60S acidic ribosomal protein P0

Overview
Name60S acidic ribosomal protein P0
Smed IDSMED30027280
Length (bp)1010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S acidic ribosomal protein P0 (SMED30027280) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P0 (SMED30027280) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S acidic ribosomal protein P0 (SMED30027280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P0 (SMED30027280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027280

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027280SMESG000079482.1 SmedASXL_018683SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027280SMESG000079482.1 dd_Smed_v4_161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027280SMESG000079482.1 Contig39697uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027280SMESG000079482.1 Contig39697newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30027280SMESG000079482.1 dd_Smed_v6_161_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Human
Match: RPLP0 (ribosomal protein lateral stalk subunit P0 [Source:HGNC Symbol;Acc:HGNC:10371])

HSP 1 Score: 263.848 bits (673), Expect = 3.640e-86
Identity = 140/262 (53.44%), Postives = 179/262 (68.32%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH I N  K V+ L+V TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Human
Match: RPLP0 (ribosomal protein lateral stalk subunit P0 [Source:HGNC Symbol;Acc:HGNC:10371])

HSP 1 Score: 263.848 bits (673), Expect = 3.640e-86
Identity = 140/262 (53.44%), Postives = 179/262 (68.32%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH I N  K V+ L+V TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Human
Match: RPLP0 (ribosomal protein lateral stalk subunit P0 [Source:HGNC Symbol;Acc:HGNC:10371])

HSP 1 Score: 263.848 bits (673), Expect = 3.640e-86
Identity = 140/262 (53.44%), Postives = 179/262 (68.32%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH I N  K V+ L+V TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Human
Match: RPLP0 (ribosomal protein lateral stalk subunit P0 [Source:HGNC Symbol;Acc:HGNC:10371])

HSP 1 Score: 246.128 bits (627), Expect = 3.334e-80
Identity = 130/237 (54.85%), Postives = 165/237 (69.62%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIK 788
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH I N  K
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYK 246          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Human
Match: RPLP0 (ribosomal protein lateral stalk subunit P0 [Source:HGNC Symbol;Acc:HGNC:10371])

HSP 1 Score: 235.343 bits (599), Expect = 4.134e-76
Identity = 122/219 (55.71%), Postives = 157/219 (71.69%), Query Frame = 3
Query:  165 QLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDY 821
            Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH I N  K V+ L+V TDY
Sbjct:   19 QMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDY 237          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Celegans
Match: rla-0 (60S acidic ribosomal protein P0 [Source:UniProtKB/Swiss-Prot;Acc:Q93572])

HSP 1 Score: 280.411 bits (716), Expect = 3.583e-93
Identity = 135/262 (51.53%), Postives = 182/262 (69.47%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  KL   F +Y K  +V  DNV S+Q+Q +R+ +R  AEI++GKNTM++  +  +   NP L KL PH+  NVGFVFT  DL  ++  LL  +  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI RGTIEI+NDV LIK GD V  SES LL ML + PF YGL ++Q+Y++G+ Y+P+ LD+T +++ + F+   + VA+VSLA+N PTLAS+ H +AN ++ ++G+A VTD   KEA  IK ++ D
Sbjct:   10 KANYFTKLVELFEEYPKCLLVGVDNVGSKQMQEIRQAMRGHAEILMGKNTMIRKALRGHLGKNPSLEKLLPHIVENVGFVFTKEDLGEIRSKLLENRKGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKIARGTIEILNDVHLIKEGDKVGASESALLNMLGVTPFSYGLVVRQVYDDGTLYTPEVLDMTTEELRKRFLSGVRNVASVSLAVNYPTLASVAHSLANGLQNMLGVAAVTDVSFKEAETIKAFIAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Celegans
Match: F10E7.5 (Ribosome assembly factor mrt4 [Source:UniProtKB/TrEMBL;Acc:Q19302])

