   44 GEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 310          
BLAST of PBX vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0333322)

HSP 1 Score: 390.193 bits (1001), Expect = 1.023e-132
Identity = 194/273 (71.06%), Postives = 216/273 (79.12%), Query Frame = 2
Query:  302 GRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ--------SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            G  LQ I+S++ QSLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+RNT       +   PDPQL+RLD MLIAEGV G      G   +                 N IEH+DYRAKLAQIRQIYH ELEKY+ ACNEFT HV+NLLREQSR+RPI+P EIE MV II KKF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   44 GEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 310          
BLAST of PBX vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0333323)

HSP 1 Score: 390.193 bits (1001), Expect = 1.023e-132
Identity = 194/273 (71.06%), Postives = 216/273 (79.12%), Query Frame = 2
Query:  302 GRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ--------SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            G  LQ I+S++ QSLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+RNT       +   PDPQL+RLD MLIAEGV G      G   +                 N IEH+DYRAKLAQIRQIYH ELEKY+ ACNEFT HV+NLLREQSR+RPI+P EIE MV II KKF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   44 GEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 310          
BLAST of PBX vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 65.0846 bits (157), Expect = 6.914e-11
Identity = 28/63 (44.44%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  881 RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIV 1069
            ++KR  F K AT IL  + + HL +PYPSE+ K +LA+  G+T+ QV+NWF N R R  + ++
Sbjct:  351 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 413          
BLAST of PBX vs. Ensembl Zebrafish
Match: pbx3a (pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-031218-1])

HSP 1 Score: 384.415 bits (986), Expect = 4.881e-131
Identity = 191/274 (69.71%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D K Q  G  LQ I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R      S  D    DPQL+RLD ML+AEGV+G    +       +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   28 DGKQQDIGDILQQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSMR------SSQDEEPTDPQLMRLDNMLLAEGVSGPEKGSGAAAVAAATAAVGVGADNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVNIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 295          
BLAST of PBX vs. Ensembl Zebrafish
Match: pbx4 (pre-B-cell leukemia transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-000201-18])

HSP 1 Score: 383.645 bits (984), Expect = 1.446e-130
Identity = 195/287 (67.94%), Postives = 223/287 (77.70%), Query Frame = 2
Query:  260 ADPNLV-----LDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
             DP+ V     L Q  Q  G  LQ I+++  +SLDEAQ RKH+LN HRLKPAL+SV CEIKEKT LS+R    +  ED    PDPQ++RLD ML+AEGV+G      +      +   G       IEH+DYRAKLAQIRQIYHSELEKY+ AC+EFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   23 GDPDSVRKQQSLGQPQQDIGDILQQIMAITDESLDEAQARKHALNCHRLKPALFSVLCEIKEKTVLSIRG---VQEED---PPDPQIMRLDNMLLAEGVSGPEKGGGSAAAAAAAAAAGGSPNDGSIEHSDYRAKLAQIRQIYHSELEKYEQACSEFTNHVMNLLREQSRTRPISPKEIERMVAIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 303          
BLAST of PBX vs. Ensembl Zebrafish
Match: pbx3a (pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-031218-1])

HSP 1 Score: 385.571 bits (989), Expect = 2.672e-130
Identity = 191/274 (69.71%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D K Q  G  LQ I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R      S  D    DPQL+RLD ML+AEGV+G    +       +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   28 DGKQQDIGDILQQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSMR------SSQDEEPTDPQLMRLDNMLLAEGVSGPEKGSGAAAVAAATAAVGVGADNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVNIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 295          
BLAST of PBX vs. Ensembl Zebrafish
Match: pbx3b (pre-B-cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-000405-3])

HSP 1 Score: 379.793 bits (974), Expect = 6.491e-129
Identity = 188/274 (68.61%), Postives = 214/274 (78.10%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   39 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAAAGSPTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 306          
BLAST of PBX vs. Ensembl Zebrafish
Match: pbx3b (pre-B-cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-000405-3])

HSP 1 Score: 379.793 bits (974), Expect = 6.491e-129
Identity = 188/274 (68.61%), Postives = 214/274 (78.10%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   39 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAAAGSPTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 306          
BLAST of PBX vs. Ensembl Xenopus
Match: pbx2 (pre-B-cell leukemia homeobox 2 [Source:NCBI gene;Acc:100101713])

HSP 1 Score: 384.03 bits (985), Expect = 2.475e-129
Identity = 206/332 (62.05%), Postives = 238/332 (71.69%), Query Frame = 2
Query:  257 HADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ---SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQ--VSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGH---SGNNYEF 1228
            H  P    + + Q  G  LQ I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+RNT       +    DPQL+RLD ML+AEGV G          +         S  N IEH+DYR KL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQ  VSNWFGNKRIRYKKNI K QEEAN+Y       A   +V+VA  G    + PT  TS   GG    SG+N  F
Sbjct:   33 HEPPADNGEPRKQDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRNT------QEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGVSPDNSIEHSDYRNKLSQIRQIYHAELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVTVSNWFGNKRIRYKKNIGKFQEEANIY-------AVKTAVSVAQGGHSGANSPTTPTSAGSGGSFNLSGSNDMF 351          
BLAST of PBX vs. Ensembl Xenopus
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:Xenbase;Acc:XB-GENE-985138])

