winged helix/forkhead transcription factor

Overview
Namewinged helix/forkhead transcription factor (AGL33698.1)
Smed IDSMED30027297
Length (bp)1433
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of winged helix/forkhead transcription factor (SMED30027297) t-SNE clustered cells

Violin plots show distribution of expression levels for winged helix/forkhead transcription factor (SMED30027297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of winged helix/forkhead transcription factor (SMED30027297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for winged helix/forkhead transcription factor (SMED30027297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30027297SMESG000077075.1 KC577557smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30027297SMESG000077075.1 KC577557smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30027297SMESG000077075.1 dd_Smed_v4_23249_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior pole cellSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30027297SMESG000077075.1 dd_Smed_v4_23249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027297SMESG000077075.1 dd_Smed_v4_23249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027297SMESG000077075.1 dd_Smed_v4_23249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30027297SMESG000077075.1 dd_Smed_v4_23249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027297SMESG000077075.1 dd_Smed_v4_23249_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior poleSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
anterior pole progenitor cellSMED30027297SMESG000077075.1 KC577557.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of winged helix/forkhead transcription factor vs. Ensembl Human
Match: FOXD4 (forkhead box D4 [Source:HGNC Symbol;Acc:HGNC:3805])

HSP 1 Score: 188.734 bits (478), Expect = 4.313e-54
Identity = 84/117 (71.79%), Postives = 96/117 (82.05%), Query Frame = 3
Query:  444 PMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPS 794
            P S    +      KPP SYIALITMAIL+SP ++LTLSGIC FI  RFPYY+ +FPAWQNSIRHNLSLNDCF+KIPREPG PGKGNYW+LDP S+DMFDNGSFLRRRKR++R  P+
Sbjct:   90 PRSAAASEDARQPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQPT 206          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Human
Match: FOXD3 (forkhead box D3 [Source:HGNC Symbol;Acc:HGNC:3804])

HSP 1 Score: 187.578 bits (475), Expect = 3.051e-53
Identity = 83/96 (86.46%), Postives = 91/96 (94.79%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            K K+  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:  134 KPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 229          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Human
Match: FOXD1 (forkhead box D1 [Source:HGNC Symbol;Acc:HGNC:3802])

HSP 1 Score: 180.259 bits (456), Expect = 1.470e-50
Identity = 78/90 (86.67%), Postives = 86/90 (95.56%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            VKPPYSYIALITMAIL+SP+++LTLS ICEFI GRFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:  124 VKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 213          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Human
Match: FOXD2 (forkhead box D2 [Source:HGNC Symbol;Acc:HGNC:3803])

HSP 1 Score: 180.259 bits (456), Expect = 2.188e-50
Identity = 79/95 (83.16%), Postives = 89/95 (93.68%), Query Frame = 3
Query:  468 SKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            ++S  VKPPYSYIALITMAIL+SP+++LTLS ICEFI GRFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:  121 TRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 215          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Human
Match: FOXD4L1 (forkhead box D4 like 1 [Source:HGNC Symbol;Acc:HGNC:18521])

HSP 1 Score: 174.481 bits (441), Expect = 6.372e-49
Identity = 76/103 (73.79%), Postives = 86/103 (83.50%), Query Frame = 3
Query:  444 PMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            P S    +      KPPYSYIALITMAIL+SP ++LTLSGIC FI GRFPYY+ +FPAWQNSIRHNLSLNDCF+KIPREPG+PGKG YW+LDP S+DMFDNGS
Sbjct:   93 PRSAAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGS 195          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 186.422 bits (472), Expect = 9.900e-55
Identity = 85/121 (70.25%), Postives = 100/121 (82.64%), Query Frame = 3
Query:  471 KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIP 833
            KS + KPPYSYIALI M+IL SP++KLTLS ICEFI+ +F YYK++FPAWQNSIRHNLSLNDCF+K+ R PGNPGKGNYW LDP  EDMFDNGSFLRRRKRYK+   S+ ++   SH  +P
Sbjct:  122 KSSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYKKN--SDTYHEMMSHHPMP 240          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 133.265 bits (334), Expect = 3.094e-34
Identity = 59/98 (60.20%), Postives = 75/98 (76.53%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPPYSYI+LITMAI +S  R+LTLS I  +IM  FPYY++    WQNSIRH+LS NDCF+K+ R P  PGKG++WTL     +MF+NG +LRR+KR+K
Sbjct:  141 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFK 238          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 133.265 bits (334), Expect = 4.268e-34
Identity = 59/98 (60.20%), Postives = 75/98 (76.53%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPPYSYI+LITMAI +S  R+LTLS I  +IM  FPYY++    WQNSIRH+LS NDCF+K+ R P  PGKG++WTL     +MF+NG +LRR+KR+K
Sbjct:  172 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFK 269          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 134.035 bits (336), Expect = 5.754e-34
Identity = 59/98 (60.20%), Postives = 75/98 (76.53%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPPYSYI+LITMAI +S  R+LTLS I  +IM  FPYY++    WQNSIRH+LS NDCF+K+ R P  PGKG++WTL     +MF+NG +LRR+KR+K
Sbjct:  236 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFK 333          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 122.479 bits (306), Expect = 1.543e-31
Identity = 57/101 (56.44%), Postives = 75/101 (74.26%), Query Frame = 3
Query:  474 SHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSED-MFDNGSFLRRRKR 773
            S N KPP+SY ALI MAI  SP+++LTL+GI E+I+  +P+Y+D    WQNSIRHNLSLN CF+K+PR   +PGKGNYW LD  +ED +F  G+  + R+R
Sbjct:   89 SPNDKPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRR 189          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Fly
Match: fd59A (gene:FBgn0004896 transcript:FBtr0071898)