HSP 1 Score: 52.7582 bits (125), Expect = 6.540e-8
Identity = 42/184 (22.83%), Postives = 83/184 (45.11%), Query Frame = 3
Query:   84 NYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFF------QALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGL 611
            N   ++R    QY+ +FI    N+ S +   +R++ +  +    GKN ++   + K K+      L K    LKG  G +FTN     V+        +  A+   +A  +V++P+     GP     F      + L +PTK+ +G I +    ++ K G+ +   ++++L+  ++   Q+ L
Sbjct:   25 NLVNEVRASVDQYKNLFIFTIANMRSTRFIAIRQKYKENSRFFFGKNNVISIALGKQKSDEYANQLHKASAILKGQCGLMFTNMSKKEVEAEFSEASEEDYARVGDVATETVVLPE-----GPISQFAFSMEPQLRKLGLPTKLDKGVITLYQQFEVCKEGEPLTVEQAKILKHFEVKMSQFRL 203          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Celegans
Match: F10E7.5 (Ribosome assembly factor mrt4 [Source:UniProtKB/TrEMBL;Acc:Q19302])

HSP 1 Score: 52.7582 bits (125), Expect = 6.540e-8
Identity = 42/184 (22.83%), Postives = 83/184 (45.11%), Query Frame = 3
Query:   84 NYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFF------QALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGL 611
            N   ++R    QY+ +FI    N+ S +   +R++ +  +    GKN ++   + K K+      L K    LKG  G +FTN     V+        +  A+   +A  +V++P+     GP     F      + L +PTK+ +G I +    ++ K G+ +   ++++L+  ++   Q+ L
Sbjct:   25 NLVNEVRASVDQYKNLFIFTIANMRSTRFIAIRQKYKENSRFFFGKNNVISIALGKQKSDEYANQLHKASAILKGQCGLMFTNMSKKEVEAEFSEASEEDYARVGDVATETVVLPE-----GPISQFAFSMEPQLRKLGLPTKLDKGVITLYQQFEVCKEGEPLTVEQAKILKHFEVKMSQFRL 203          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Fly
Match: RpLP0 (gene:FBgn0000100 transcript:FBtr0334113)

HSP 1 Score: 286.574 bits (732), Expect = 2.065e-95
Identity = 140/262 (53.44%), Postives = 184/262 (70.23%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K  Y  K+   F ++ K FIV ADNV S+Q+QN+R  LR  A +++GKNTMM+  I  +  +NP L KL PH+KGNVGFVFT GDL  V+D LL  K++APA+  AIAP+ V++P Q T LGPEKTSFFQAL IPTKI++GTIEIINDV ++K GD V  SE+ LL ML I PF YGL + Q+Y++GS +SP+ LDI  +D+   F +    +AAV L++  PT+AS PH IAN  K ++ +A  T+ + KEA  IKEY+KD
Sbjct:   10 KAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIKD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Fly
Match: RpLP0 (gene:FBgn0000100 transcript:FBtr0078481)

HSP 1 Score: 286.574 bits (732), Expect = 2.065e-95
Identity = 140/262 (53.44%), Postives = 184/262 (70.23%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K  Y  K+   F ++ K FIV ADNV S+Q+QN+R  LR  A +++GKNTMM+  I  +  +NP L KL PH+KGNVGFVFT GDL  V+D LL  K++APA+  AIAP+ V++P Q T LGPEKTSFFQAL IPTKI++GTIEIINDV ++K GD V  SE+ LL ML I PF YGL + Q+Y++GS +SP+ LDI  +D+   F +    +AAV L++  PT+AS PH IAN  K ++ +A  T+ + KEA  IKEY+KD
Sbjct:   10 KAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIKD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Fly
Match: RpLP0-like (gene:FBgn0033485 transcript:FBtr0088425)