HSP 1 Score: 383.645 bits (984), Expect = 4.036e-129
Identity = 190/271 (70.11%), Postives = 217/271 (80.07%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  L  I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV+G      +      +   G  S  N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   35 QDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGGSSDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 299          
BLAST of PBX vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 372.089 bits (954), Expect = 7.290e-126
Identity = 185/271 (68.27%), Postives = 212/271 (78.23%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +    DPQL+RLD ML+AEGV G      +      +   G     N  EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   41 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPADPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGADNSAEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYKKNIGKFQEEANIY 305          
BLAST of PBX vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 372.089 bits (954), Expect = 9.635e-126
Identity = 185/271 (68.27%), Postives = 212/271 (78.23%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +    DPQL+RLD ML+AEGV G      +      +   G     N  EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   41 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPADPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGADNSAEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYKKNIGKFQEEANIY 305          
BLAST of PBX vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 374.015 bits (959), Expect = 1.039e-125
Identity = 185/271 (68.27%), Postives = 212/271 (78.23%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +    DPQL+RLD ML+AEGV G      +      +   G     N  EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   41 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPADPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGADNSAEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYKKNIGKFQEEANIY 305          
BLAST of PBX vs. Ensembl Mouse
Match: Pbx3 (pre B cell leukemia homeobox 3 [Source:MGI Symbol;Acc:MGI:97496])

HSP 1 Score: 382.874 bits (982), Expect = 4.344e-130
Identity = 190/274 (69.34%), Postives = 217/274 (79.20%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV+G      +     +      S  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   40 DGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 307          
BLAST of PBX vs. Ensembl Mouse
Match: Pbx3 (pre B cell leukemia homeobox 3 [Source:MGI Symbol;Acc:MGI:97496])

HSP 1 Score: 385.956 bits (990), Expect = 5.343e-130
Identity = 190/274 (69.34%), Postives = 217/274 (79.20%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV+G      +     +      S  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   40 DGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 307          
BLAST of PBX vs. Ensembl Mouse
Match: Pbx2 (pre B cell leukemia homeobox 2 [Source:MGI Symbol;Acc:MGI:1341793])

HSP 1 Score: 379.793 bits (974), Expect = 1.109e-127
Identity = 197/308 (63.96%), Postives = 227/308 (73.70%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ----SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGG 1204
            Q  G  LQ I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R      S  +    DPQL+RLD ML+AEGV G          +          S  N IEH+DYR+KLAQIR IYHSELEKY+ ACNEFT HV+NLLREQSR+RP++P E+E MV II +KF AI+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y       A   +V+VA  G    S PT  +S   GG
Sbjct:   51 QDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIR------SSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY-------AVKTAVSVAQGGHSRTSSPTPPSSAGSGG 345          
BLAST of PBX vs. Ensembl Mouse
Match: Pbx1 (pre B cell leukemia homeobox 1 [Source:MGI Symbol;Acc:MGI:97495])

HSP 1 Score: 378.637 bits (971), Expect = 3.175e-127
Identity = 186/271 (68.63%), Postives = 214/271 (78.97%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +    DPQL+RLD ML+AEGV G      +      +   G     N +EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   41 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY 305          
BLAST of PBX vs. Ensembl Mouse
Match: Pbx1 (pre B cell leukemia homeobox 1 [Source:MGI Symbol;Acc:MGI:97495])

HSP 1 Score: 375.17 bits (962), Expect = 3.640e-127
Identity = 186/271 (68.63%), Postives = 214/271 (78.97%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +    DPQL+RLD ML+AEGV G      +      +   G     N +EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   41 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY 305          
BLAST of PBX vs. UniProt/SwissProt
Match: sp|Q7PMT1|EXD_ANOGA (Homeobox protein extradenticle OS=Anopheles gambiae OX=7165 GN=exd PE=3 SV=2)

