Death domain-containing protein

Overview
NameDeath domain-containing protein
Smed IDSMED30027291
Length (bp)4401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Death domain-containing protein (SMED30027291) t-SNE clustered cells

Violin plots show distribution of expression levels for Death domain-containing protein (SMED30027291) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Death domain-containing protein (SMED30027291) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Death domain-containing protein (SMED30027291) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027291

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027291SMESG000064407.1 SmedASXL_017735SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027291SMESG000064407.1 dd_Smed_v4_12177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30027291SMESG000064407.1 dd_Smed_v4_12177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027291SMESG000064407.1 dd_Smed_v4_12177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027291SMESG000064407.1 dd_Smed_v6_12177_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30027291SMESG000064407.1 SMESG000029735.1 OX_Smed_1.0.11548ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027291SMESG000064407.1 dd_Smed_v4_12177_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A267H2A2 (Death domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018443g1 PE=4 SV=1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 289/547 (52.83%), Postives = 391/547 (71.48%), Query Frame = 2
Query: 2630 IEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDISLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNG-TEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQYQYKDKKVVAEISVKHELEEKIES----------PEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQII 4237
            I+ W++S  A  D C HLLDVIA+RSL   E  I +Q + I  L+  L     +VD+++  V   +  +  V  R++  E  V EL   VG + EKV EIDLKT+S AP W+REVS L+NP S+ DWRLLA RL FSA++IR+W+T ADPCMS+L++F+   +  EA++A+L+QL E+NR+DAA IVE ++  AES  SD DP+EF  P  +FLSYQWG Q EVK+L++HL+KAGYRCWMDIGQMGGGDKL+ AID GIR A V I+CVT KYS+S NC+RELNL++SL+K +IP+Q+E++ WPP G MGPLLTEY++IR+F ++G      G FW  DKF ELL+QIR + AP+Y+ V   Y NWW+PP         D+K  ++   K   ++K +S          P++FLSYQW KQ EVK L   L  +G++CWMDI+QMGGGDSLY+KID+GVRGCS+++  VTPKY+ S NCRRE+SL D+I+KP++P+M+E+M WPPEGPMSM L+QL+Y+      E+Q TW G+  +EL ++++QI+
Sbjct:  858 IKHWKSS-PALLDACNHLLDVIANRSLVGLEGQITDQSDKIGGLERDLSDTGHKVDEVSGRVDETRDELGQVRGRVDATEGRVDELNVAVGVLGEKVEEIDLKTLSAAPAWSREVSRLINPESDTDWRLLAQRLNFSADDIRAWATTADPCMSMLAEFYTNNRAAEASKAVLQQLKEMNRLDAAAIVEASILNAESAASD-DPVEFTAPRNVFLSYQWGHQAEVKMLKQHLEKAGYRCWMDIGQMGGGDKLFSAIDAGIRSAKVVIACVTDKYSKSDNCRRELNLSVSLNKHLIPVQLERVSWPPEGAMGPLLTEYLYIRLFDRSGKASGSGGVFWPPDKFMELLVQIRLAVAPDYDSVSAEYANWWQPPSADETIVLPDRKEASKTDAKA--KDKFDSADSRDAPPAAPQVFLSYQWSKQSEVKALYSRLCSLGFTCWMDIFQMGGGDSLYEKIDRGVRGCSVVVAFVTPKYAASPNCRREVSLADAIRKPIVPVMLEKMAWPPEGPMSMPLTQLIYVQMYKDAEDQLTWRGEKFEELHARLRQIV 1400          
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A267H5X5 (Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019235g1 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 285/543 (52.49%), Postives = 389/543 (71.64%), Query Frame = 2
Query: 2630 IEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDISLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNG-TEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQYQYKDKKVVAEISVKHEL------EEKIESPEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQII 4237
            I+ W++S  A  D C HLLDVIA+RSL   E  I +Q + I  L+  L     +VD+++  V   +  +  V  R++  E  V EL   VG + EKV EIDLKT++ AP W+REVS L+NP S+ DWRLLA RL FSA++IR+W+T ADPCMS+L++F+   +  EA++A+L+QL E+NR+DAA IVE ++  AES  SD DP+EF  P  +FLSYQWG Q EVK+L++HL+KAGYRCWMDIGQMGGGDKL+ AID GIR A V I+CVT KYS+S NC+RELNL++SL+K +IP+Q+E++ WPP G MGPLLTEY++IR+F ++G      G FW  DKF ELL+QIR + AP+Y+ V   Y NWW+PP         D+K  ++   K +       +    +P++FLSYQW KQ EVK L   L  +G++CWMDI+QMGGGDSLY+KID+GVRGCS+++  VTPKY+ S NCRRE+SL D+I+KP++P+M+E+M WPPEGPMSM L+QL+Y+      ++Q TW G+  +EL ++++QI+
Sbjct:  870 IKRWKSS-PALLDACNHLLDVIANRSLVGLEGQITDQSDKIGGLERDLSDTGHKVDEVSGRVDETRDELGQVRGRVDATEGRVDELNITVGVLDEKVKEIDLKTLNAAPAWSREVSRLMNPESDTDWRLLAQRLNFSADDIRAWATTADPCMSMLAEFYTNNRAAEASKAVLQQLKEMNRLDAAAIVEASILNAESAASD-DPVEFTAPRNVFLSYQWGHQAEVKMLKQHLEKAGYRCWMDIGQMGGGDKLFSAIDAGIRSAKVVIACVTDKYSKSDNCRRELNLSVSLNKHLIPVQLERVSWPPEGAMGPLLTEYLYIRLFDRSGKASGSGGVFWPPDKFMELLVQIRLAVAPDYDSVSAEYANWWQPPSADETIVLPDRKEASKSDAKTKTSSADSRDAPPAAPQVFLSYQWSKQSEVKALYSRLCSLGFTCWMDIFQMGGGDSLYEKIDRGVRGCSVVVAFVTPKYAASPNCRREVSLADAIRKPIVPVMLEKMAWPPEGPMSMPLTQLIYVQMYKDADDQLTWRGEKFEELHARLRQIV 1410          
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A1I8I651 (Death domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 282/530 (53.21%), Postives = 379/530 (71.51%), Query Frame = 2
Query: 2630 IEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDISLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNG-TEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQYQYKDKKVVAEISVKHEL------EEKIESPEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQ 4198
            I+ W++S  A  D C HLLDVIA+RSL   E  I +Q + I  L+  L     +VD+++  V   +  +  V  R++  E  V EL   VG + EKV EIDLKT+S AP W+REVS L+NP S+ DWRLLA RL FSA++IR+W+T ADPCMS+L++F+   +  EA++A+L+QL E+NR+DAA IVE ++  AES  SD DP+EF  P  +FLSYQWG Q EVK+L++HL+KAGYRCWMDIGQMGGGDKL+ AID GIR A V I+CVT KYS+S NC+RELNL++SL+K +IP+Q+E++ WPP G MGPLLTEY++IR+F ++G      G FW  DKF ELL+QIR + AP+Y+ V   Y NWW+PP         D+K  ++   K +       +    +P++FLSYQW KQ EVK L   L  +G++CWMDI+QMGGGDSLY+KID+GVRGCS+++  VTPKY+ S NCRRE+SL D+I+KP++P+M+E+M WPPEGPMSM L+QL+Y+      ++Q TW G+
Sbjct:  874 IKRWKSS-PALLDACNHLLDVIANRSLVGLEGQITDQSDKIGGLERDLSDTGHKVDEVSGRVDETRDELGQVRGRVDATEGRVDELNVAVGVLGEKVEEIDLKTLSAAPAWSREVSRLMNPESDTDWRLLAQRLNFSADDIRAWATTADPCMSMLAEFYTNNRAAEASKAVLQQLKEMNRLDAAAIVEASILNAESAASD-DPVEFTAPRNVFLSYQWGHQAEVKMLKQHLEKAGYRCWMDIGQMGGGDKLFSAIDAGIRSAKVVIACVTDKYSKSDNCRRELNLSVSLNKHLIPVQLERVSWPPEGAMGPLLTEYLYIRLFDRSGKASGSGGVFWPPDKFMELLVQIRLAVAPDYDSVSAEYANWWQPPSADETIVLPDRKEASKTDAKAKTSSADSRDAPPAAPQVFLSYQWSKQSEVKALYSRLCSLGFTCWMDIFQMGGGDSLYEKIDRGVRGCSVVVAFVTPKYAASPNCRREVSLADAIRKPIVPVMLEKMAWPPEGPMSMPLTQLIYVQMYKDADDQLTWRGE 1401          
BLAST of Death domain-containing protein vs. TrEMBL
Match: K1QFD8 (Death domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10026176 PE=4 SV=1)