HSP 1 Score: 65.855 bits (159), Expect = 4.875e-12
Identity = 39/165 (23.64%), Postives = 85/165 (51.52%), Query Frame = 3
Query:   99 LRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVI--TKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQ-LTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQML 584
            +R    +Y  IF+    N+ +  L+++R+EL+  +  + GKN +M+  +  TK++   P+L KL   L G VG +FT+     V +   +      A++  +A  +V +P   L           ++L +PTK+ +G + + +D  + + G ++   ++++L+++
Sbjct:   30 IRFCVGKYPNIFVFQVQNMRNSLLKDLRQELKKNSRFIFGKNRVMQIGLGRTKSEEVEPELHKLSKRLTGQVGLLFTDKSKEEVLEWAENYWAVEYARSGFVATETVTLPAGPLEDFAHSMEPHLRSLGLPTKLEKGIVTLYSDYTVCEEGKVLTPEQARILKLV 194          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Zebrafish
Match: rplp0 (ribosomal protein, large, P0 [Source:NCBI gene;Acc:58101])

HSP 1 Score: 271.937 bits (694), Expect = 1.350e-89
Identity = 145/262 (55.34%), Postives = 179/262 (68.32%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L +L PH++GNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF YGL IQQ+Y+NGS YSP+ LDITED + + F+E  + +A+V L I  PTLASIPH I N  K V+ + V TDY    A  +K YL D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQTIRLSLRGKAVVLMGKNTMMRKAIRGHLENNPALERLLPHIRGNVGFVFTKEDLTEVRDLLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKPGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASIPHTIINGYKRVLAVTVETDYTFPLAEKVKAYLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Zebrafish
Match: rplp0 (ribosomal protein, large, P0 [Source:NCBI gene;Acc:58101])

HSP 1 Score: 149.443 bits (376), Expect = 6.021e-44
Identity = 82/146 (56.16%), Postives = 102/146 (69.86%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEII 515
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L +L PH++GNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI+
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQTIRLSLRGKAVVLMGKNTMMRKAIRGHLENNPALERLLPHIRGNVGFVFTKEDLTEVRDLLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEIL 155          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Zebrafish
Match: mrto4 (MRT4 homolog, ribosome maturation factor [Source:ZFIN;Acc:ZDB-GENE-050417-142])

HSP 1 Score: 62.3882 bits (150), Expect = 6.874e-11
Identity = 49/210 (23.33%), Postives = 100/210 (47.62%), Query Frame = 3
Query:   60 KMVIQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTS-FFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDD 680
            K  ++ K N  E+LR     Y  +F+ + +N+ + +L+++R   +  +    GKN +M   + K        +L KL   L+G VG +FTN   + V++   + K    A+A   A ++V + +      P       + L +PT + +G + +I D ++ K GD +   ++++L++      ++ L I+ ++ + S       D  +DD
Sbjct:   17 KKGLEAKQNLIEELRKCADIYRYVFVFSVENMRNNKLKDIRTAWKH-SRFFFGKNKVMMIALGKGPTDEYKDNLHKLSRFLRGEVGVLFTNKTKDEVQEYFGNFKEVDYARAGNTASMAVTLDEGPLDQFPHSMEPQLRQLGLPTALKKGVVTLIKDFEVCKEGDTLTPEQARILKLFGFEMAEFKLSIKCMWNSESGEFEKLTDGDDDD 225          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Xenopus
Match: septin3 (septin 3 [Source:Xenbase;Acc:XB-GENE-1002286])

HSP 1 Score: 278.485 bits (711), Expect = 5.166e-92
Identity = 143/262 (54.58%), Postives = 179/262 (68.32%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL  H+KGNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V+VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF YGL IQQ+Y+NGS YSP+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH + N  K V+ +AV TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLSHIKGNVGFVFTKEDLTEVRDMLLANKVPACARAGAIAPCGVVVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Xenopus
Match: septin3 (septin 3 [Source:Xenbase;Acc:XB-GENE-1002286])