HSP 1 Score: 400.208 bits (1027), Expect = 6.443e-136
Identity = 196/287 (68.29%), Postives = 223/287 (77.70%), Query Frame = 2
Query:  236 NYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            NY    N     +  D + Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KP L++V CEIKEKT LSLRNT       +   PDPQL+RLD MLIAEGV G       D  S+      + N IEH+DYRAKLAQIRQIYH ELEKY+ AC+EFT HV+NLLREQSR+RPI+P EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   18 NYGMPTNDGQAGVDNDPRKQDIGEILQQIMNITDQSLDEAQARKHTLNCHRMKPVLFAVLCEIKEKTVLSLRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGADFLSQSDLTGGQDNAIEHSDYRAKLAQIRQIYHQELEKYEQACSEFTTHVMNLLREQSRTRPITPKEIERMVQIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 298          
BLAST of PBX vs. UniProt/SwissProt
Match: sp|Q29CT2|EXD_DROPS (Homeobox protein extradenticle OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=exd PE=3 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 9.714e-132
Identity = 194/273 (71.06%), Postives = 216/273 (79.12%), Query Frame = 2
Query:  302 GRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ--------SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            G  LQ I+S++ QSLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+RNT       +   PDPQL+RLD MLIAEGV G      G   +                 N IEH+DYRAKLAQIRQIYH ELEKY+ ACNEFT HV+NLLREQSR+RPI+P EIE MV II KKF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   44 GEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 310          
BLAST of PBX vs. UniProt/SwissProt
Match: sp|P40427|EXD_DROME (Homeobox protein extradenticle OS=Drosophila melanogaster OX=7227 GN=exd PE=1 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.026e-131
Identity = 194/273 (71.06%), Postives = 216/273 (79.12%), Query Frame = 2
Query:  302 GRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ--------SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            G  LQ I+S++ QSLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+RNT       +   PDPQL+RLD MLIAEGV G      G   +                 N IEH+DYRAKLAQIRQIYH ELEKY+ ACNEFT HV+NLLREQSR+RPI+P EIE MV II KKF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+A+EILNEYFYSHL+NPYPSEEAK+ELA+KCGITVSQVSNWFGNKRIRYKKNI KAQEEANLY
Sbjct:   44 GEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNT------QEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY 310          
BLAST of PBX vs. UniProt/SwissProt
Match: sp|B3DM47|PBX2_XENTR (Pre-B-cell leukemia transcription factor 2 OS=Xenopus tropicalis OX=8364 GN=pbx2 PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.316e-130
Identity = 206/330 (62.42%), Postives = 238/330 (72.12%), Query Frame = 2
Query:  257 HADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQ---SESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGH---SGNNYEF 1228
            H  P    + + Q  G  LQ I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+RNT       +    DPQL+RLD ML+AEGV G          +         S  N IEH+DYR KL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y       A   +V+VA  G    + PT  TS   GG    SG+N  F
Sbjct:   33 HEPPADNGEPRKQDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRNT------QEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGVSPDNSIEHSDYRNKLSQIRQIYHAELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY-------AVKTAVSVAQGGHSGANSPTTPTSAGSGGSFNLSGSNDMF 349          
BLAST of PBX vs. UniProt/SwissProt
Match: sp|P40426|PBX3_HUMAN (Pre-B-cell leukemia transcription factor 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 3.697e-129
Identity = 190/274 (69.34%), Postives = 217/274 (79.20%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH+LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV+G      +     +      S  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   40 DGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 307          
BLAST of PBX vs. TrEMBL
Match: M4QVS3 (PBX OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 389/389 (100.00%), Postives = 389/389 (100.00%), Query Frame = 2
Query:  146 MSENLXXXXXXXXXXXXXXXXXYMTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 1312
            MSENLHQPPSSWHSHPTTPNSHYMTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH
Sbjct:    1 MSENLHQPPSSWHSHPTTPNSHYMTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 389          
BLAST of PBX vs. TrEMBL
Match: A0A075A0X4 (Homeobox domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00694 PE=4 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 2.114e-165
Identity = 268/386 (69.43%), Postives = 298/386 (77.20%), Query Frame = 2
Query:  251 MNHADPN---------LVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNT---NNIGDIDSEYGGNQS--------ESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYG-GHSGNNYEFSNQL---------MSENDWMQASGMRE---DEPDMKKLK 1309
            M   DPN         L+ +Q+ Q TGRELQ +LSVAHQSLDEAQERK SLNNHRLKPALYSVFCEIKEKT+LSLRN+A    ED++NSPDPQLLRLDKML+AEGVTG      N++GD   +   +          + NQIEHADYRAKLAQIRQIYH+ELEKYK+AC+EFTGHVINLLREQSRSRPISPAEIELMVGII++KFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATE+LNEYFYSHLANPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEAN+YAAATAAAAAAAS   +  G      PT     S G GHSG +Y+ S  L          +++D     G+     DEPD K+ K
Sbjct:   62 MTGFDPNASGVETDNPLITEQRAQLTGRELQQLLSVAHQSLDEAQERKQSLNNHRLKPALYSVFCEIKEKTALSLRNSAASAVEDEANSPDPQLLRLDKMLVAEGVTGPGAGLANDLGDSSGDLAAHGGLGGGGGIGDCNQIEHADYRAKLAQIRQIYHAELEKYKSACDEFTGHVINLLREQSRSRPISPAEIELMVGIIRRKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEVLNEYFYSHLANPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANMYAAATAAAAAAASSVNSGPGG-----PTSGDDHSVGYGHSGYDYDDSMGLPRGVPQLSCTTDHDAWVTGGITPGSLDEPDRKRNK 442          
BLAST of PBX vs. TrEMBL
Match: A0A4S2LAD3 (Homeobox domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009083 PE=4 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 1.079e-164
Identity = 268/386 (69.43%), Postives = 298/386 (77.20%), Query Frame = 2
Query:  251 MNHADPN---------LVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNT---NNIGDIDSEYGGNQS--------ESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYG-GHSGNNYEFSNQL---------MSENDWMQASGMRE---DEPDMKKLK 1309
            M   DPN         L+ +Q+ Q TGRELQ +LSVAHQSLDEAQERK SLNNHRLKPALYSVFCEIKEKT+LSLRN+A    ED++NSPDPQLLRLDKML+AEGVTG      N++GD   +   +          + NQIEHADYRAKLAQIRQIYH+ELEKYK+AC+EFTGHVINLLREQSRSRPISPAEIELMVGII++KFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATE+LNEYFYSHLANPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEAN+YAAATAAAAAAAS   +  G      PT     S G GHSG +Y+ S  L          +++D     G+     DEPD K+ K
Sbjct:   29 MTGFDPNASGVETDNPLLTEQRAQLTGRELQQLLSVAHQSLDEAQERKQSLNNHRLKPALYSVFCEIKEKTALSLRNSAASAVEDEANSPDPQLLRLDKMLVAEGVTGPGAGLANDLGDSSGDLAAHGGLAGGGGIGDCNQIEHADYRAKLAQIRQIYHAELEKYKSACDEFTGHVINLLREQSRSRPISPAEIELMVGIIRRKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEVLNEYFYSHLANPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANMYAAATAAAAAAASSVNSGPGG-----PTSGDDHSVGYGHSGYDYDDSMGLPRGVPQLSCTTDHDAWVTGGITPGSLDEPDRKRNK 409          
BLAST of PBX vs. TrEMBL
Match: G7YN27 (Pre-B-cell leukemia transcription factor OS=Clonorchis sinensis OX=79923 GN=CLF_102499 PE=4 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 2.648e-164
Identity = 236/302 (78.15%), Postives = 258/302 (85.43%), Query Frame = 2
Query:  251 MNHADPN---------LVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNT---NNIGDIDSEYGGNQS--------ESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            M   DPN         L+ +Q+ Q TGRELQ +LSVAHQSLDEAQERK SLNNHRLKPALYSVFCEIKEKT+LSLRN+A    ED++NSPDPQLLRLDKML+AEGVTG      N++GD   +   +          + NQIEHADYRAKLAQIRQIYH+ELEKYK+AC+EFTGHVINLLREQSRSRPISPAEIELMVGII++KFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATE+LNEYFYSHLANPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEAN+Y
Sbjct:   29 MTGFDPNASGVETDNPLITEQRAQLTGRELQQLLSVAHQSLDEAQERKQSLNNHRLKPALYSVFCEIKEKTALSLRNSAASAVEDEANSPDPQLLRLDKMLVAEGVTGPGAGLANDLGDSSGDLAAHGGLGGGGGMGDCNQIEHADYRAKLAQIRQIYHAELEKYKSACDEFTGHVINLLREQSRSRPISPAEIELMVGIIRRKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEVLNEYFYSHLANPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANMY 330          
BLAST of PBX vs. TrEMBL
Match: A0A3R7CJH1 (Homeobox protein extradenticle OS=Clonorchis sinensis OX=79923 GN=exd PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 2.904e-164
Identity = 235/301 (78.07%), Postives = 257/301 (85.38%), Query Frame = 2
Query:  251 MNHADPN---------LVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNT---NNIGDIDSEYGGNQS--------ESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANL 1093
            M   DPN         L+ +Q+ Q TGRELQ +LSVAHQSLDEAQERK SLNNHRLKPALYSVFCEIKEKT+LSLRN+A    ED++NSPDPQLLRLDKML+AEGVTG      N++GD   +   +          + NQIEHADYRAKLAQIRQIYH+ELEKYK+AC+EFTGHVINLLREQSRSRPISPAEIELMVGII++KFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATE+LNEYFYSHLANPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEAN+
Sbjct:   29 MTGFDPNASGVETDNPLITEQRAQLTGRELQQLLSVAHQSLDEAQERKQSLNNHRLKPALYSVFCEIKEKTALSLRNSAASAVEDEANSPDPQLLRLDKMLVAEGVTGPGAGLANDLGDSSGDLAAHGGLGGGGGIGDCNQIEHADYRAKLAQIRQIYHAELEKYKSACDEFTGHVINLLREQSRSRPISPAEIELMVGIIRRKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEVLNEYFYSHLANPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANM 329          
BLAST of PBX vs. Ensembl Cavefish
Match: ENSAMXT00000048665.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000139.1:3941319:4008251:1 gene:ENSAMXG00000009040.2 transcript:ENSAMXT00000048665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 386.726 bits (992), Expect = 4.308e-131
Identity = 189/275 (68.73%), Postives = 216/275 (78.55%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNN---TNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         D   PDPQL+RLD ML+AEGV+G +    +      +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYP+EEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   41 DARKQDIGDILHQIMAITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------HDDEPPDPQLMRLDNMLLAEGVSGPDKGGGSAAVAAAAAAAVGGGTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIECMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPTEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNISKFQEEANLY 309          
BLAST of PBX vs. Ensembl Cavefish
Match: ENSAMXT00000040519.1 (pre-B-cell leukemia transcription factor 3 [Source:NCBI gene;Acc:103029164])