HSP 1 Score: 555.829 bits (1431), Expect = 2.496e-172
Identity = 278/565 (49.20%), Postives = 386/565 (68.32%), Query Frame = 2
Query: 2624 EKIEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDISLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYGTFWSKDKFQELLIQIR-YSSAPEYEIVDDMYLNWWKPPE-----TKSQYQYKDKKVVAEISVKHELEEKIESPEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIR-------KPVNSKQNKTSKD 4279
            EKI+E   S T   DL ++LL+ +  RS+ K   D+ E    IEKL+I +   +  +  +  DV  Q   +E V + +      V E++ +V D KE+V E+D KT+SNAPIW+R+V+ LLNP S  DWRLLASRLG+S ++IR W+T +DPCM+LLS+++A  +  EA+R +L  L E+NR+DAA IVENA+  AE +V+DE P+++  PP+IFLSYQWG Q+EVK++  HL+ AGY+CWMDIGQMGGGDKL+E ID GIR A + ISCVT+KY++SPNC RE+NL+++L K +IPL MEKM WPP G+MGP+ +EY+FIR F + G E      W   KF ELL+Q+      P+ E +  MY NWW P        K   +  + K  +        E ++ SP++F+SYQW KQ+E+  L + LT +G++CW+DI QMGGGDSLYDKID+GVRGC +M+  VT KY+ SANCRRE+SL D++KKP+IP++ME++ WPP GPMSM+L+QL+Y++F      Q +W G+   ELLSKI+Q +        +  +SKQ K +KD
Sbjct:  479 EKIKEKGASKTVT-DLVENLLNELEGRSIAKVSKDVEEHSGQIEKLEIGVAGTKVVLKKVHRDVKEQGEEIEGVKQGLGEVNTRVDEVEMDVADTKERVEEVDKKTMSNAPIWSRDVTKLLNPESEHDWRLLASRLGYSPDDIRGWATQSDPCMALLSEWYATHRTFEASRGVLTILQEMNRLDAAIIVENAMKAAEGVVTDE-PVDYPEPPEIFLSYQWGHQNEVKLICRHLEMAGYKCWMDIGQMGGGDKLFEKIDSGIRAAKIVISCVTEKYAKSPNCNREVNLSVNLGKPMIPLLMEKMAWPPAGSMGPIFSEYLFIRFFQRPGEETNDDRIWPAAKFTELLMQMNCLKIMPDEENIATMYKNWWMPVVEEIVIPKRNEKKGENKAASSGQENVNRESQVVSPDVFISYQWGKQKEIIALFQRLTSLGFTCWLDIRQMGGGDSLYDKIDRGVRGCKVMLSSVTTKYALSANCRREVSLADALKKPIIPLLMEKIDWPPTGPMSMVLTQLLYVNFSKDESIQLSWEGKYFDELLSKIKQHVPTAKIEEIQTNSSKQEKNTKD 1041          
BLAST of Death domain-containing protein vs. TrEMBL
Match: V4BH47 (Death domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_102305 PE=4 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 1.304e-164
Identity = 258/557 (46.32%), Postives = 374/557 (67.15%), Query Frame = 2
Query: 2642 QTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDISLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYG-TFWSKDKFQELLIQIRYSSA-PEYEIVDDMYLNWWKP-------PETKSQYQYKDKKVVAEISVKHELEEKIESPEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIRKPVN-SKQNKTSKDI 4282
            +TS     D C  ++D +  RSL   ++++  Q+E I+ LD+ +      +  +  +VT Q+  + ++ + ++     + +L   V     KV EIDLKT+S+AP W+++VS LLNP S  DWRLL+SRLG+S ++IR+WS  +DPCM++L++++   K  EA   +L  L E++R+DAA I+EN +  +E +V DE+  ++ITPP IFLSYQWG Q+EVK+LR HL+ AGY CWMDIGQMGGGDKL+E ID+GIR A + ISC T+KY++SPNC RE+NL+++L K +IPL +E   WPP G+MGP+ +EY++I+ +     E      FW   KFQELL+Q+  +   P+   V  +Y NWWKP        ++K+    K +KVV       E  E  +SP +F+SYQWDKQ+ V KL + LT++GY CWMDIYQMGGGDSLYDKID+G+RGC +++ CVT KYS S NCRRE+SLCDS+K+P+IP+++E + WPP+GPMSM  +QL+YI        Q+ W+G    EL SK+++I+    + + + + SKDI
Sbjct:   44 KTSEIHVKDGCNAIIDFLEGRSLDSLKDELAAQQEDIDNLDVRVTSNEKNITIVTKEVTKQRVDITNIKQDVKGQGKKLDKLGNVVKATVTKVEEIDLKTLSHAPYWSKDVSKLLNPKSEHDWRLLSSRLGYSKDDIRAWSQQSDPCMAMLNEWYTTHKTSEANYGLLTALQEMSRMDAAIIIENGMKASEPVVEDEE-FDYITPPSIFLSYQWGHQEEVKLLRNHLEMAGYSCWMDIGQMGGGDKLFEKIDKGIRVAKIIISCTTEKYAQSPNCNREVNLSVNLKKPIIPLLLESCPWPPKGSMGPIFSEYLYIQFYQTENDEAAPDDRFWPIPKFQELLMQLSMNGVQPDESRVFKLYRNWWKPLVDELKIDKSKTFEGGKHRKVVES----SEKREDTKSPAVFISYQWDKQKNVMKLYKKLTELGYHCWMDIYQMGGGDSLYDKIDRGIRGCKVVVSCVTDKYSLSLNCRREISLCDSLKRPIIPLLLENIPWPPKGPMSMTFTQLLYIDLHSNDNVQEEWSGTKFDELQSKLREILPDQTSKTNEKQKSKDI 595          
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Match: EDO47001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN39])