HSP 1 Score: 209.534 bits (532), Expect = 5.165e-62
Identity = 95/130 (73.08%), Postives = 107/130 (82.31%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPI 872
            VKPPYSYIALITMAIL+SP +KLTLSGIC+FIM RFPYYKD+FPAWQNSIRHNLSLNDCFIK+PREPGNPGKGN+WTLDP +EDMFDNGSFLRRRKRYKR    + F+       + P   R  +P  P+
Sbjct:   84 VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPV 213          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 144.436 bits (363), Expect = 1.767e-37
Identity = 67/101 (66.34%), Postives = 84/101 (83.17%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ 785
            VKPPYSYIALI MAI  +  +K+TL+GI ++IM RFPYY+D    WQNSIRHNLSLN+CF+K+ R+   PGKG+YWTLDP S +MFDNGSFLRRR+R+K++
Sbjct:   69 VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKK 169          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 140.584 bits (353), Expect = 3.842e-37
Identity = 63/98 (64.29%), Postives = 74/98 (75.51%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPPYSYI+L  MAI  SP++ L LS I +FI  RFPYY+     WQNS+RHNLS NDCFIK+PR P  PGKG YW L P++ DMF+NGS LRRRKR+K
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK 110          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 140.584 bits (353), Expect = 3.842e-37
Identity = 63/98 (64.29%), Postives = 74/98 (75.51%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPPYSYI+L  MAI  SP++ L LS I +FI  RFPYY+     WQNS+RHNLS NDCFIK+PR P  PGKG YW L P++ DMF+NGS LRRRKR+K
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK 110          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 136.732 bits (343), Expect = 1.063e-36
Identity = 65/108 (60.19%), Postives = 80/108 (74.07%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK-RQLPSEMFN 806
            KPPYSYI+L  MAI+ SPQR L LS I  FIM +FP+Y+     WQNS+RHNLS NDCFIK+PR     GKG+YWTL P + DMF+NGS LRRRKR++ +QL  ++ N
Sbjct:   13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISN 120          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Zebrafish
Match: foxd3 (forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-143])

HSP 1 Score: 193.356 bits (490), Expect = 1.043e-56
Identity = 94/155 (60.65%), Postives = 110/155 (70.97%), Query Frame = 3
Query:  363 ESDDNIHSESDLDRICSEDKKDVDNKIPM---SQERCKS----------------------KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            E D+ +  +SD +  C +D+ D   +I +   S   C+S                      KS  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:   30 EGDEGMEQDSDCESQCMQDRGDEVEEIEVKERSDSPCESNADGETKGDAQESSTGPMQNKPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 184          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Zebrafish
Match: foxd5 (forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4])

HSP 1 Score: 180.644 bits (457), Expect = 1.770e-52
Identity = 80/94 (85.11%), Postives = 89/94 (94.68%), Query Frame = 3
Query:  471 KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            +S +VKPPYSYIALITMAIL+SP +KLTLSGIC+FI  +FPYYK++FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYW+LDP SEDMFDNGS
Sbjct:   68 QSSSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNGS 161          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Zebrafish
Match: foxd5 (forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4])

HSP 1 Score: 180.644 bits (457), Expect = 1.770e-52
Identity = 80/94 (85.11%), Postives = 89/94 (94.68%), Query Frame = 3
Query:  471 KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            +S +VKPPYSYIALITMAIL+SP +KLTLSGIC+FI  +FPYYK++FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYW+LDP SEDMFDNGS
Sbjct:   68 QSSSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNGS 161          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Zebrafish
Match: foxd1 (forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2094])

HSP 1 Score: 178.333 bits (451), Expect = 2.649e-51
Identity = 84/136 (61.76%), Postives = 102/136 (75.00%), Query Frame = 3
Query:  369 DDNIHSESDLDRICSEDKKDVDNKIPMSQE--------RCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            D + H+ S +D +     + + N  P   +        +  SK+  VKPPYSYIALITMAIL+SP+++LTLS IC+FI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:   27 DGDGHTRSYVDEVAQMHDEILLNGSPPGVDASPARDPYKPASKNTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 162          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Zebrafish
Match: foxd2 (forkhead box D2 [Source:ZFIN;Acc:ZDB-GENE-980605-6])

HSP 1 Score: 177.563 bits (449), Expect = 1.135e-50
Identity = 77/90 (85.56%), Postives = 85/90 (94.44%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            VKPPYSYIALITMAIL+SP+++LTLS ICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:   94 VKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 183          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Xenopus
Match: foxd3 (forkhead box D3 [Source:NCBI gene;Acc:496851])

HSP 1 Score: 188.734 bits (478), Expect = 8.517e-55
Identity = 92/141 (65.25%), Postives = 105/141 (74.47%), Query Frame = 3
Query:  357 ECESDDNIHSESD------LDRICSEDKKDVDNKIPMSQERC---KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            EC S      E+D      + R  S    + + K    Q+     K K+  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:   40 ECGSPAGHAEEADELGGKEIARSPSGSANEAEGKGESQQQEGMQNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 180          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Xenopus
Match: ankra2 (ankyrin repeat family A member 2 [Source:Xenbase;Acc:XB-GENE-1002386])

HSP 1 Score: 184.882 bits (468), Expect = 1.779e-53
Identity = 84/103 (81.55%), Postives = 91/103 (88.35%), Query Frame = 3
Query:  444 PMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            P +    K+K   VKPPYSYIALITMAIL+SP +KLTLSGIC+FI  +FPYYKD+FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDP SEDMFDNGS
Sbjct:   83 PATPSGGKAKRALVKPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASEDMFDNGS 185          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Xenopus
Match: arhgef28 (Rho guanine nucleotide exchange factor 28 [Source:Xenbase;Acc:XB-GENE-952324])

HSP 1 Score: 181.8 bits (460), Expect = 1.458e-52
Identity = 88/141 (62.41%), Postives = 106/141 (75.18%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS----FLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLV 893
            +KPPYSYIALITMAI++SP RKLTLSGIC+FI  +FPYYKD+FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDP S+DMFDNGS      R ++ ++  +      +N  H I P ++ +   P   + + QNL 
Sbjct:   96 LKPPYSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASKDMFDNGSFLRRRKRFKRHHQELIKDGFLMYNPLHYITPYSAPQTQTPVICMAIPQNLA 236          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Xenopus
Match: foxd1 (forkhead box D1 [Source:NCBI gene;Acc:493510])

HSP 1 Score: 177.563 bits (449), Expect = 4.773e-51
Identity = 78/94 (82.98%), Postives = 87/94 (92.55%), Query Frame = 3
Query:  471 KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            +S  VKPPYSYIALITMAIL+SP+++LTLS ICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:   63 RSALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 156          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Xenopus
Match: FOXD2 (forkhead box D2 [Source:NCBI gene;Acc:100495241])

HSP 1 Score: 176.792 bits (447), Expect = 1.688e-50
Identity = 77/90 (85.56%), Postives = 85/90 (94.44%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            VKPPYSYIALITMAIL+SP+++LTLS ICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:   77 VKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 166          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Mouse
Match: Foxd3 (forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473])