HSP 1 Score: 383.645 bits (984), Expect = 1.062e-130
Identity = 189/274 (68.98%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   39 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGSPTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 306          
BLAST of PBX vs. Ensembl Cavefish
Match: ENSAMXT00000009300.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000139.1:3941328:4009694:1 gene:ENSAMXG00000009040.2 transcript:ENSAMXT00000009300.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.03 bits (985), Expect = 1.739e-130
Identity = 189/275 (68.73%), Postives = 216/275 (78.55%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNN---TNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         D   PDPQL+RLD ML+AEGV+G +    +      +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYP+EEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   38 DARKQDIGDILHQIMAITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------HDDEPPDPQLMRLDNMLLAEGVSGPDKGGGSAAVAAAAAAAVGGGTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIECMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPTEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNISKFQEEANLY 306          
BLAST of PBX vs. Ensembl Cavefish
Match: ENSAMXT00000045862.1 (pre-B-cell leukemia transcription factor 3 [Source:NCBI gene;Acc:103029164])

HSP 1 Score: 385.571 bits (989), Expect = 4.575e-130
Identity = 189/274 (68.98%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   39 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGSPTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 306          
BLAST of PBX vs. Ensembl Cavefish
Match: ENSAMXT00000045593.1 (pre-B-cell leukemia transcription factor 3 [Source:NCBI gene;Acc:103029164])

HSP 1 Score: 385.571 bits (989), Expect = 1.102e-129
Identity = 189/274 (68.98%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +         N IEH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   39 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGSPTDNSIEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 306          
BLAST of PBX vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 58.5362 bits (140), Expect = 1.535e-9
Identity = 24/66 (36.36%), Postives = 41/66 (62.12%), Query Frame = 2
Query:  878 ARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKA 1075
            AR KR    K AT ++  + + H+ +PYP+E+ K ++A +  +T+ QV+NWF N R R  + ++ A
Sbjct:  258 ARLKRGVLPKHATTVMRSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRILQPMLDA 323          
BLAST of PBX vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002620.1 (pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 gene:ENSPMAG00000002391.1 transcript:ENSPMAT00000002620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 8.079e-8
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  890 RRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKK 1060
            R+N +++AT  L  +   H  NPYP++  K  LA    +T++QVS WF N R R KK
Sbjct:   41 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITRMTLTQVSTWFANARRRLKK 97          
BLAST of PBX vs. Ensembl Sea Lamprey
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 49.6766 bits (117), Expect = 1.386e-7
Identity = 23/49 (46.94%), Postives = 33/49 (67.35%), Query Frame = 2
Query:  899 FSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKR 1045
            F + +  +L ++ Y+H  NPYPS   K ELA+  G+T +QVSNWF N+R
Sbjct:  105 FKERSRGVLRDW-YAH--NPYPSPREKRELAQATGLTTTQVSNWFKNRR 150          
BLAST of PBX vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011157.1 (pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 gene:ENSPMAG00000010130.1 transcript:ENSPMAT00000011157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 1.398e-7
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  875 DARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKR 1045
            D  +K   F +    +L E++   L +PYP+   K ELA+  G+T +QV NWF N+R
Sbjct:   10 DGEQKTHCFKERTRNLLREWY---LQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 63          
BLAST of PBX vs. Ensembl Sea Lamprey
Match: mkxb (mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513-2])