HSP 1 Score: 130.568 bits (327), Expect = 2.424e-30
Identity = 90/262 (34.35%), Postives = 130/262 (49.62%), Query Frame = 2
Query: 2945 SNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRK--KIEATRAILEQLN----EINRIDAA-KIVENALTVAESMVSDED--------PIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYGTFWSKDKFQELLIQI-RYSS 3682
            S + I +R+  +LL       W+ L   L     E+      AD        F  +R+  +I A+ A L+ L     ++ R D   K   +AL  AE+   D               + P +FLSYQW +Q+    L   L++AG  CWMD+GQMGGGD LY +ID G+RGA V + CVT +Y  S NC+ E  L   L K +IPL  E++ WPP G +GP+  + ++I M     +E +        KFQEL+ +I +Y S
Sbjct: 1250 SGSSIVSRDTLMLLAREIGPAWKALGRALLLDNAELDQ--IEADEKQLYEQSFLVLRRWHEINASAATLDNLGRALVKVGRGDLGRKHCGDALQGAEACAQDSTDSAKAPSPVASPSSSPPVFLSYQWDMQETALELGRQLREAGIECWMDVGQMGGGDSLYASIDAGVRGAKVMLCCVTSRYCASENCQCEATLGGLLKKPIIPLLFEEIPWPPAGQLGPVFAKLLYIDM--TQCSENI-----PSQKFQELVQRIEKYCS 1502          

HSP 2 Score: 124.02 bits (310), Expect = 2.411e-28
Identity = 61/137 (44.53%), Postives = 85/137 (62.04%), Query Frame = 2
Query: 3833 FLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIRK 4243
            FLSYQWD QE   +L   L + G  CWMD+ QMGGGDSLY  ID GVRG  +M+ CVT +Y  S NC+ E +L   +KKP+IP++ E + WPP G +  + ++L+YI   D  +  +    Q  QEL+ +I++   K
Sbjct: 1370 FLSYQWDMQETALELGRQLREAGIECWMDVGQMGGGDSLYASIDAGVRGAKVMLCCVTSRYCASENCQCEATLGGLLKKPIIPLLFEEIPWPPAGQLGPVFAKLLYI---DMTQCSENIPSQKFQELVQRIEKYCSK 1503          
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 92.0485 bits (227), Expect = 9.483e-19
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 2
Query: 3260 QIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYGTFWSKDKFQELLIQI 3670
             + +SYQW +Q  +  ++  LQ AGYR WMD+ QMGG     +A+   +  A V + CV++KY ESPNC+ E   A  L K ++PL MEK  + P G +G ++   ++I    K        T    D F++L  +I
Sbjct:  597 HVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGS--TLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEK-SYRPDGWLGMIMGAKLWIDFSDKQ-------TLRVDDSFEKLQKEI 723          

HSP 2 Score: 83.5741 bits (205), Expect = 4.247e-16
Identity = 41/112 (36.61%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 3830 IFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVD 4165
            + +SYQWD Q  + ++K  L   GY  WMD+ QMGG  S    +   V    ++++CV+ KY ES NCR E      ++K ++P+MME+  + P+G + MI+   ++I F D
Sbjct:  598 VMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGG--STLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKS-YRPDGWLGMIMGAKLWIDFSD 706          
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 90.5077 bits (223), Expect = 4.132e-18
Identity = 43/117 (36.75%), Postives = 68/117 (58.12%), Query Frame = 2
Query: 3260 QIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGT 3610
             + LSYQWG QD V  +R+ L+ AGY+ W+D+ QM G     EA+   +  A   + CV++ Y ESPNC+ E   +  L K +IPL ME  ++ P G +G ++   +++   +K+ T
Sbjct:  554 HVMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEGST--LEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEP-QYKPDGWLGIIVGAKLWMDFRSKDAT 667          

HSP 2 Score: 81.2629 bits (199), Expect = 2.866e-15
Identity = 40/121 (33.06%), Postives = 69/121 (57.02%), Query Frame = 2
Query: 3260 QIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVY 3622
             I +SYQW  Q  +  + + L++AG++ WMD+ QMGG     EA+ R +  A V +  ++++Y +SPNC+ E   A    K ++PL ME+ ++ P G +G +L   +++       T IV+
Sbjct: 1013 HIMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGST--LEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQ-DYRPDGWLGMILGAKLWMDFRESVDTGIVH 1130          

HSP 3 Score: 73.9442 bits (180), Expect = 4.358e-13
Identity = 39/117 (33.33%), Postives = 69/117 (58.97%), Query Frame = 2
Query: 3827 EIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISF---VDT 4168
             I +SYQWD Q+ +  + + L + G+  WMD+ QMGG  S  + + + V   S++++ ++ +Y +S NCR E       +K ++P+MME+  + P+G + MIL   +++ F   VDT
Sbjct: 1013 HIMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGG--STLEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQ-DYRPDGWLGMILGAKLWMDFRESVDT 1126          