HSP 1 Score: 231.876 bits (590), Expect = 4.601e-74
Identity = 128/262 (48.85%), Postives = 160/262 (61.07%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L K                     K I L   + A A+A AIAP  V+VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF YGL IQQ+Y+NGS YSP+ LDITE+ +   F+E  + VA+V L I  PT+AS+PH + N  K V+ +AV TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEK---------------------KIIFLVMWVPACARAGAIAPCGVVVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLAD 250          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Xenopus
Match: septin3 (septin 3 [Source:Xenbase;Acc:XB-GENE-1002286])

HSP 1 Score: 162.925 bits (411), Expect = 8.829e-48
Identity = 83/147 (56.46%), Postives = 102/147 (69.39%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIIN 518
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL  H+KGNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V+VP Q T LGPEKTSFFQAL I TKI+RGTIEI+ 
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLSHIKGNVGFVFTKEDLTEVRDMLLANKVPACARAGAIAPCGVVVPAQNTGLGPEKTSFFQALGITTKISRGTIEILG 156          

HSP 2 Score: 51.6026 bits (122), Expect = 6.008e-7
Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  657 ALDITEDDILRGFME--STQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            AL IT   I RG +E    + VA+V L I  PT+AS+PH + N  K V+ +AV TDY    A  +K +L D
Sbjct:  140 ALGITTK-ISRGTIEILGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVETDYSFPLADKVKAFLAD 209          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Mouse
Match: Rplp0 (ribosomal protein, large, P0 [Source:MGI Symbol;Acc:MGI:1927636])

HSP 1 Score: 258.84 bits (660), Expect = 1.664e-84
Identity = 138/262 (52.67%), Postives = 177/262 (67.56%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE  +   F+E  + VA+V L I  PT+AS+PH I N  K V+ L+V T+Y       +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQALHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETEYTFPLTEKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Mouse
Match: Rplp0 (ribosomal protein, large, P0 [Source:MGI Symbol;Acc:MGI:1927636])

HSP 1 Score: 229.95 bits (585), Expect = 2.165e-74
Identity = 120/218 (55.05%), Postives = 155/218 (71.10%), Query Frame = 3
Query:  168 LQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDY 821
            +Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+++NGS Y+P+ LDITE  +   F+E  + VA+V L I  PT+AS+PH I N  K V+ L+V T+Y
Sbjct:    1 MQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQALHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETEY 218          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Mouse
Match: Rplp0 (ribosomal protein, large, P0 [Source:MGI Symbol;Acc:MGI:1927636])

HSP 1 Score: 132.88 bits (333), Expect = 1.018e-37
Identity = 74/136 (54.41%), Postives = 92/136 (67.65%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPT 485
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  ++D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I T
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT 145          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Mouse
Match: Mrto4 (mRNA turnover 4, ribosome maturation factor [Source:MGI Symbol;Acc:MGI:1917152])

HSP 1 Score: 56.9954 bits (136), Expect = 5.114e-9
Identity = 39/175 (22.29%), Postives = 87/175 (49.71%), Query Frame = 3
Query:   69 IQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMV-PKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQML 584
            ++ K N  E+LR     Y+ +FI +  N+ + +L+++R   + +  +  GKN +M   + ++ +     +L ++   L+G VG +FTN     V +          A+A   A ++V + P  L           + L +PT + +G + +++D ++ K GD++   ++++L++ 
Sbjct:   20 LELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHS-RMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEPQLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARILKLF 193          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Mouse
Match: Mrto4 (mRNA turnover 4, ribosome maturation factor [Source:MGI Symbol;Acc:MGI:1917152])