HSP 1 Score: 188.734 bits (478), Expect = 7.485e-54
Identity = 83/96 (86.46%), Postives = 91/96 (94.79%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            K K+  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:  124 KPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 219          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Mouse
Match: Foxd3 (forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473])

HSP 1 Score: 188.734 bits (478), Expect = 7.485e-54
Identity = 83/96 (86.46%), Postives = 91/96 (94.79%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            K K+  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:  124 KPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 219          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Mouse
Match: Foxd2 (forkhead box D2 [Source:MGI Symbol;Acc:MGI:1347471])

HSP 1 Score: 180.259 bits (456), Expect = 1.361e-50
Identity = 79/95 (83.16%), Postives = 89/95 (93.68%), Query Frame = 3
Query:  468 SKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            ++S  VKPPYSYIALITMAIL+SP+++LTLS ICEFI GRFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:  123 TRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 217          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Mouse
Match: Foxd1 (forkhead box D1 [Source:MGI Symbol;Acc:MGI:1347463])

HSP 1 Score: 178.718 bits (452), Expect = 3.213e-50
Identity = 77/90 (85.56%), Postives = 85/90 (94.44%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            VKPPYSYIALITMAIL+SP+++LTLS ICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:  129 VKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 218          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Mouse
Match: Foxd4 (forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467])

HSP 1 Score: 176.407 bits (446), Expect = 1.607e-49
Identity = 89/125 (71.20%), Postives = 102/125 (81.60%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTI 857
             KPPYSYIALITMAIL+SP ++LTLSGIC FI GRFPYY+ +FPAWQNSIRHNLSLNDCF+KIPREPG+PGKGNYW+LDP S+DMFDNGSFLRRRKR+KR  P    +    H   PP +   T+
Sbjct:  102 AKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPP---SGGHPHCPFPPPAVPATL 223          
BLAST of winged helix/forkhead transcription factor vs. UniProt/SwissProt
Match: sp|Q02361|FD3_DROME (Fork head domain-containing protein FD3 OS=Drosophila melanogaster OX=7227 GN=fd59A PE=2 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 5.177e-61
Identity = 95/130 (73.08%), Postives = 107/130 (82.31%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPI 872
            VKPPYSYIALITMAIL+SP +KLTLSGIC+FIM RFPYYKD+FPAWQNSIRHNLSLNDCFIK+PREPGNPGKGN+WTLDP +EDMFDNGSFLRRRKRYKR    + F+       + P   R  +P  P+
Sbjct:   84 VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPV 213          
BLAST of winged helix/forkhead transcription factor vs. UniProt/SwissProt
Match: sp|Q9DEN3|FXD3B_XENLA (Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.842e-56
Identity = 98/145 (67.59%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  357 ECESDDNIHSESD------LDRICSEDKKDVDNK---IPMSQERCKSKSHN--VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFL 758
            ECES    H E D      + R  S    D + K       QE  ++K  N  VKPPYSYIALITM+IL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDP+SEDMFDNGSFL
Sbjct:   40 ECESPVGHHDEVDALGGKEIPRSPSGSSTDAEGKGESQQQQQEGIQNKPKNSVVKPPYSYIALITMSILQSPQKKLTLSGICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPQSEDMFDNGSFL 184          
BLAST of winged helix/forkhead transcription factor vs. UniProt/SwissProt
Match: sp|Q9DEN4|FXD3A_XENLA (Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 8.129e-55
Identity = 84/98 (85.71%), Postives = 93/98 (94.90%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFL 758
            K K+  VKPPYSYIALITM+IL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGSFL
Sbjct:   87 KPKNSLVKPPYSYIALITMSILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFL 184          
BLAST of winged helix/forkhead transcription factor vs. UniProt/SwissProt
Match: sp|Q63245|FOXD3_RAT (Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 9.036e-55
Identity = 81/90 (90.00%), Postives = 88/90 (97.78%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:    2 VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 91          
BLAST of winged helix/forkhead transcription factor vs. UniProt/SwissProt
Match: sp|P79772|FOXD3_CHICK (Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.941e-54
Identity = 84/98 (85.71%), Postives = 92/98 (93.88%), Query Frame = 3
Query:  459 RCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            + K KS  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:  108 QSKPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 205          
BLAST of winged helix/forkhead transcription factor vs. TrEMBL
Match: X2C870 (Winged helix/forkhead transcription factor OS=Schmidtea mediterranea OX=79327 GN=foxd PE=2 SV=1)