HSP 4 Score: 68.1662 bits (165), Expect = 2.260e-11
Identity = 44/149 (29.53%), Postives = 76/149 (51.01%), Query Frame = 2
Query: 3827 EIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIRKPVNSKQNKTS 4273
             + LSYQW  Q+ V K+++ L   GY  W+D+ QM G  S  + +   V   + +++CV+  Y ES NCR E      ++K +IP+MME   + P+G + +I+   +++ F       +     A Q L+ ++ Q  R     K ++ S
Sbjct:  554 HVMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEG--STLEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQ-YKPDGWLGIIVGAKLWMDF-----RSKDATSSAVQGLIKELGQRGRPAKKGKLHRKS 694          
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Match: EDO28203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DUR5])

HSP 1 Score: 77.0258 bits (188), Expect = 4.073e-14
Identity = 57/181 (31.49%), Postives = 89/181 (49.17%), Query Frame = 2
Query: 3041 AEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVEN-ALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQM-----------GGGD--KLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWP 3541
            A +  S S H   CM +L   + ++        ILEQ    + +D+ K ++  A  VA S+  +ED     T P++FLSY W +Q +V+ L   L+  G+ CW D+  +           G  D   L   I R ++ +V  + C+T+KY  S NC ++L+LA  L K ++PL     EWP
Sbjct:  493 AIDFESCSYHD--CMDVLR--YQLKPLRSMPAVILEQEFLDHMVDSIKPLKVLADNVAPSIPDNED---ISTQPRVFLSYHWDVQTKVQRLAHFLENQGFECWTDVSGVSKQPLPNTSLHGNNDTGTLQTQIKRSMKSSVAILCCITRKYICSDNCLKDLDLAELLSKPIVPL---IFEWP 663          

HSP 2 Score: 61.6178 bits (148), Expect = 1.974e-9
Identity = 35/110 (31.82%), Postives = 58/110 (52.73%), Query Frame = 2
Query: 3824 PEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQM-----------GGGDS--LYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPE 4114
            P +FLSY WD Q +V++L   L   G+ CW D+  +           G  D+  L  +I + ++    ++ C+T KY  S NC ++L L + + KP++P++ E   WP E
Sbjct:  559 PRVFLSYHWDVQTKVQRLAHFLENQGFECWTDVSGVSKQPLPNTSLHGNNDTGTLQTQIKRSMKSSVAILCCITRKYICSDNCLKDLDLAELLSKPIVPLIFE---WPLE 665          
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Match: EDO32803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU33])

HSP 1 Score: 77.0258 bits (188), Expect = 4.250e-14
Identity = 57/181 (31.49%), Postives = 89/181 (49.17%), Query Frame = 2
Query: 3041 AEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVEN-ALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQM-----------GGGD--KLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWP 3541
            A +  S S H   CM +L   + ++        ILEQ    + +D+ K ++  A  VA S+  +ED     T P++FLSY W +Q +V+ L   L+  G+ CW D+  +           G  D   L   I R ++ +V  + C+T+KY  S NC ++L+LA  L K ++PL     EWP
Sbjct:  493 AIDFESCSYHD--CMDVLR--YQLKPLRSMPAVILEQEFLDHMVDSIKPLKVLADNVAPSIPDNED---ISTQPRVFLSYHWDVQTKVQRLAHFLENQGFECWTDVSGVSKQPLPNTSLHGNNDTGTLQTQIKRSMKSSVAILCCITRKYICSDNCLKDLDLAELLSKPIVPL---IFEWP 663          

HSP 2 Score: 61.6178 bits (148), Expect = 1.974e-9
Identity = 35/110 (31.82%), Postives = 58/110 (52.73%), Query Frame = 2
Query: 3824 PEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQM-----------GGGDS--LYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPE 4114
            P +FLSY WD Q +V++L   L   G+ CW D+  +           G  D+  L  +I + ++    ++ C+T KY  S NC ++L L + + KP++P++ E   WP E
Sbjct:  559 PRVFLSYHWDVQTKVQRLAHFLENQGFECWTDVSGVSKQPLPNTSLHGNNDTGTLQTQIKRSMKSSVAILCCITRKYICSDNCLKDLDLAELLSKPIVPLIFE---WPLE 665          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000064407.1 (SMESG000064407.1)