HSP 1 Score: 49.6766 bits (117), Expect = 5.725e-7
Identity = 26/66 (39.39%), Postives = 35/66 (53.03%), Query Frame = 2
Query:  884 RKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQE 1081
            R +R   ++    L  + Y H  NPYP++  K  LA    +T+ QVSNWF N R R  KN V+  E
Sbjct:    3 RHKRQALQDMARPLKHWLYKHRHNPYPTKTEKILLALGSHMTLVQVSNWFANARRRL-KNTVRQPE 67          
BLAST of PBX vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 62.003 bits (149), Expect = 3.412e-11
Identity = 30/71 (42.25%), Postives = 41/71 (57.75%), Query Frame = 2
Query:  878 ARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEAN 1090
            A  KR N  K    ILN++ + H+ NPYP+ + K EL  K G+T  Q+SNWF N R   ++ I   Q +AN
Sbjct:  194 AHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINAR---RRKIFSGQNDAN 261          
BLAST of PBX vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 60.4622 bits (145), Expect = 1.511e-10
Identity = 27/55 (49.09%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  887 KRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIR 1051
            +R N  KE  +ILN +  +HL NPYP+++ K EL  K G+T  Q+SNWF N R R
Sbjct:  165 RRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219          
BLAST of PBX vs. Ensembl Yeast
Match: HMRA2 (Silenced copy of a2 at HMR; similarity to Alpha2p; required along with a1p for inhibiting expression of the HO endonuclease in a/alpha HO/HO diploid cells with an active mating-type interconversion system [Source:SGD;Acc:S000000692])

HSP 1 Score: 43.8986 bits (102), Expect = 4.436e-6
Identity = 23/65 (35.38%), Postives = 35/65 (53.85%), Query Frame = 2
Query:  899 FSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANL 1093
            F+KE   IL  +F  ++ NPY   +  + L K   ++  Q+ NW  N+R R +K I  A E A+L
Sbjct:   45 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRR-RKEKTITIAPELADL 108          
BLAST of PBX vs. Ensembl Nematostella
Match: EDO43361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ8])

HSP 1 Score: 380.948 bits (977), Expect = 1.646e-130
Identity = 190/273 (69.60%), Postives = 222/273 (81.32%), Query Frame = 2
Query:  278 LDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            LD + Q  G  LQ I+S+  QSLDEAQ +KH+LN HR+KPAL++V CEIKEKT LS+R +     ED+   PDPQL+RLD ML+AEGV G          +  G ++   NQ EH++YRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF AI+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELA+KC I+V+Q+SNWFGNKRIRYKKNI KAQEEA+LY
Sbjct:    7 LDGRKQDIGDILQQIMSITDQSLDEAQAKKHALNCHRMKPALFNVLCEIKEKTVLSIRGS----QEDEP--PDPQLMRLDNMLLAEGVAGPEKGGAAAAAAAAGVHE---NQAEHSEYRAKLNQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIRYKKNIGKAQEEASLY 270          
BLAST of PBX vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 68.5514 bits (166), Expect = 9.867e-13
Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = 2
Query:  878 ARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEAN 1090
            +++KR  F K AT I+  + + HL +PYPSEE K  LA++ G+T+ QV+NWF N R R  + ++ A   A 
Sbjct:  238 SQKKRGIFPKAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRRIVQPMIDASNRAG 308          
BLAST of PBX vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 59.6918 bits (143), Expect = 6.459e-10
Identity = 27/89 (30.34%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  809 AIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKA 1075
             I TQ++Q     +     +    + KR    K+AT I+  + + H+ +PYP+E+ K  +A++  +T+ QV+NWF N R R  + ++ A
Sbjct:  174 VIATQVQQQQASPMSYTPQQSATVKSKRGVLPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRRILQPMLDA 262          
BLAST of PBX vs. Ensembl Nematostella
Match: EDO41982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2T4])

HSP 1 Score: 50.8322 bits (120), Expect = 1.501e-8
Identity = 24/58 (41.38%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  887 KRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKK 1060
            +R+N ++E T  L  + + H  NPYP++  K  LA    +T++QVS WF N R R KK
Sbjct:    2 RRKNATRETTSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRRLKK 59          
BLAST of PBX vs. Ensembl Nematostella
Match: EDO41178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S544])

HSP 1 Score: 51.2174 bits (121), Expect = 1.976e-8
Identity = 23/67 (34.33%), Postives = 38/67 (56.72%), Query Frame = 2
Query:  878 ARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQ 1078
             +R+R N  K++  +L  + + H  N YPSE  K  L+K   ++V QV NWF N R R   ++++ +
Sbjct:   16 PKRRRGNLPKDSVNVLRLWLWEHRFNAYPSEAEKQYLSKAANLSVLQVCNWFINARRRILPDMIRRE 82          
BLAST of PBX vs. Ensembl Medaka
Match: pbx4 (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101159440])