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 432/432 (100.00%), Postives = 432/432 (100.00%), Query Frame = 3
Query:   36 MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRXXXXXXXELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKSXXXXXXXXXXXXXAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEPINKRCKLNSSEDELSTFQKFXXXXXXXXXXXXNKTKQSEESYANQFIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN 1331
            MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRDDDVDVDELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKSIIPNPNNIIPPLNAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEPINKRCKLNSSEDELSTFQKFSISHIISDDSTDNKTKQSEESYANQFIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN
Sbjct:    1 MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRDDDVDVDELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKSIIPNPNNIIPPLNAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEPINKRCKLNSSEDELSTFQKFSISHIISDDSTDNKTKQSEESYANQFIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN 432          
BLAST of winged helix/forkhead transcription factor vs. TrEMBL
Match: Q8MXW8 (Winged helix/forkhead transcription factor (Fragment) OS=Dugesia japonica OX=6161 GN=DjFoxD PE=2 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 335/455 (73.63%), Postives = 373/455 (81.98%), Query Frame = 3
Query:   42 KFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRXXX-XXXXELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKS-KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKSX----XXXXXXXXXXXXAIRYPRPFE-NNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEP----------------INKRCKLNSSEDELSTFQKFXXXXXXXXXXXXNKTKQSEESYANQ--FIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN 1331
            KFSLYYSTLNHL KE++ N MALEMNHLYWSLFGQR+DAKL+KNF +D YL+ YHRSNSI+YLR  QR+N+K+EQDMPQAFKDSQTIEQIKNLLRDDD    DE KECESDDNIHSE+D+DRICSEDKKD +NKI ++Q+RCKS KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ+PSE+F    +H+  PPTSFRMT+PPNP++VQQNLV QLLFHQNI KS     I + NNIIP LN IRY RPF+ NN+R +EFIGS  P   HD R VIPSTS  E  +                  NKR K +SSEDE +T QKFSISHIISD++ ++K K +EE   NQ  F+PQ+LRLWPCNPFP  K V  STWIPP+FIN
Sbjct:    1 KFSLYYSTLNHLPKEDDQNPMALEMNHLYWSLFGQRADAKLVKNFVEDPYLLSYHRSNSIDYLRPPQRMNIKFEQDMPQAFKDSQTIEQIKNLLRDDDIEMRDESKECESDDNIHSENDIDRICSEDKKDNENKISINQDRCKSGKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQIPSEIF-LITNHIDNPPTSFRMTMPPNPVSVQQNLVTQLLFHQNIGKSFIPNPISSNNNIIPSLNFIRYQRPFDNNNYRLNEFIGS--PQNSHDARRVIPSTSINESYQTNNNNNNNNNNNNNNNNNNKRRKFSSSEDESTTIQKFSISHIISDEAINHK-KPTEELCTNQNTFLPQSLRLWPCNPFPATKSVTNSTWIPPHFIN 451          
BLAST of winged helix/forkhead transcription factor vs. TrEMBL
Match: T1D148 (FoxD OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 1.499e-98
Identity = 163/305 (53.44%), Postives = 205/305 (67.21%), Query Frame = 3
Query:   36 MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRXXXXXXXELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQER-------CKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKS 929
            MNK   YYS    + KEE SNS+ +E+N LYW+L  QR+D  +++   DDS    +         +AS+        D+ Q  KD+Q+IE++            E K    +D   SE ++ +I  E++K+  +    S+ R         +KSHNVKPPYSYIALITMAILRS  RKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPS++F+ + +H++IPP SFR+ +  N   +Q  +  Q++ HQN  ++
Sbjct:    2 MNKHFPYYS---QVYKEEVSNSIPMEINSLYWALLKQRNDKNMLQPCIDDSLFQNHQ-------FKASKI-------DISQTLKDNQSIEEL------------ESKSDVKEDCTISEEEMHQIMHENQKNASDDDKCSESRSSNKDVIASNKSHNVKPPYSYIALITMAILRSSHRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSDLFSQSHNHMLIPPGSFRLGLHTNQAAIQHTIAAQMIMHQNSARA 277          
BLAST of winged helix/forkhead transcription factor vs. TrEMBL
Match: A0A0A9WTF6 (Fork head domain-containing protein FD3 (Fragment) OS=Lygus hesperus OX=30085 GN=fd59A PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 5.035e-65
Identity = 103/161 (63.98%), Postives = 124/161 (77.02%), Query Frame = 3
Query:  360 CESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTS 842
             +SD +++ +SD D + +   +   ++    + +  + +  VKPPYSYIALITMAIL+SP +KLTLSGICEFIM RFPYY+++FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDP +EDMFDNGSFLRRRKRYKRQ P  M    Q  L  PP +
Sbjct:   23 ADSDPDVNVDSDDDHLTTSPAQQPSSQSSPEEAKKSTTTTLVKPPYSYIALITMAILQSPHKKLTLSGICEFIMTRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPMAEDMFDNGSFLRRRKRYKRQPPEFMLREQQGFL--PPAA 181          
BLAST of winged helix/forkhead transcription factor vs. TrEMBL
Match: A0A146KV17 (Forkhead box protein D3 OS=Lygus hesperus OX=30085 GN=foxd3 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.767e-64
Identity = 103/164 (62.80%), Postives = 125/164 (76.22%), Query Frame = 3
Query:  351 LKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTS 842
            +   +SD +++ +SD D + +   +   ++    + +  + +  VKPPYSYIALITMAIL+SP +KLTLSGICEFIM RFPYY+++FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDP +EDMFDNGSFLRRRKRYKRQ P  M    Q  L  PP +
Sbjct:   21 VSPADSDPDVNVDSDDDHLTTSPAQQPSSQSSPEEAKKSTTTTLVKPPYSYIALITMAILQSPHKKLTLSGICEFIMTRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPMAEDMFDNGSFLRRRKRYKRQPPEFMLREQQGFL--PPAA 182          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Cavefish
Match: foxd3 (forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-143])

HSP 1 Score: 187.578 bits (475), Expect = 1.189e-54
Identity = 83/96 (86.46%), Postives = 91/96 (94.79%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            K K+  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP+SEDMFDNGS
Sbjct:   58 KPKNALVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 153          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Cavefish
Match: foxd1 (forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2094])

HSP 1 Score: 182.185 bits (461), Expect = 8.922e-53
Identity = 82/110 (74.55%), Postives = 92/110 (83.64%), Query Frame = 3
Query:  423 KDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
             D+      S  R   KS  VKPPYSYIALITMAIL+SP+++LTLS IC+FI GRFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:   47 ADLSVATASSACRPAGKSALVKPPYSYIALITMAILQSPKKRLTLSEICDFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 156          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Cavefish
Match: zgc:162612 (zgc:162612 [Source:ZFIN;Acc:ZDB-GENE-070410-88])

HSP 1 Score: 178.333 bits (451), Expect = 2.698e-52
Identity = 83/129 (64.34%), Postives = 99/129 (76.74%), Query Frame = 3
Query:  369 DDNIHSESDLDRICSEDKKDVDNKIP-MSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            D ++  E  +D +       VD  +  +     K KS  VKPPYSYIALITMAIL+SP+++LTLS IC+FI  RFPYY+++FPAWQNSIRHNLSLNDCF+K+PREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:    4 DTDLMDELVIDVVGEGSMDSVDEPVSVLPGANAKLKSGTVKPPYSYIALITMAILQSPKKRLTLSEICDFISRRFPYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSADMFDNGS 132          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Cavefish
Match: foxd2 (forkhead box protein D2 [Source:NCBI gene;Acc:103022344])