HSP 1 Score: 1597.41 bits (4135), Expect = 0.000e+0
Identity = 801/808 (99.13%), Postives = 805/808 (99.63%), Query Frame = 3
Query:   99 LNSKFENNTDSEYSKYFDNINELVTENPNEQCLKEILDAICTQVLKYNPEHKSNDSYMLIRCMVVFKDMAGNAITNLIEEKLINVMHVTINSDWSSTKCELLSLMYRCLPEKYMQNLSGKQLENHLAIFKDINLKISKLEKEENYQFIRQEQQNFITNMITYIDQALIEKNRENFQDLLQNFYFQGWRKDDEETKIISNLLYRAVSSCKTLYLTTPNEFLKLLTEITEKLIKDSVETENGKEIIKDFFSLSSKVLNHNKENMELMMDKVAKSLFLLYKLDQDWMYSILYNINREFYHVNNKFVSTVFKNCQYLAKDALEYFDNLISKIPSKADLEESEYEKRFSDWCNCIKSLTQVFLQQTLKTQEDLETFVYCMANFISNFNDEIATLFHNSFEKIEKPIQELFKKKPDLIIPLIDKCVEFSFREASMEDTSLSFPFKIPTFRLQDVFEKITKFGKISKAFKSVSVQDNLRVHFLKCFNEFNLTITIFIASFYEYIEFQSYTPEQMLESIQSINIMIDTELFQLYNPSTIIIATLFGNLADCISQSTVKYSSVFPELINSCKICLKNGLLWENSDGELSYNTNSLIIFHVSSQLLLKKSSIPLINKFYSILFETINMIDESHGFYSSYISFASTVPRVCANPEXXXXXXXXXXXXXPKLQDTSLDGNIYSFLDGLQVIITTKPETGLEYLTEIENFLTMFLNPTYLIPVFSILSILYKDYPEKINTKLIEVIGNKFAADLSNAYYVGNLLNIISKTHSNDLKAIINQITEALSTHKINVSHLVMEIFGNILKSDPSFGETIFPIVVN 2522
            LNSKFENNTD EYSKYFDNINELVTENPNEQCLKEILDAICTQVLKYNPEHKSNDSYMLIRCMVVFKDMAGNAITNLIEEKLINVMHVTINSDWSSTKCELLSLMYRCLPEKYMQNLSGKQLENHLAIFKDINLKISKLEKEENYQFIRQEQQNFITNMITYIDQALIEKNRE FQDLLQNFYFQGWRKDDEETKIISNLLYRAVSSCKTLYLTTPNEFLKLLTEITEKLIKDSVETENGKEIIKDFFSLSSKVLNHNKENMELMMDKVAKSLFLLYKLD+DWMYSILYNINREFYHVNNKFVSTVFKNCQYLAKDALEYFDNLISKIPSKADLEESEYEKRFSDWCNCIKSLTQVFLQ+TLKTQEDLETFVYCMANFISNFNDEIATLFHNSFEKIEKP+QELFKKKPDLIIPLIDKCVEFSFREASMEDTSLSFPFKIPTFRLQDVFEKITKFGKISKAFKSVSVQDNLRVHFLKCFNEFNLTITIFIASFYEYIEFQSYTPEQMLESIQSINIMIDTELFQLYNPSTIIIATLFGNLADCISQSTVKYSSVFPELINSCKICLKNGLLWENSDGELSYNTNSLIIFHVSSQLLLKKSSIPLINKFYSILFETINMIDESHGFYSSYISFASTVPRVCANPELL DNLGDIINLIPKLQDTSLDGNIYSFLDGLQVIITTKPETGLEYLTEIENFL+MFLNPTYLIPVFSILSILYKDYPEKINTKLIEVIGNKFAADLSNAYYVGNLLNIISKTHSNDLKAIINQITEALSTHKINVSHLVMEIFGNILKSDPSFGETIFPIVVN
Sbjct:    6 LNSKFENNTDPEYSKYFDNINELVTENPNEQCLKEILDAICTQVLKYNPEHKSNDSYMLIRCMVVFKDMAGNAITNLIEEKLINVMHVTINSDWSSTKCELLSLMYRCLPEKYMQNLSGKQLENHLAIFKDINLKISKLEKEENYQFIRQEQQNFITNMITYIDQALIEKNREIFQDLLQNFYFQGWRKDDEETKIISNLLYRAVSSCKTLYLTTPNEFLKLLTEITEKLIKDSVETENGKEIIKDFFSLSSKVLNHNKENMELMMDKVAKSLFLLYKLDKDWMYSILYNINREFYHVNNKFVSTVFKNCQYLAKDALEYFDNLISKIPSKADLEESEYEKRFSDWCNCIKSLTQVFLQKTLKTQEDLETFVYCMANFISNFNDEIATLFHNSFEKIEKPVQELFKKKPDLIIPLIDKCVEFSFREASMEDTSLSFPFKIPTFRLQDVFEKITKFGKISKAFKSVSVQDNLRVHFLKCFNEFNLTITIFIASFYEYIEFQSYTPEQMLESIQSINIMIDTELFQLYNPSTIIIATLFGNLADCISQSTVKYSSVFPELINSCKICLKNGLLWENSDGELSYNTNSLIIFHVSSQLLLKKSSIPLINKFYSILFETINMIDESHGFYSSYISFASTVPRVCANPELLTDNLGDIINLIPKLQDTSLDGNIYSFLDGLQVIITTKPETGLEYLTEIENFLSMFLNPTYLIPVFSILSILYKDYPEKINTKLIEVIGNKFAADLSNAYYVGNLLNIISKTHSNDLKAIINQITEALSTHKINVSHLVMEIFGNILKSDPSFGETIFPIVVN 813          

HSP 2 Score: 1199.5 bits (3102), Expect = 0.000e+0
Identity = 628/650 (96.62%), Postives = 632/650 (97.23%), Query Frame = 2
Query: 2450 YGNIWKYSQIRPVFWGNDISNCSELFENNKQDNNFCLSLLTGIRSXXXXXXXXXXXXKEKIEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDISLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQYQYKDKKVVAEISVKHELEEKIESPEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIRKPVNSKQNKTSKDIQSPSLPSAISENFTIEXXXXXXXXXXXXXXXXLAKSKSC 4399
            +GNI K     P F          LFENNKQDNNFCLSLLTG+RSLGLLRHDLLVGLKEKIEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDI+LEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLV+ELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQYQYKDKKVVAEISVKHELEEKIESPEIFLSYQWDKQEEVKKLKETLTKVGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMI CVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIRKPVNSKQNKTSKDIQSPSLPSAISENFTIEATHISSASNANTSNISLAKSKSC
Sbjct:  793 FGNILKSD---PSFGETIFPIVVNLFENNKQDNNFCLSLLTGMRSLGLLRHDLLVGLKEKIEEWQTSNTAHHDLCQHLLDVIADRSLGKFENDINEQKESIEKLDINLEKERGRVDDIAIDVTNQKTIVEDVNKRMENNEVLVEELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNEDWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKNGTEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQYQYKDKKVVAEISVKHELEEKIESPEIFLSYQWDKQEEVKKLKETLTKVGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMISCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQATQELLSKIQQIIRKPVNSKQNKTSKDIQSPSLPSAISENFTIEATHISSASNANTSNISLAKSKSC 1439          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000036998.1 (SMESG000036998.1)

HSP 1 Score: 137.117 bits (344), Expect = 2.680e-33
Identity = 78/217 (35.94%), Postives = 118/217 (54.38%), Query Frame = 2
Query: 2954 PIWAREVSLLLNPTSNED--WRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIE-ATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMF 3595
            P W R  +  L+ T N+   W+ LA +LG+S E+I+ +    +P +++L D+       + +   I+  L E  +   + I+E+            DP      PQIF+SYQW  Q E + + E+L + GY  WMD+GQMGGGD L   I+R IRG  V I+C++ +Y  S  C RE+ LA  L K +IP+ +  + WPP G  G +L  YI+I +F
Sbjct:  231 PQWMRTSAKFLS-TDNQSFTWKTLAIKLGYS-EKIKKFEEDPNPALAMLVDWITTSGNNQLSVDFIILTLQEAGQFQISDIIES------------DPECQWLQPQIFISYQWHNQREAREISEYLHRVGYTTWMDVGQMGGGDLLMHRIERAIRGCKVLIACISPRYIVSTICHREIVLADLLKKPIIPVMVLPVPWPPPGGTGLMLAPYIYIDLF 433          