HSP 1 Score: 55.8398 bits (133), Expect = 1.417e-8
Identity = 39/172 (22.67%), Postives = 85/172 (49.42%), Query Frame = 3
Query:   69 IQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMV-PKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLL 575
            ++ K N  E+LR     Y+ +FI +  N+ + +L+++R   + +  +  GKN +M   + ++ +     +L ++   L+G VG +FTN     V +          A+A   A ++V + P  L           + L +PT + +G + +++D ++ K GD++   ++++L
Sbjct:   20 LELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHS-RMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEPQLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARIL 190          
BLAST of 60S acidic ribosomal protein P0 vs. UniProt/SwissProt
Match: sp|P19889|RLA0_DROME (60S acidic ribosomal protein P0 OS=Drosophila melanogaster OX=7227 GN=RpLP0 PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.070e-94
Identity = 140/262 (53.44%), Postives = 184/262 (70.23%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K  Y  K+   F ++ K FIV ADNV S+Q+QN+R  LR  A +++GKNTMM+  I  +  +NP L KL PH+KGNVGFVFT GDL  V+D LL  K++APA+  AIAP+ V++P Q T LGPEKTSFFQAL IPTKI++GTIEIINDV ++K GD V  SE+ LL ML I PF YGL + Q+Y++GS +SP+ LDI  +D+   F +    +AAV L++  PT+AS PH IAN  K ++ +A  T+ + KEA  IKEY+KD
Sbjct:   10 KAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIKD 271          
BLAST of 60S acidic ribosomal protein P0 vs. UniProt/SwissProt
Match: sp|Q9U3U0|RLA0_CERCA (60S acidic ribosomal protein P0 OS=Ceratitis capitata OX=7213 GN=RpLP0 PE=3 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.466e-93
Identity = 142/262 (54.20%), Postives = 183/262 (69.85%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K  Y  K+   F +Y K FIV ADNV S+Q+QN+R  LR    +++GKNTMM+  I  +  +N  L KL PH+KGNVGFVFT GDL  V+D LL  K++APA+A AIAP+ V++P Q T LGPEKTSFFQAL IPTKI++GTIEIINDV ++K GD V  SE+ LL ML I PF YGL I Q+Y++GS +SP+ LDI  +D+   F      +AAVSL I  PT+AS PH IAN  K ++ +A  T+ + K+AA IKE++KD
Sbjct:   10 KAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMMRKAIRGHLENNAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPLPVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLAITQVYDSGSIFSPEILDIKPEDLRAKFQAGVANLAAVSLQIGYPTIASAPHSIANGFKNLLAIAASTEVEFKQAATIKEFIKD 271          
BLAST of 60S acidic ribosomal protein P0 vs. UniProt/SwissProt
Match: sp|Q93572|RLA0_CAEEL (60S acidic ribosomal protein P0 OS=Caenorhabditis elegans OX=6239 GN=rla-0 PE=1 SV=3)