HSP 1 Score: 180.259 bits (456), Expect = 1.791e-51
Identity = 80/95 (84.21%), Postives = 89/95 (93.68%), Query Frame = 3
Query:  468 SKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            SK+  VKPPYSYIALITMAIL+SP+++LTLS ICEFI GRFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:  107 SKNALVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 201          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Cavefish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 145.591 bits (366), Expect = 1.001e-40
Identity = 64/100 (64.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ 785
            KPPYSYIALI MAI  +P+ + TLSGI +FIM  FP+Y D    WQNSIRHNLSLNDCF+K+PRE G PGKG+YWTLDP+  DMF+NG++ RR+++ + Q
Sbjct:   69 KPPYSYIALIAMAIKSAPEERATLSGIYQFIMDNFPFYHDNKQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPKCLDMFENGNYRRRKRKARGQ 168          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 142.51 bits (358), Expect = 1.164e-40
Identity = 62/93 (66.67%), Postives = 79/93 (84.95%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLR 761
            VKPPYSYIALITMAI  +P +K+TL+GI +FIM +FP+Y++    WQNSIRHNLSLN+CF+K+PR+   PGKG+YW+LDP S +MF+NGSFLR
Sbjct:   76 VKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENGSFLR 168          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 133.65 bits (335), Expect = 3.949e-38
Identity = 56/98 (57.14%), Postives = 78/98 (79.59%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPP+SYIALI MAI  SP +++TLS I +F+ GRFP+++  +  W+NS+RHNLSLN+CF+K+P+  G PGKG+YWT+DP SE MF+ GSF RR + ++
Sbjct:    5 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR 102          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 134.806 bits (338), Expect = 4.067e-38
Identity = 56/98 (57.14%), Postives = 78/98 (79.59%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KPP+SYIALI MAI  SP +++TLS I +F+ GRFP+++  +  W+NS+RHNLSLN+CF+K+P+  G PGKG+YWT+DP SE MF+ GSF RR + ++
Sbjct:    6 KPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR 103          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Sea Lamprey
Match: foxb2 (forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-320])

HSP 1 Score: 139.428 bits (350), Expect = 1.543e-37
Identity = 65/101 (64.36%), Postives = 76/101 (75.25%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQL 788
            KPPYSYI+L  MAI  S ++ L LS I +FIM RFPYY++    WQNS+RHNLS NDCFIKIPR P  PGKG++W L P   DMF+NGSFLRRRKR+K  L
Sbjct:   13 KPPYSYISLTAMAIQSSAEKMLPLSEIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPACGDMFENGSFLRRRKRFKVLL 113          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Sea Lamprey
Match: foxl2b (forkhead box L2b [Source:ZFIN;Acc:ZDB-GENE-170803-1])

HSP 1 Score: 130.183 bits (326), Expect = 9.704e-37
Identity = 56/90 (62.22%), Postives = 71/90 (78.89%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSF 755
            KPPYSY+ALI MAI  S  ++LTLSGI ++I+ +FP+Y+     WQNSIRHNLSLN+CF+K+PRE G   KGNYWTLDP  EDMF+ G++
Sbjct:   22 KPPYSYVALIAMAIRESSDKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFVKVPREGGGERKGNYWTLDPACEDMFEKGNY 111          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 97.0561 bits (240), Expect = 6.046e-22
Identity = 49/88 (55.68%), Postives = 59/88 (67.05%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNG 749
            KPPYSY  LI +AIL+S + KLTLS I  +I   FPYYK +  +WQNSIRHNLSLND FIK   E    GKG++W + P +E  F  G
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKT--EKSCDGKGHFWEVRPGAETKFFKG 194          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 95.1301 bits (235), Expect = 3.878e-21
Identity = 56/142 (39.44%), Postives = 72/142 (50.70%), Query Frame = 3
Query:  417 DKKDVDNKIPMSQERCKSKSH----NVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDN----GSF--LRRRKRYKRQLPSEMFNHN 812
            D     N  P + +     SH    NVKPP+SY  +IT AIL SP+  ++L+ I ++I   + YY+     WQNSIRHNLSLN  F K+PR P  PGKG  W +    +  F N    G    +RR     RQL   M   N
Sbjct:  313 DSYKSSNAYPQALDFTSDLSHDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFLNKWNTGKVGKIRRGSSVARQLQLHMAKFN 454          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 85.5001 bits (210), Expect = 2.395e-18
Identity = 45/112 (40.18%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNG------SFLRRRKRYKRQLPSEM 800
            +KPP SY ++IT AIL +P+  ++L+ I +FI   + +Y+    AWQNS+RHNLSLN  F K+P+  G  GKG  W +       F N       S +RR     RQL   M
Sbjct:  302 IKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRGASVTRQLQLHM 413          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 65.0846 bits (157), Expect = 1.447e-11
Identity = 39/102 (38.24%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILR-SPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ 785
             KP  SY A++T  I + S  + ++LS I   I   FPYYK     WQ+S+RHNLSLN  F K+ +E    GKG  W LD           ++  R+R K++
Sbjct:  460 TKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLDEE---------YIAERERQKKK 548          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 171.014 bits (432), Expect = 3.596e-52
Identity = 77/89 (86.52%), Postives = 84/89 (94.38%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            KPPYSYIALITMAIL+SPQRKLTLS ICEFI  RFPYY+++FP+WQNSIRHNLSLNDCF+K+PREPGNPGKGNYWTLDP SE MFDNGS
Sbjct:    3 KPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPASEGMFDNGS 91          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Nematostella
Match: EDO42098 (Forkhead domain protein D1; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q3LUS9])

HSP 1 Score: 144.05 bits (362), Expect = 1.259e-39
Identity = 66/124 (53.23%), Postives = 89/124 (71.77%), Query Frame = 3
Query:  414 EDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ 785
            ED +    K   +  +C+ +     PPYSYIALI MA+  SP+++LTL GIC+FI  RFP+Y++ +P+W+  IR+NLSLNDCFIK   +   P KGNYWTLDP S +MF+NGSFLRR+ R+K+Q
Sbjct:   55 EDDRGEGGKKARTHRKCRRR-----PPYSYIALIAMAVQNSPEKRLTLDGICKFIRDRFPFYRETYPSWKICIRNNLSLNDCFIKTGIKSDEPLKGNYWTLDPESYNMFENGSFLRRKTRFKKQ 173          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Nematostella
Match: EDO39529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S2])

HSP 1 Score: 138.272 bits (347), Expect = 1.598e-39
Identity = 68/100 (68.00%), Postives = 77/100 (77.00%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREP-GNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            VKPP+SYIALITM+I  SP R  TL+ I EFIM RFPY++     WQNSIRHNLSLNDCF+K+PR   G PGKGNYWTL P   DMF +GSFLRR KR+K
Sbjct:   15 VKPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFVKVPRSIFGKPGKGNYWTLHPSCGDMFGSGSFLRRPKRFK 114          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 143.665 bits (361), Expect = 2.214e-39
Identity = 72/134 (53.73%), Postives = 93/134 (69.40%), Query Frame = 3
Query:  480 NVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQ 881
            + KPPYSYI+LITMAI +SP + LTLS I +FIM  FPYY+     WQNSIRH+LS NDCF+K+PR P  PGKG+YWTL P   +MF+NG +LRR+KR+K +   ++     SHL     S   ++  NP+TVQ
Sbjct:   38 HAKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPDCGNMFENGCYLRRQKRFKAEKKPDL-----SHL-----SKVSSMTHNPVTVQ 161          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Nematostella
Match: EDO45102 (Forkhead domain protein E; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q3LUS8])