HSP 2 Score: 116.316 bits (290), Expect = 1.843e-26
Identity = 51/110 (46.36%), Postives = 78/110 (70.91%), Query Frame = 2
Query: 3824 PEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYI 4153
            P+IF+SYQW  Q E +++ E L +VGY+ WMD+ QMGGGD L  +I++ +RGC ++I C++P+Y  S  C RE+ L D +KKP+IP+M+  + WPP G   ++L+  +YI
Sbjct:  321 PQIFISYQWHNQREAREISEYLHRVGYTTWMDVGQMGGGDLLMHRIERAIRGCKVLIACISPRYIVSTICHREIVLADLLKKPIIPVMVLPVPWPPPGGTGLMLAPYIYI 430          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000036998.1 (SMESG000036998.1)

HSP 1 Score: 137.117 bits (344), Expect = 3.846e-33
Identity = 78/217 (35.94%), Postives = 118/217 (54.38%), Query Frame = 2
Query: 2954 PIWAREVSLLLNPTSNED--WRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIE-ATRAILEQLNEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMF 3595
            P W R  +  L+ T N+   W+ LA +LG+S E+I+ +    +P +++L D+       + +   I+  L E  +   + I+E+            DP      PQIF+SYQW  Q E + + E+L + GY  WMD+GQMGGGD L   I+R IRG  V I+C++ +Y  S  C RE+ LA  L K +IP+ +  + WPP G  G +L  YI+I +F
Sbjct:  258 PQWMRTSAKFLS-TDNQSFTWKTLAIKLGYS-EKIKKFEEDPNPALAMLVDWITTSGNNQLSVDFIILTLQEAGQFQISDIIES------------DPECQWLQPQIFISYQWHNQREAREISEYLHRVGYTTWMDVGQMGGGDLLMHRIERAIRGCKVLIACISPRYIVSTICHREIVLADLLKKPIIPVMVLPVPWPPPGGTGLMLAPYIYIDLF 460          

HSP 2 Score: 116.316 bits (290), Expect = 1.991e-26
Identity = 51/110 (46.36%), Postives = 78/110 (70.91%), Query Frame = 2
Query: 3824 PEIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYI 4153
            P+IF+SYQW  Q E +++ E L +VGY+ WMD+ QMGGGD L  +I++ +RGC ++I C++P+Y  S  C RE+ L D +KKP+IP+M+  + WPP G   ++L+  +YI
Sbjct:  348 PQIFISYQWHNQREAREISEYLHRVGYTTWMDVGQMGGGDLLMHRIERAIRGCKVLIACISPRYIVSTICHREIVLADLLKKPIIPVMVLPVPWPPPGGTGLMLAPYIYI 457          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 71.633 bits (174), Expect = 2.819e-12
Identity = 35/102 (34.31%), Postives = 60/102 (58.82%), Query Frame = 2
Query: 3263 IFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLL 3568
            +F+SY W  +  V  +R+ L ++  + W+D+ QM G     EA+  GI  + +FI  +++ Y  SPNC+ E   A SL+K +IPL +E M++ P   +G ++
Sbjct:  363 VFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKGST--LEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVE-MKYKPTSWLGIIM 461          

HSP 2 Score: 58.151 bits (139), Expect = 3.812e-8
Identity = 44/175 (25.14%), Postives = 82/175 (46.86%), Query Frame = 2
Query: 3827 EIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVD--TYEEQQTWNGQATQELLSKIQQIIRK-----------PVNSKQNKTSKDIQSPSLPSAIS 4312
            ++F+SY W  ++ V  +++ L +     W+D+ QM G  S  + +  G+   ++ I+ ++  Y  S NCR E     S+ KP+IP+++E M + P   + +I+   +Y  F     +EE       +   LL+ +  II+            PV   ++  S D  +P + S  S
Sbjct:  362 DVFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKG--STLEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVE-MKYKPTSWLGIIMGSKMYYEFSKRRNFEE-------SIHSLLANVNTIIQNVERKIVTEIIVPVAQNESYQSSDGGTPKILSVHS 526          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000047638.1 (SMESG000047638.1)

HSP 1 Score: 71.633 bits (174), Expect = 2.896e-12
Identity = 35/102 (34.31%), Postives = 59/102 (57.84%), Query Frame = 2
Query: 3263 IFLSYQWGIQDEVKVLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSESPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLL 3568
            IFLSY W  +  +  +R+ L K+    W+D+ QM G     EA+  GI  + +F+  +++ Y  SPNC+ E   A SL K +IPL +E +++ P+  +G ++
Sbjct:  309 IFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGST--LEAMADGIENSHIFVMAISEAYRTSPNCRTEAEYAFSLKKPIIPLIVE-LKYKPMSWLGMIM 407          