HSP 1 Score: 383.645 bits (984), Expect = 1.418e-130
Identity = 194/287 (67.60%), Postives = 224/287 (78.05%), Query Frame = 2
Query:  260 ADPNLV-----LDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
             DP+ V     L Q  Q  G  LQ I+++  +SLDEAQ RKH+LN HR+KPAL+SV CEIKEKT LS+R    +  ED    PDPQ++RLD ML+AEGV+G      +      +   G     + IEH+DYRAKLAQIRQIYHSELEKY+ AC+EFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATE+LNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   23 GDPDSVRKQQSLGQPQQDIGDILQQIMAITDESLDEAQARKHALNCHRMKPALFSVLCEIKEKTVLSIRG---VQEED---PPDPQIMRLDNMLLAEGVSGPEKGGGSAAAAAAAAAAGGSPTDSSIEHSDYRAKLAQIRQIYHSELEKYEQACSEFTNHVMNLLREQSRTRPISPKEIERMVAIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 303          
BLAST of PBX vs. Ensembl Medaka
Match: ENSORLT00000016626.2 (PBX homeobox 3 [Source:NCBI gene;Acc:101159358])

HSP 1 Score: 385.185 bits (988), Expect = 6.575e-130
Identity = 189/274 (68.98%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +      +  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   39 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAADNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 306          
BLAST of PBX vs. Ensembl Medaka
Match: ENSORLT00000046609.1 (PBX homeobox 3 [Source:NCBI gene;Acc:101159358])

HSP 1 Score: 385.571 bits (989), Expect = 1.754e-129
Identity = 189/274 (68.98%), Postives = 215/274 (78.47%), Query Frame = 2
Query:  281 DQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG--NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            D + Q  G  L  I+++  QSLDEAQ +KH LN HR+KPAL+SV CEIKEKT LS+R         + + PDPQL+RLD ML+AEGV G      +     +      +  N IEH+DYRAKL QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MVGII +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNFSK+ATEILNEYFYSHL+NPYPSEEAK+ELAKKC ITVSQVSNWFGNKRIRYKKNI K QEEANLY
Sbjct:   56 DGRKQDIGDILHQIMTITDQSLDEAQAKKHGLNCHRMKPALFSVLCEIKEKTGLSIRGA------QEEDPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAADNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLY 323          
BLAST of PBX vs. Ensembl Medaka
Match: pbx1a (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101160104])

HSP 1 Score: 381.333 bits (978), Expect = 2.206e-128
Identity = 187/271 (69.00%), Postives = 214/271 (78.97%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +   PDPQL+RLD ML+AEGV G      +      +   G     N  EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   39 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAATGGVGADNSAEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANMY 303          
BLAST of PBX vs. Ensembl Medaka
Match: pbx1a (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101160104])

HSP 1 Score: 377.867 bits (969), Expect = 2.484e-128
Identity = 187/271 (69.00%), Postives = 214/271 (78.97%), Query Frame = 2
Query:  293 QCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTG---NNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLY 1096
            Q  G  LQ I+++  QSLDEAQ RKH+LN HR+KPAL++V CEIKEKT LS+R         +   PDPQL+RLD ML+AEGV G      +      +   G     N  EH+DYRAKL+QIRQIYH+ELEKY+ ACNEFT HV+NLLREQSR+RPISP EIE MV II +KF +I+ QLKQSTCEAVMILRSRFLDARRKRRNF+K+ATEILNEYFYSHL+NPYPSEEAK+ELAKKCGITVSQVSNWFGNKRIRYKKNI K QEEAN+Y
Sbjct:   39 QDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGA------QEEEPPDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAATGGVGADNSAEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANMY 303          
BLAST of PBX vs. Planmine SMEST
Match: SMESG000001913.1 (SMESG000001913.1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 389/389 (100.00%), Postives = 389/389 (100.00%), Query Frame = 2
Query:  146 MSENLXXXXXXXXXXXXXXXXXYMTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 1312
            MSENLHQPPSSWHSHPTTPNSHYMTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH
Sbjct:    1 MSENLHQPPSSWHSHPTTPNSHYMTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 389          
BLAST of PBX vs. Planmine SMEST
Match: SMESG000001913.1 (SMESG000001913.1)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 366/366 (100.00%), Postives = 366/366 (100.00%), Query Frame = 2
Query:  215 MTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 1312
            MTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH
Sbjct:    1 MTQNTRNNYSYDMNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 366          
BLAST of PBX vs. Planmine SMEST
Match: SMESG000001913.1 (SMESG000001913.1)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 2
Query:  251 MNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 1312
            MNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH
Sbjct:    1 MNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLSLRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGNQSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSRSRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 354          
BLAST of PBX vs. Planmine SMEST
Match: SMESG000022232.1 (SMESG000022232.1)

HSP 1 Score: 262.692 bits (670), Expect = 2.387e-86
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 2
Query:  881 RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 1312
            RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH
Sbjct:    5 RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 148          
BLAST of PBX vs. Planmine SMEST
Match: SMESG000022232.1 (SMESG000022232.1)

HSP 1 Score: 263.848 bits (673), Expect = 2.770e-86
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 2
Query:  881 RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYXXXXXXXXXXXXXXXXXXGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 1312
            RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH
Sbjct:   38 RRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMSYGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH 181          