HSP 1 Score: 144.436 bits (363), Expect = 9.707e-39
Identity = 71/115 (61.74%), Postives = 86/115 (74.78%), Query Frame = 3
Query:  414 EDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFL 758
            E +K+V +K     ++ + +    KPPYSYIALI MAI  SPQR+LTLS I +FI  RFP+Y+     W+NSIRHNL+LNDCFIK+PREP  PGKGNYWT+DP S DMFDNGSFL
Sbjct:   24 ELEKEVGDK-----KQSRRQQSRGKPPYSYIALICMAITSSPQRQLTLSEIYDFISQRFPFYQTCSIKWKNSIRHNLTLNDCFIKLPREPNRPGKGNYWTIDPTSVDMFDNGSFL 133          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Medaka
Match: foxd3 (forkhead box D3 [Source:NCBI gene;Acc:100301607])

HSP 1 Score: 188.734 bits (478), Expect = 1.024e-54
Identity = 84/96 (87.50%), Postives = 90/96 (93.75%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            K KS  VKPPYSYIALITMAIL+SPQ+KLTLSGICEFI  RFPYY+++FPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWT+DP SEDMFDNGS
Sbjct:  112 KPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTMDPASEDMFDNGS 207          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Medaka
Match: FOXD2 (forkhead box D1 [Source:NCBI gene;Acc:100302451])

HSP 1 Score: 181.03 bits (458), Expect = 3.786e-52
Identity = 89/137 (64.96%), Postives = 105/137 (76.64%), Query Frame = 3
Query:  357 ECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKS-----KSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            E +SDDN  S++  DR  S   +D +     ++    +     KS  VKPPYSYIALITMAIL+SP+++LTLS ICEFI  RFPYY+++FPAWQNSIRHNLSLNDCF+KIPREPGNPGKGNYWTLDP S DMFDNGS
Sbjct:   42 EPDSDDNF-SQNAADRAESPGLRDSEQLGAGAEAGAVTGDKPRKSALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPDSADMFDNGS 177          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Medaka
Match: zgc:162612 (forkhead box D4 [Source:NCBI gene;Acc:100301608])

HSP 1 Score: 169.088 bits (427), Expect = 3.665e-48
Identity = 80/121 (66.12%), Postives = 95/121 (78.51%), Query Frame = 3
Query:  396 LDRICSEDKKDVDNKI-PMSQERCKSKS-HNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            LD   +E ++     I P      K K   +VKPPYSYIALITMAIL+SP+++LTLS IC+FI  RF YY+++FPAWQNSIRHNLSLNDCF+K+PREPGNPGKGNYWTLDP S DMF+NGS
Sbjct:   33 LDESRTEQERSTGTSIGPSCNPPAKGKGPTSVKPPYSYIALITMAILQSPKKRLTLSEICDFISQRFVYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGS 153          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Medaka
Match: ENSORLT00000004708.2 (forkhead box protein D1-like [Source:NCBI gene;Acc:101160044])

HSP 1 Score: 167.933 bits (424), Expect = 3.990e-48
Identity = 79/132 (59.85%), Postives = 94/132 (71.21%), Query Frame = 3
Query:  357 ECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            +C  D    + +D +R  +           +  +    +    KPPYSYIALITMAIL+SP++KLTL  ICEFI  RF YY++RFPAWQNSIRHNLSLNDCFIK+PREPGNPGKGNYWTLDP S DMF+NGS
Sbjct:   20 DCRGDGREETRADAERRATSPG--------VRAQDAPGRRGASKPPYSYIALITMAILQSPKKKLTLGEICEFISQRFVYYQERFPAWQNSIRHNLSLNDCFIKMPREPGNPGKGNYWTLDPMSADMFENGS 143          
BLAST of winged helix/forkhead transcription factor vs. Ensembl Medaka
Match: foxe3 (forkhead box E3 [Source:NCBI gene;Acc:100301611])

HSP 1 Score: 160.999 bits (406), Expect = 2.742e-44
Identity = 75/117 (64.10%), Postives = 86/117 (73.50%), Query Frame = 3
Query:  411 SEDKKDV---DNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGS 752
            +ED   V   +  +P    R K      KPPYSYIALI MAI  SP+RKLTL GI +FIM RFP+Y++    WQNSIRHNL+LNDCF+KIPREPG PGKGNYWTLDP +EDMFDNGS
Sbjct:   52 AEDGGAVGQTEEHLPSGSRRRKRPVQRGKPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPREPGRPGKGNYWTLDPAAEDMFDNGS 168          
BLAST of winged helix/forkhead transcription factor vs. Planmine SMEST
Match: SMESG000077075.1 (SMESG000077075.1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 431/432 (99.77%), Postives = 431/432 (99.77%), Query Frame = 3
Query:   36 MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRXXXXXXXELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKSXXXXXXXXXXXXXAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEPINKRCKLNSSEDELSTFQKFXXXXXXXXXXXXNKTKQSEESYANQFIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN 1331
            MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRDDDVDVDELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPP SFRMTIPPNPITVQQNLVNQLLFHQNITKSIIPNPNNIIPPLNAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEPINKRCKLNSSEDELSTFQKFSISHIISDDSTDNKTKQSEESYANQFIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN
Sbjct:    1 MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDDSYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRDDDVDVDELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQLPSEMFNHNQSHLIIPPASFRMTIPPNPITVQQNLVNQLLFHQNITKSIIPNPNNIIPPLNAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKTEYNEPINKRCKLNSSEDELSTFQKFSISHIISDDSTDNKTKQSEESYANQFIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN 432          
BLAST of winged helix/forkhead transcription factor vs. Planmine SMEST
Match: SMESG000065690.1 (SMESG000065690.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.700e-50
Identity = 75/105 (71.43%), Postives = 89/105 (84.76%), Query Frame = 3
Query:  465 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            KS S + KPPYSYIALITM+IL S +++LTL+ IC FI+  FPYY++RFP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDP +  MF+NGSFLRRR RYK
Sbjct:    2 KSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 106          
BLAST of winged helix/forkhead transcription factor vs. Planmine SMEST
Match: SMESG000021761.1 (SMESG000021761.1)