HSP 2 Score: 60.8474 bits (146), Expect = 5.941e-9
Identity = 34/113 (30.09%), Postives = 60/113 (53.10%), Query Frame = 2
Query: 3827 EIFLSYQWDKQXXXXXXXXXXXXXGYSCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLCDSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVD 4165
            +IFLSY W  +  +  +++ L K   + W+D+ QM G  S  + +  G+    + ++ ++  Y  S NCR E     S+KKP+IP+++E + + P   + MI+    Y  F D
Sbjct:  308 DIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKG--STLEAMADGIENSHIFVMAISEAYRTSPNCRTEAEYAFSLKKPIIPLIVE-LKYKPMSWLGMIMGSKTYYEFSD 417          
The following BLAST results are available for this feature:
BLAST of Death domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H2A20.000e+052.83Death domain-containing protein (Fragment) OS=Macr... [more]
A0A267H5X50.000e+052.49Death domain-containing protein OS=Macrostomum lig... [more]
A0A1I8I6510.000e+053.21Death domain-containing protein OS=Macrostomum lig... [more]
K1QFD82.496e-17249.20Death domain-containing protein OS=Crassostrea gig... [more]
V4BH471.304e-16446.32Death domain-containing protein OS=Lottia gigantea... [more]
back to top
BLAST of Death domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470012.424e-3034.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450309.483e-1935.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410084.132e-1836.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282034.073e-1431.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO328034.250e-1431.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Death domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064407.10.000e+099.13SMESG000064407.1[more]
SMESG000036998.12.680e-3335.94SMESG000036998.1[more]
SMESG000036998.13.846e-3335.94SMESG000036998.1[more]
SMESG000015387.12.819e-1234.31SMESG000015387.1[more]
SMESG000047638.12.896e-1234.31SMESG000047638.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027291 ID=SMED30027291|Name=Death domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4401bp
AATTTGAAAATCGGTTTCTATTTTATGAAAATGTATTTTAACATAAATAT
TTTATCATTATAATTATTAATTTCAAAATATAAATGGATAAATTCATCCT
AAATTCCAAGTTCGAAAATAATACTGATTCAGAATACTCAAAGTATTTCG
ATAATATAAATGAATTGGTTACTGAAAATCCTAATGAGCAGTGTTTAAAA
GAAATTCTCGATGCTATATGTACACAAGTACTGAAATATAATCCAGAACA
CAAGTCGAATGACTCTTACATGCTTATAAGATGTATGGTAGTATTTAAAG
ACATGGCAGGAAATGCAATTACAAATTTAATTGAAGAAAAATTAATTAAT
GTAATGCATGTTACAATCAATTCAGATTGGAGTTCTACAAAATGTGAATT
ATTAAGCCTGATGTATAGATGCTTACCAGAAAAGTATATGCAGAATTTAT
CCGGTAAACAGTTAGAAAATCATTTAGCAATTTTTAAGGACATTAATCTT
AAAATATCGAAATTGGAGAAAGAGGAGAATTATCAGTTTATAAGACAAGA
GCAACAAAACTTCATCACAAATATGATTACTTACATCGACCAGGCTTTAA
TAGAAAAAAATAGAGAAAATTTTCAGGATTTGCTTCAAAATTTTTACTTT
CAAGGTTGGCGAAAAGATGACGAAGAAACCAAAATAATTTCTAATTTATT
ATATCGAGCAGTGAGTAGTTGCAAAACATTATACCTAACAACTCCGAATG
AATTTTTAAAACTCTTAACCGAAATCACTGAAAAATTAATCAAAGATTCT
GTTGAGACCGAAAACGGTAAAGAAATAATCAAGGATTTTTTTTCACTAAG
TTCAAAAGTCCTGAATCACAACAAAGAAAATATGGAACTAATGATGGATA
AAGTTGCGAAATCACTTTTTCTGTTGTATAAATTAGACCAAGATTGGATG
TATTCTATTTTATATAATATAAACAGAGAATTCTATCATGTTAATAACAA
ATTCGTATCAACAGTTTTTAAAAATTGCCAATACCTTGCCAAAGATGCAC
TTGAATATTTTGATAATTTGATATCGAAAATTCCCAGTAAAGCTGATTTA
GAGGAATCAGAGTATGAAAAAAGGTTTTCAGATTGGTGTAACTGTATTAA
GTCTTTAACGCAAGTGTTCCTGCAACAAACGCTCAAAACACAAGAAGATT
TAGAAACGTTTGTTTATTGTATGGCAAATTTTATTTCTAACTTTAATGAC
GAAATTGCTACTTTGTTCCATAATAGTTTCGAAAAAATTGAAAAACCAAT
TCAAGAACTGTTTAAAAAAAAACCAGATTTGATCATTCCATTGATTGATA
AATGTGTCGAATTCTCATTCCGTGAAGCATCTATGGAAGACACAAGCTTA
TCATTTCCGTTTAAGATTCCAACATTTCGTTTACAGGATGTATTCGAAAA
AATTACAAAATTTGGAAAAATATCTAAAGCCTTTAAATCTGTTTCAGTCC
AGGACAACCTTCGGGTGCATTTTTTGAAATGTTTTAATGAATTTAATTTG
ACAATTACAATATTCATAGCTTCTTTTTATGAATATATCGAATTCCAGAG
TTATACACCTGAACAAATGTTAGAATCTATCCAGTCAATTAATATAATGA
TTGACACTGAATTATTCCAACTATATAATCCTTCAACCATCATAATAGCT
ACACTGTTTGGTAATCTTGCCGATTGTATAAGTCAGTCGACTGTCAAATA
TTCTTCGGTTTTTCCTGAGTTAATCAACTCTTGTAAAATTTGCTTAAAAA
ATGGATTGTTATGGGAAAATTCTGACGGAGAATTATCCTACAATACCAAT
TCTTTGATCATTTTTCATGTTTCAAGTCAACTCTTATTAAAAAAATCTTC
AATACCACTGATAAACAAATTCTACTCAATTTTATTTGAAACTATTAATA
TGATAGATGAGTCCCATGGATTTTATTCTTCATATATATCGTTTGCAAGT
ACAGTGCCAAGGGTATGTGCAAACCCCGAACTTCTCATTGACAATTTGGG
AGATATTATCAATCTCATTCCAAAATTGCAAGACACAAGTTTAGATGGAA
ATATTTACTCATTTCTTGATGGATTACAAGTTATTATTACTACGAAACCA
GAAACGGGATTAGAATATTTGACAGAAATCGAAAACTTCCTAACAATGTT
CCTTAATCCAACTTATTTGATTCCAGTATTTTCGATTTTATCAATTCTCT
ACAAAGATTATCCTGAAAAAATAAATACAAAACTGATTGAAGTTATTGGC
AATAAGTTTGCTGCTGACCTCTCAAATGCTTACTACGTTGGAAACTTGCT
TAATATAATCAGCAAAACACATTCAAATGATTTGAAGGCAATAATAAATC
AGATCACAGAAGCCCTGAGCACTCATAAAATCAATGTTTCACATTTAGTT
ATGGAAATATTTGGAAATATTCTCAAATCCGACCCGTCTTTTGGGGAAAC
GATATTTCCAATTGTAGTGAATTATTTGAAAATAATAAACAGGACAATAA
TTTTTGCCTTTCTTTATTAACTGGAATTCGATCTTTGGGACTTCTGAGAC
ACGATTTATTGGTTGGATTGAAAGAAAAAATTGAAGAATGGCAAACATCA
AATACAGCTCATCATGACTTGTGTCAACATTTGTTGGATGTCATTGCTGA
TCGGTCTTTAGGAAAATTCGAAAACGATATTAATGAACAAAAGGAGTCAA
TTGAGAAACTCGATATCAGTCTAGAAAAAGAGAGGGGCCGAGTTGATGAT
ATTGCCATAGACGTTACAAATCAAAAGACCATCGTAGAAGATGTTAACAA
ACGGATGGAAAACAACGAAGTTTTGGTAAAAGAATTAAAGACAGAGGTTG
GCGACGTAAAGGAGAAAGTTGTTGAAATTGATTTAAAAACTGTTTCTAAT
GCTCCGATATGGGCGCGAGAAGTGAGTTTGTTACTCAATCCGACCTCTAA
TGAGGACTGGAGGTTGCTAGCTTCGAGATTAGGATTTTCAGCTGAAGAGA
TACGTTCTTGGTCGACTCATGCTGATCCATGTATGAGTTTGTTAAGTGAT
TTCTTTGCAGTAAGAAAGAAAATAGAAGCTACGCGAGCAATATTAGAACA
ATTAAATGAAATTAACAGAATAGATGCAGCTAAAATTGTGGAAAATGCAT
TAACAGTGGCAGAATCTATGGTATCTGATGAAGATCCTATTGAGTTTATT
ACTCCTCCACAAATTTTTCTCAGTTATCAGTGGGGTATACAAGATGAAGT
TAAAGTATTACGTGAGCATTTACAAAAAGCTGGTTATCGATGCTGGATGG
ATATTGGTCAAATGGGGGGAGGAGACAAACTTTATGAAGCTATAGACAGA
GGCATTCGTGGAGCGGTGGTGTTTATTTCGTGCGTGACCAAGAAATATTC
AGAATCTCCAAATTGCAAAAGAGAATTGAATTTGGCAATAAGTCTGCATA
AATCTGTCATACCGTTACAAATGGAGAAAATGGAATGGCCACCGGTCGGA
ACGATGGGTCCTTTATTGACTGAATATATATTTATTCGGATGTTTGCTAA
AAATGGAACCGAGATCGTTTATGGAACTTTCTGGTCGAAAGATAAATTTC
AGGAATTATTAATTCAAATTCGATATAGTTCTGCCCCAGAATACGAAATT
GTTGATGACATGTATCTAAATTGGTGGAAACCTCCAGAAACGAAATCTCA
GTATCAATATAAAGATAAAAAGGTTGTAGCTGAAATATCTGTGAAACATG
AATTGGAAGAGAAAATTGAAAGTCCAGAAATATTTCTATCTTATCAATGG
GATAAACAAGAAGAAGTGAAAAAATTAAAAGAAACATTAACAAAAGTAGG
TTATTCCTGTTGGATGGACATTTATCAGATGGGTGGTGGAGATTCCTTAT
ATGATAAGATTGACAAAGGAGTTCGAGGTTGCTCACTAATGATTTTATGT
GTAACTCCTAAGTATTCTGAATCTGCCAACTGCCGTAGAGAATTATCGCT
TTGTGATAGTATTAAAAAACCTTTAATACCTATTATGATGGAAAGAATGG
TATGGCCTCCTGAGGGGCCTATGTCGATGATTTTGAGTCAGTTAGTGTAC
ATTTCCTTTGTCGATACTTATGAAGAACAGCAAACATGGAATGGACAAGC
TACACAAGAATTACTCTCGAAAATACAGCAAATAATCCGGAAACCAGTAA
ATAGTAAACAAAATAAAACTTCGAAAGATATTCAAAGTCCTTCACTACCT
TCAGCAATTTCTGAGAATTTTACAATAGAAGCTACTCACATTTCTTCAGC
TTCGAATGCTAATACTTCGAATATATCTCTTGCTAAATCGAAATCTTGCA
T
back to top