HSP 2 Score: 84.3445 bits (207), Expect = 1.078e-18
Identity = 39/43 (90.70%), Postives = 40/43 (93.02%), Query Frame = 2
Query:  251 MNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERKHSLN 379
            MNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQER+   N
Sbjct:    1 MNHADPNLVLDQKIQCTGRELQNILSVAHQSLDEAQERRKRRN 43          
The following BLAST results are available for this feature:
BLAST of PBX vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PBX36.327e-13069.34PBX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:8634][more]
PBX37.699e-13069.34PBX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:8634][more]
PBX24.641e-12863.64PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633][more]
PBX24.641e-12863.64PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633][more]
PBX24.641e-12863.64PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633][more]
back to top
BLAST of PBX vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-201.801e-10259.32Homeobox protein ceh-20 [Source:UniProtKB/Swiss-P... [more]
ceh-405.551e-4840.61Homeobox protein ceh-40 [Source:UniProtKB/Swiss-P... [more]
ceh-609.647e-2440.00C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:... [more]
irx-15.293e-1150.00Putative iroquois-class homeodomain protein irx-1 ... [more]
unc-621.465e-1045.16Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of PBX vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exd1.023e-13271.06gene:FBgn0000611 transcript:FBtr0074137[more]
exd1.023e-13271.06gene:FBgn0000611 transcript:FBtr0074135[more]
exd1.023e-13271.06gene:FBgn0000611 transcript:FBtr0333322[more]
exd1.023e-13271.06gene:FBgn0000611 transcript:FBtr0333323[more]
hth6.914e-1144.44gene:FBgn0001235 transcript:FBtr0082256[more]
back to top
BLAST of PBX vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbx3a4.881e-13169.71pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:Z... [more]
pbx41.446e-13067.94pre-B-cell leukemia transcription factor 4 [Source... [more]
pbx3a2.672e-13069.71pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:Z... [more]
pbx3b6.491e-12968.61pre-B-cell leukemia homeobox 3b [Source:ZFIN;Acc:Z... [more]
pbx3b6.491e-12968.61pre-B-cell leukemia homeobox 3b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of PBX vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbx22.475e-12962.05pre-B-cell leukemia homeobox 2 [Source:NCBI gene;A... [more]
esrp14.036e-12970.11epithelial splicing regulatory protein 1 [Source:X... [more]
alcam7.290e-12668.27activated leukocyte cell adhesion molecule [Source... [more]
alcam9.635e-12668.27activated leukocyte cell adhesion molecule [Source... [more]
alcam1.039e-12568.27activated leukocyte cell adhesion molecule [Source... [more]
back to top
BLAST of PBX vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pbx34.344e-13069.34pre B cell leukemia homeobox 3 [Source:MGI Symbol;... [more]
Pbx35.343e-13069.34pre B cell leukemia homeobox 3 [Source:MGI Symbol;... [more]
Pbx21.109e-12763.96pre B cell leukemia homeobox 2 [Source:MGI Symbol;... [more]
Pbx13.175e-12768.63pre B cell leukemia homeobox 1 [Source:MGI Symbol;... [more]
Pbx13.640e-12768.63pre B cell leukemia homeobox 1 [Source:MGI Symbol;... [more]
back to top
BLAST of PBX vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7PMT1|EXD_ANOGA6.443e-13668.29Homeobox protein extradenticle OS=Anopheles gambia... [more]
sp|Q29CT2|EXD_DROPS9.714e-13271.06Homeobox protein extradenticle OS=Drosophila pseud... [more]
sp|P40427|EXD_DROME1.026e-13171.06Homeobox protein extradenticle OS=Drosophila melan... [more]
sp|B3DM47|PBX2_XENTR1.316e-13062.42Pre-B-cell leukemia transcription factor 2 OS=Xeno... [more]
sp|P40426|PBX3_HUMAN3.697e-12969.34Pre-B-cell leukemia transcription factor 3 OS=Homo... [more]
back to top
BLAST of PBX vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M4QVS30.000e+0100.00PBX OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A075A0X42.114e-16569.43Homeobox domain-containing protein OS=Opisthorchis... [more]
A0A4S2LAD31.079e-16469.43Homeobox domain-containing protein OS=Opisthorchis... [more]
G7YN272.648e-16478.15Pre-B-cell leukemia transcription factor OS=Clonor... [more]
A0A3R7CJH12.904e-16478.07Homeobox protein extradenticle OS=Clonorchis sinen... [more]
back to top
BLAST of PBX vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048665.14.308e-13168.73pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040519.11.062e-13068.98pre-B-cell leukemia transcription factor 3 [Source... [more]
ENSAMXT00000009300.21.739e-13068.73pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045862.14.575e-13068.98pre-B-cell leukemia transcription factor 3 [Source... [more]
ENSAMXT00000045593.11.102e-12968.98pre-B-cell leukemia transcription factor 3 [Source... [more]
back to top
BLAST of PBX vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox21.535e-936.36pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000002620.18.079e-842.11pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 g... [more]
six1a1.386e-746.94SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
ENSPMAT00000011157.11.398e-738.60pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 ge... [more]
mkxb5.725e-739.39mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513... [more]
back to top
BLAST of PBX vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TOS83.412e-1142.25Homeodomain-containing protein and putative transc... [more]
CUP91.511e-1049.09Homeodomain-containing transcriptional repressor; ... [more]
HMRA24.436e-635.38Silenced copy of a2 at HMR; similarity to Alpha2p;... [more]
back to top
BLAST of PBX vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433611.646e-13069.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364399.867e-1342.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393756.459e-1030.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419821.501e-841.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411781.976e-834.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBX vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbx41.418e-13067.60pre-B-cell leukemia transcription factor 1 [Source... [more]
ENSORLT00000016626.26.575e-13068.98PBX homeobox 3 [Source:NCBI gene;Acc:101159358][more]
ENSORLT00000046609.11.754e-12968.98PBX homeobox 3 [Source:NCBI gene;Acc:101159358][more]
pbx1a2.206e-12869.00pre-B-cell leukemia transcription factor 1 [Source... [more]
pbx1a2.484e-12869.00pre-B-cell leukemia transcription factor 1 [Source... [more]
back to top
BLAST of PBX vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001913.10.000e+0100.00SMESG000001913.1[more]
SMESG000001913.10.000e+0100.00SMESG000001913.1[more]
SMESG000001913.10.000e+0100.00SMESG000001913.1[more]
SMESG000022232.12.387e-86100.00SMESG000022232.1[more]
SMESG000022232.12.770e-86100.00SMESG000022232.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027299
GenBankAGH32779.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027299 ID=SMED30027299|Name=PBX|organism=Schmidtea mediterranea sexual|type=transcript|length=1524bp
AAATAAAGGTATTTTCTATACCATTTTGTGATGTATACATTTTGAGATAA
TATTTTATATAATAAAGAATTTGCATTTAAGCTTTAGATAGAATCAAAGC
TTAAATACCAAATTAAAGATTTTTAAAGAACAAAACTAGTTTAAAATGAG
TGAGAATTTACACCAGCCTCCGAGTAGTTGGCATTCGCACCCTACAACCC
CAAATTCACATTATATGACTCAAAATACACGAAATAATTATTCGTATGAT
ATGAATCATGCTGATCCTAATTTGGTGCTAGATCAAAAAATCCAGTGTAC
TGGAAGAGAGCTACAAAATATTTTAAGTGTGGCTCATCAAAGTTTAGATG
AAGCTCAAGAGAGAAAACATTCATTAAATAATCATCGATTGAAGCCTGCG
TTGTACAGTGTGTTTTGTGAAATAAAAGAAAAGACGTCTTTAAGCTTGAG
AAACACCGCTCAAATAAATTCGGAAGATGATTCTAATTCTCCAGACCCAC
AACTTCTAAGATTGGATAAAATGCTTATTGCTGAAGGTGTAACTGGAAAT
AATACGAATAATATTGGAGATATTGATAGTGAATACGGTGGTAATCAGTC
TGAAAGTAATCAAATAGAACATGCAGATTATAGGGCTAAATTGGCTCAAA
TTAGACAAATTTATCATTCCGAGCTCGAAAAATACAAAAATGCCTGTAAT
GAATTTACCGGACACGTAATTAATTTGCTAAGAGAACAAAGCCGCAGTCG
GCCTATTAGTCCAGCTGAAATTGAATTAATGGTTGGTATAATAAAGAAGA
AATTCCGCGCAATTGAAACACAACTTAAACAAAGTACCTGTGAAGCAGTC
ATGATATTAAGGAGCAGATTTCTTGATGCTAGGAGGAAACGAAGAAATTT
CAGTAAAGAGGCTACTGAGATTTTAAATGAATATTTTTATTCTCATTTGG
CAAATCCTTATCCTTCCGAAGAAGCAAAAGATGAATTGGCAAAAAAATGT
GGCATAACAGTGTCTCAAGTTTCAAATTGGTTTGGCAATAAGCGCATAAG
GTATAAGAAAAATATAGTTAAAGCACAAGAAGAAGCTAATCTTTATGCCG
CTGCCACAGCAGCAGCCGCCGCCGCGGCTTCTGTTACAGTAGCATCATCT
GGTCAAATTTCAGGTTCCTGTCCGACAGTTTCCACATCTATGAGTTATGG
CGGTCATTCTGGCAATAATTATGAATTTTCCAATCAGCTGATGTCAGAAA
ACGACTGGATGCAGGCCAGTGGCATGAGAGAAGACGAACCAGATATGAAG
AAGCTGAAACATTAACAAGCAGATTTCATTCGGATTAGTTGCGATTGAAA
TGCATTTTGACGAAAATTCTTTTAAATAATCTTGTTTAATGTGTACAGTT
TGTGTATTATAGTGTTTGATTCCTTGATAGCATTGACAATCATTTCTTTT
CAAAATCTACAGTTTTATAGTTTGTATTTTGATTTAATATTTTACACGTA
TTATACAATAAATTTAAAATATTG
back to top