HSP 1 Score: 159.844 bits (403), Expect = 4.268e-46
Identity = 69/88 (78.41%), Postives = 77/88 (87.50%), Query Frame = 3
Query:  486 KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNG 749
            KPPYSYIALI MAI  SP +KLTLS IC+FIM +F YY+DRFP WQNSIRHNLSLNDCFIKIPR+  NPGKGN+W+LDP+SE MFDNG
Sbjct:   27 KPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 114          
BLAST of winged helix/forkhead transcription factor vs. Planmine SMEST
Match: SMESG000015673.1 (SMESG000015673.1)

HSP 1 Score: 156.377 bits (394), Expect = 2.080e-42
Identity = 67/101 (66.34%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  483 VKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ 785
            VKPPYSYIALITMA+   P++K+TLSGI +FIM +FPYY++    WQNSIRHNLSLN+CFIKIPR+   PGKG+YW L P++ +MF+NGSFLRRR+R+K +
Sbjct:   72 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAK 172          
BLAST of winged helix/forkhead transcription factor vs. Planmine SMEST
Match: SMESG000021434.1 (SMESG000021434.1)

HSP 1 Score: 141.354 bits (355), Expect = 2.843e-38
Identity = 65/101 (64.36%), Postives = 77/101 (76.24%), Query Frame = 3
Query:  477 HNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 779
            H  KPPYSYIALI MAI  +P +K+TLSGI +FI   FP+Y      WQNSIRHNLSLNDCFIKI R+  NPGKGNYWTL+   E+MFD+G+F RRR++ K
Sbjct:   61 HLEKPPYSYIALIAMAIRNTPDKKITLSGIYKFITDNFPFYHRNKQGWQNSIRHNLSLNDCFIKIARDKNNPGKGNYWTLNENFEEMFDHGNFRRRRRKTK 161          
The following BLAST results are available for this feature:
BLAST of winged helix/forkhead transcription factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXD44.313e-5471.79forkhead box D4 [Source:HGNC Symbol;Acc:HGNC:3805][more]
FOXD33.051e-5386.46forkhead box D3 [Source:HGNC Symbol;Acc:HGNC:3804][more]
FOXD11.470e-5086.67forkhead box D1 [Source:HGNC Symbol;Acc:HGNC:3802][more]
FOXD22.188e-5083.16forkhead box D2 [Source:HGNC Symbol;Acc:HGNC:3803][more]
FOXD4L16.372e-4973.79forkhead box D4 like 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1309.900e-5570.25pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
pha-43.094e-3460.20Defective pharyngeal development protein 4 [Sourc... [more]
pha-44.268e-3460.20Defective pharyngeal development protein 4 [Sourc... [more]
pha-45.754e-3460.20Defective pharyngeal development protein 4 [Sourc... [more]
fkh-21.543e-3156.44ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd59A5.165e-6273.08gene:FBgn0004896 transcript:FBtr0071898[more]
croc1.767e-3766.34gene:FBgn0014143 transcript:FBtr0078395[more]
fd96Ca3.842e-3764.29gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca3.842e-3764.29gene:FBgn0004897 transcript:FBtr0084770[more]
fd96Cb1.063e-3660.19gene:FBgn0004898 transcript:FBtr0084771[more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd31.043e-5660.65forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
foxd51.770e-5285.11forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4... [more]
foxd51.770e-5285.11forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4... [more]
foxd12.649e-5161.76forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
foxd21.135e-5085.56forkhead box D2 [Source:ZFIN;Acc:ZDB-GENE-980605-6... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd38.517e-5565.25forkhead box D3 [Source:NCBI gene;Acc:496851][more]
ankra21.779e-5381.55ankyrin repeat family A member 2 [Source:Xenbase;A... [more]
arhgef281.458e-5262.41Rho guanine nucleotide exchange factor 28 [Source:... [more]
foxd14.773e-5182.98forkhead box D1 [Source:NCBI gene;Acc:493510][more]
FOXD21.688e-5085.56forkhead box D2 [Source:NCBI gene;Acc:100495241][more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxd37.485e-5486.46forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473... [more]
Foxd37.485e-5486.46forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473... [more]
Foxd21.361e-5083.16forkhead box D2 [Source:MGI Symbol;Acc:MGI:1347471... [more]
Foxd13.213e-5085.56forkhead box D1 [Source:MGI Symbol;Acc:MGI:1347463... [more]
Foxd41.607e-4971.20forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02361|FD3_DROME5.177e-6173.08Fork head domain-containing protein FD3 OS=Drosoph... [more]
sp|Q9DEN3|FXD3B_XENLA1.842e-5667.59Forkhead box protein D3-B OS=Xenopus laevis OX=835... [more]
sp|Q9DEN4|FXD3A_XENLA8.129e-5585.71Forkhead box protein D3-A OS=Xenopus laevis OX=835... [more]
sp|Q63245|FOXD3_RAT9.036e-5590.00Forkhead box protein D3 (Fragment) OS=Rattus norve... [more]
sp|P79772|FOXD3_CHICK1.941e-5485.71Forkhead box protein D3 OS=Gallus gallus OX=9031 G... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X2C8700.000e+0100.00Winged helix/forkhead transcription factor OS=Schm... [more]
Q8MXW80.000e+073.63Winged helix/forkhead transcription factor (Fragme... [more]
T1D1481.499e-9853.44FoxD OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0A9WTF65.035e-6563.98Fork head domain-containing protein FD3 (Fragment)... [more]
A0A146KV171.767e-6462.80Forkhead box protein D3 OS=Lygus hesperus OX=30085... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd31.189e-5486.46forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
foxd18.922e-5374.55forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
zgc:1626122.698e-5264.34zgc:162612 [Source:ZFIN;Acc:ZDB-GENE-070410-88][more]
foxd21.791e-5184.21forkhead box protein D2 [Source:NCBI gene;Acc:1030... [more]
foxl11.001e-4064.00forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXC21.164e-4066.67forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
foxf2a3.949e-3857.14forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2a4.067e-3857.14forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxb21.543e-3764.36forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
foxl2b9.704e-3762.22forkhead box L2b [Source:ZFIN;Acc:ZDB-GENE-170803-... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM16.046e-2255.68Forkhead transcription factor; drives S-phase acti... [more]
FKH23.878e-2139.44Forkhead family transcription factor; rate-limitin... [more]
FKH12.395e-1840.18Forkhead family transcription factor; rate-limitin... [more]
FHL11.447e-1138.24Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451053.596e-5286.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420981.259e-3953.23Forkhead domain protein D1; Predicted protein [So... [more]
EDO395291.598e-3968.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424922.214e-3953.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451029.707e-3961.74Forkhead domain protein E; Predicted protein [Sou... [more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd31.024e-5487.50forkhead box D3 [Source:NCBI gene;Acc:100301607][more]
FOXD23.786e-5264.96forkhead box D1 [Source:NCBI gene;Acc:100302451][more]
zgc:1626123.665e-4866.12forkhead box D4 [Source:NCBI gene;Acc:100301608][more]
ENSORLT00000004708.23.990e-4859.85forkhead box protein D1-like [Source:NCBI gene;Acc... [more]
foxe32.742e-4464.10forkhead box E3 [Source:NCBI gene;Acc:100301611][more]
back to top
BLAST of winged helix/forkhead transcription factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077075.10.000e+099.77SMESG000077075.1[more]
SMESG000065690.11.700e-5071.43SMESG000065690.1[more]
SMESG000021761.14.268e-4678.41SMESG000021761.1[more]
SMESG000015673.12.080e-4266.34SMESG000015673.1[more]
SMESG000021434.12.843e-3864.36SMESG000021434.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027297
GenBankAGL33698.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027297 ID=SMED30027297|Name=winged helix/forkhead transcription factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1433bp
TATAATTAGTTGATTATTAATTTTATGAAGTTGCAATGAACAAATTTTCA
TTATATTACTCTACTTTAAATCATTTATCCAAAGAAGAGGAATCCAATTC
CATGGCATTGGAAATGAATCATCTCTATTGGTCACTGTTCGGTCAGCGCT
CTGATGCGAAATTAATGAAGAATTTTGGAGATGACTCTTACTTGATGCCA
TATCACAGATCTAATTCTATAGAGTATTTAAGAGCGTCTCAAAGAATAAA
CATGAAATATGAACAAGATATGCCCCAGGCGTTCAAAGATTCTCAGACTA
TTGAACAAATAAAAAATTTACTTCGAGATGATGATGTGGATGTAGACGAA
TTGAAAGAATGCGAAAGTGATGATAATATACACTCAGAAAGTGATTTAGA
TCGAATATGTTCAGAAGACAAAAAAGATGTTGATAATAAAATACCGATGT
CTCAAGAAAGATGCAAATCTAAATCTCATAATGTAAAACCTCCATATTCA
TATATAGCTCTAATTACCATGGCAATTTTAAGATCTCCTCAAAGAAAATT
GACATTGAGTGGAATATGTGAATTTATAATGGGACGTTTTCCATATTATA
AAGATAGATTTCCAGCCTGGCAAAATAGTATTCGTCATAATTTATCTTTG
AATGATTGCTTCATAAAAATACCAAGAGAACCGGGAAATCCTGGCAAAGG
AAATTACTGGACATTAGATCCAAGATCAGAAGATATGTTTGATAATGGCA
GCTTCTTACGAAGAAGAAAACGATATAAGCGTCAGTTACCATCAGAAATG
TTCAATCACAATCAATCTCATTTGATAATTCCTCCAACTTCATTCAGAAT
GACTATTCCACCAAATCCAATAACAGTTCAACAAAACCTCGTAAATCAGT
TGTTATTTCATCAAAATATTACTAAGTCAATTATTCCCAATCCGAATAAT
ATCATTCCTCCATTGAATGCTATTCGTTATCCAAGACCGTTTGAGAATAA
TTTCAGAGGACATGAGTTCATAGGATCGCTAGTTCCCCCTTATCCACACG
ATGGGAGAATAGTTATTCCTTCGACATCAAAAACTGAATACAACGAGCCG
ATAAATAAAAGATGCAAACTCAATTCATCAGAAGACGAACTGTCGACATT
TCAAAAGTTTTCCATTTCTCACATAATTTCAGACGATTCAACAGATAATA
AAACTAAACAATCTGAAGAATCTTATGCTAATCAGTTCATACCGCAAACG
CTTCGACTTTGGCCATGCAATCCTTTTCCAGTGGCAAAACCAGTGATCAA
ATCGACTTGGATACCTCCTAATTTCATCAACTGACAATATAATTGCAATA
TAGAATAATTGAAATTCTTTGTACAGTTCTGACGAATTTAATATTTTCTT
TTATACTCAAAAATAAATTCTTTCGAAATTTCA
back to top