protein sequence of SMED30027291-orf-1

>SMED30027291-orf-1 ID=SMED30027291-orf-1|Name=SMED30027291-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=829bp
MDKFILNSKFENNTDSEYSKYFDNINELVTENPNEQCLKEILDAICTQVL
KYNPEHKSNDSYMLIRCMVVFKDMAGNAITNLIEEKLINVMHVTINSDWS
STKCELLSLMYRCLPEKYMQNLSGKQLENHLAIFKDINLKISKLEKEENY
QFIRQEQQNFITNMITYIDQALIEKNRENFQDLLQNFYFQGWRKDDEETK
IISNLLYRAVSSCKTLYLTTPNEFLKLLTEITEKLIKDSVETENGKEIIK
DFFSLSSKVLNHNKENMELMMDKVAKSLFLLYKLDQDWMYSILYNINREF
YHVNNKFVSTVFKNCQYLAKDALEYFDNLISKIPSKADLEESEYEKRFSD
WCNCIKSLTQVFLQQTLKTQEDLETFVYCMANFISNFNDEIATLFHNSFE
KIEKPIQELFKKKPDLIIPLIDKCVEFSFREASMEDTSLSFPFKIPTFRL
QDVFEKITKFGKISKAFKSVSVQDNLRVHFLKCFNEFNLTITIFIASFYE
YIEFQSYTPEQMLESIQSINIMIDTELFQLYNPSTIIIATLFGNLADCIS
QSTVKYSSVFPELINSCKICLKNGLLWENSDGELSYNTNSLIIFHVSSQL
LLKKSSIPLINKFYSILFETINMIDESHGFYSSYISFASTVPRVCANPEL
LIDNLGDIINLIPKLQDTSLDGNIYSFLDGLQVIITTKPETGLEYLTEIE
NFLTMFLNPTYLIPVFSILSILYKDYPEKINTKLIEVIGNKFAADLSNAY
YVGNLLNIISKTHSNDLKAIINQITEALSTHKINVSHLVMEIFGNILKSD
PSFGETIFPIVVNYLKIINRTIIFAFLY*
back to top

protein sequence of SMED30027291-orf-2

>SMED30027291-orf-2 ID=SMED30027291-orf-2|Name=SMED30027291-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MENNEVLVKELKTEVGDVKEKVVEIDLKTVSNAPIWAREVSLLLNPTSNE
DWRLLASRLGFSAEEIRSWSTHADPCMSLLSDFFAVRKKIEATRAILEQL
NEINRIDAAKIVENALTVAESMVSDEDPIEFITPPQIFLSYQWGIQDEVK
VLREHLQKAGYRCWMDIGQMGGGDKLYEAIDRGIRGAVVFISCVTKKYSE
SPNCKRELNLAISLHKSVIPLQMEKMEWPPVGTMGPLLTEYIFIRMFAKN
GTEIVYGTFWSKDKFQELLIQIRYSSAPEYEIVDDMYLNWWKPPETKSQY
QYKDKKVVAEISVKHELEEKIESPEIFLSYQWDKQEEVKKLKETLTKVGY
SCWMDIYQMGGGDSLYDKIDKGVRGCSLMILCVTPKYSESANCRRELSLC
DSIKKPLIPIMMERMVWPPEGPMSMILSQLVYISFVDTYEEQQTWNGQAT
QELLSKIQQIIRKPVNSKQNKTSKDIQSPSLPSAISENFTIEATHISSAS
NANTSNISLAKSKSC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
IPR000488Death_domain
IPR000157TIR_dom
IPR011029DEATH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 127..147
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 224..828