HSP 1 Score: 280.411 bits (716), Expect = 4.557e-92
Identity = 135/262 (51.53%), Postives = 182/262 (69.47%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  KL   F +Y K  +V  DNV S+Q+Q +R+ +R  AEI++GKNTM++  +  +   NP L KL PH+  NVGFVFT  DL  ++  LL  +  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI RGTIEI+NDV LIK GD V  SES LL ML + PF YGL ++Q+Y++G+ Y+P+ LD+T +++ + F+   + VA+VSLA+N PTLAS+ H +AN ++ ++G+A VTD   KEA  IK ++ D
Sbjct:   10 KANYFTKLVELFEEYPKCLLVGVDNVGSKQMQEIRQAMRGHAEILMGKNTMIRKALRGHLGKNPSLEKLLPHIVENVGFVFTKEDLGEIRSKLLENRKGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKIARGTIEILNDVHLIKEGDKVGASESALLNMLGVTPFSYGLVVRQVYDDGTLYTPEVLDMTTEELRKRFLSGVRNVASVSLAVNYPTLASVAHSLANGLQNMLGVAAVTDVSFKEAETIKAFIAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. UniProt/SwissProt
Match: sp|Q9DG68|RLA0_LITSY (60S acidic ribosomal protein P0 OS=Lithobates sylvaticus OX=45438 GN=RPLP0 PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.251e-91
Identity = 143/262 (54.58%), Postives = 178/262 (67.94%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +N  L KL PH+KGNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIK GD V  SE+ LL ML I PF +GL IQQ+Y+NGS YSP+ LDITED +   F+E  + +A+V L I  PT+AS+PH + N  K V+ LAV TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNSALEKLLPHIKGNVGFVFTKEDLAEVRDMLLANKVPASARAGAIAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVYDNGSIYSPEVLDITEDALRARFLEGVRNIASVCLQIGYPTVASVPHSVVNGYKRVLALAVETDYSFPLADKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. UniProt/SwissProt
Match: sp|Q90YX1|RLA0_ICTPU (60S acidic ribosomal protein P0 OS=Ictalurus punctatus OX=7998 GN=rplp0 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.750e-88
Identity = 145/262 (55.34%), Postives = 180/262 (68.70%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LI+ GD V  SE+ LL ML I PF YGL IQQ+Y+NGS YSP+ LDITED + + F+E  + +A+V L I  PTLASIPH I N  K V+ +AV TDY    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLNDYPKCFIVGADNVGSKQMQTIRLSLRGKAIVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLPEVRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIRPGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASIPHSIINGYKRVLRVAVETDYSFPMADKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. TrEMBL
Match: A0A0R3S1N2 (60S acidic ribosomal protein P0 OS=Elaeophora elaphi OX=1147741 PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 2.797e-98
Identity = 147/262 (56.11%), Postives = 190/262 (72.52%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+     +Y K FIV  DNV S+Q+Q +R+ +R  A+I++GKNTM++  I  +  +NPDL KL PH+ GNVGFVFTNGDL+ ++  LL  +  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI+RGTIEI+N+V LIK G+ V  SES LL ML I PF YGL ++Q+YENG+ ++P+ LD+T DDI   FM+  Q VAA+SLAI  PTLAS+PH IAN +K ++ +AV  + ++KEA  IKEYL D
Sbjct:   10 KANYFVKIVELLEEYPKCFIVGVDNVGSKQMQEIRQAMRGHADILMGKNTMIRKAIRGHLQTNPDLEKLLPHIVGNVGFVFTNGDLSEIRAKLLENRRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLIKTGEKVGASESALLNMLNIMPFSYGLVVRQVYENGTVFAPEVLDMTPDDIRAKFMKGVQNVAAISLAIGYPTLASVPHSIANALKNLLAIAVEANVEMKEAEKIKEYLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. TrEMBL
Match: A0A1I8EZV8 (60S acidic ribosomal protein P0 OS=Wuchereria bancrofti OX=6293 PE=3 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.327e-97
Identity = 147/262 (56.11%), Postives = 188/262 (71.76%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+     +Y K FIV  DNV S+Q+Q +R+ +R  A+I++GKNTM++  I  +  +NPDL KL PH+ GNVGFVFTNGDL+ ++  LL  +  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI+RGTIEI+N+V LIK G+ V  SES LL ML I PF YGL ++Q+YENG+ ++P+ LD+T DDI   F++  Q VAAVSLAI  PTLAS+PH IAN  K ++ +AV    ++KEA  IKEYL D