protein sequence of SMED30027297-orf-1

>SMED30027297-orf-1 ID=SMED30027297-orf-1|Name=SMED30027297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MNKFSLYYSTLNHLSKEEESNSMALEMNHLYWSLFGQRSDAKLMKNFGDD
SYLMPYHRSNSIEYLRASQRINMKYEQDMPQAFKDSQTIEQIKNLLRDDD
VDVDELKECESDDNIHSESDLDRICSEDKKDVDNKIPMSQERCKSKSHNV
KPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIR
HNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYKRQ
LPSEMFNHNQSHLIIPPTSFRMTIPPNPITVQQNLVNQLLFHQNITKSII
PNPNNIIPPLNAIRYPRPFENNFRGHEFIGSLVPPYPHDGRIVIPSTSKT
EYNEPINKRCKLNSSEDELSTFQKFSISHIISDDSTDNKTKQSEESYANQ
FIPQTLRLWPCNPFPVAKPVIKSTWIPPNFIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0003109anterior pole cell
PLANA:0007524anterior pole
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR018122TF_fork_head_CS_1
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 172..189
score: 54.85
coord: 195..212
score: 79.94
coord: 151..164
score: 79.2
IPR001766Fork head domainSMARTSM00339forkneu4coord: 149..239
e-value: 3.3E-59
score: 212.7
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 151..235
e-value: 4.6E-37
score: 126.2
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 151..245
score: 39.504
IPR001766Fork head domainCDDcd00059FHcoord: 151..228
e-value: 6.56777E-49
score: 159.256
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 137..246
e-value: 9.7E-45
score: 152.8
NoneNo IPR availablePANTHERPTHR11829:SF361FORKHEAD BOX PROTEIN D2coord: 79..399
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 79..399
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 195..201
IPR018122Fork head domain conserved site1PROSITEPS00657FORK_HEAD_1coord: 151..164
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 150..245