protein sequence of SMED30027299-orf-1

>SMED30027299-orf-1 ID=SMED30027299-orf-1|Name=SMED30027299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MSENLHQPPSSWHSHPTTPNSHYMTQNTRNNYSYDMNHADPNLVLDQKIQ
CTGRELQNILSVAHQSLDEAQERKHSLNNHRLKPALYSVFCEIKEKTSLS
LRNTAQINSEDDSNSPDPQLLRLDKMLIAEGVTGNNTNNIGDIDSEYGGN
QSESNQIEHADYRAKLAQIRQIYHSELEKYKNACNEFTGHVINLLREQSR
SRPISPAEIELMVGIIKKKFRAIETQLKQSTCEAVMILRSRFLDARRKRR
NFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKR
IRYKKNIVKAQEEANLYAAATAAAAAAASVTVASSGQISGSCPTVSTSMS
YGGHSGNNYEFSNQLMSENDWMQASGMREDEPDMKKLKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000009sigma neoblast
PLANA:0000016pharynx
PLANA:0000039gamma neoblast
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR005542PBX
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 245..310
e-value: 3.2E-18
score: 76.5
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 246..305
e-value: 3.8E-19
score: 68.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 243..306
score: 17.443
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 246..306
e-value: 1.08595E-17
score: 74.5872
IPR005542PBXPFAMPF03792PBCcoord: 52..244
e-value: 1.9E-80
score: 269.1
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 244..319
e-value: 3.2E-32
score: 111.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 46..365
NoneNo IPR availablePANTHERPTHR11850:SF108HOMEOBOX PROTEIN EXTRADENTICLEcoord: 46..365
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 281..304
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 245..315