Sbjct:   10 KANYFVKIVELLEEYPKCFIVGVDNVGSKQMQEIRQAMRGHADILMGKNTMIRKAIRGHLQTNPDLEKLLPHIVGNVGFVFTNGDLSEIRAKLLENRRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLIKTGEKVGASESALLNMLNIMPFSYGLVVRQVYENGTVFAPEVLDMTPDDIRAKFLKGVQNVAAVSLAIGHPTLASVPHSIANAFKNLLAIAVEASIEMKEAEKIKEYLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. TrEMBL
Match: A0A4E9EYX5 (60S acidic ribosomal protein P0 OS=Brugia malayi OX=6279 GN=Bma-rla-0 PE=3 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.327e-97
Identity = 147/262 (56.11%), Postives = 189/262 (72.14%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+     +Y K FIV  DNV S+Q+Q +R+ +R  A+I++GKNTM++  I  +  +NPDL KL PH+ GNVGFVFTNGDL+ ++  LL  +  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI+RGTIEI+N+V LIK G+ V  SES LL ML I PF YGL ++Q+YENG+ ++P+ LD+T DDI   F++  Q VAAVSLAI  PTLASIPH IAN  K ++ +AV  + ++KEA  IKE+L D
Sbjct:   10 KANYFVKIVELLEEYPKCFIVGVDNVGSKQMQEIRQAMRGHADILMGKNTMIRKAIRGHLQTNPDLEKLLPHIVGNVGFVFTNGDLSEIRAKLLENRRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLIKTGEKVGASESALLNMLNIMPFSYGLVVRQVYENGTVFAPEVLDMTPDDIRAKFLKGVQNVAAVSLAIGHPTLASIPHSIANAFKNLLAIAVEANIEMKEAEKIKEFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. TrEMBL
Match: A0A0K0IYX6 (60S acidic ribosomal protein P0 OS=Brugia malayi OX=6279 GN=bma-rla-0 PE=3 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.327e-97
Identity = 147/262 (56.11%), Postives = 189/262 (72.14%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+     +Y K FIV  DNV S+Q+Q +R+ +R  A+I++GKNTM++  I  +  +NPDL KL PH+ GNVGFVFTNGDL+ ++  LL  +  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI+RGTIEI+N+V LIK G+ V  SES LL ML I PF YGL ++Q+YENG+ ++P+ LD+T DDI   F++  Q VAAVSLAI  PTLASIPH IAN  K ++ +AV  + ++KEA  IKE+L D
Sbjct:   10 KANYFVKIVELLEEYPKCFIVGVDNVGSKQMQEIRQAMRGHADILMGKNTMIRKAIRGHLQTNPDLEKLLPHIVGNVGFVFTNGDLSEIRAKLLENRRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLIKTGEKVGASESALLNMLNIMPFSYGLVVRQVYENGTVFAPEVLDMTPDDIRAKFLKGVQNVAAVSLAIGHPTLASIPHSIANAFKNLLAIAVEANIEMKEAEKIKEFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. TrEMBL
Match: A0A1I8AJV9 (60S acidic ribosomal protein P0 OS=Steinernema glaseri OX=37863 PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 9.403e-97
Identity = 165/306 (53.92%), Postives = 208/306 (67.97%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKDXXXXXXXXXXXXXXXXXXXXXQQEAAKXXXXXXXXXDIGMGLFD 995
            K NY  ++   F +Y K  IV  DNV S+Q+Q +R  +R TAEI++GKNTM++  I  +  +NPDL KL PH+ GNVGFVFT  DL+ V++ LL+ K  APAKA AIAP  V +P Q T +GPEKTSFFQALQIPTKI+RGTIEI+N+V LIK G+ V  SE+ LL ML I PF YGL +QQ+Y+NG+ YSP  LD+T D++   F++  + VAA+SLA+N PTLAS PHIIAN  K ++ +A  TD   KEA  +KEYL DP+KFA A    A   A A P     AK        SDIG+GLFD
Sbjct:   10 KANYFVRIVELFEEYPKCLIVGVDNVGSKQMQEIRANMRGTAEILMGKNTMIRKAIRGHLQNNPDLEKLLPHIVGNVGFVFTKEDLSEVRNTLLANKRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLIKEGEKVGASEAALLNMLNIQPFSYGLAVQQVYDNGTVYSPAVLDLTTDELRTRFLQGVRNVAALSLAVNYPTLASAPHIIANGFKKLMAIAAETDVSFKEAERVKEYLADPSKFAVAAAPAAAAPAAAAPAAAAPAK--EESESDSDIGLGLFD 313          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Cavefish
Match: rplp0 (ribosomal protein, large, P0 [Source:NCBI gene;Acc:58101])

HSP 1 Score: 263.077 bits (671), Expect = 2.015e-86
Identity = 141/257 (54.86%), Postives = 176/257 (68.48%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIK 848
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL PH++GNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI+++V LIK GD V  SE+ LL ML I PF YGL IQQ+Y+NGS YSP+ LDITED + + F+E  + +A+V L I  PTLASIPH + N  K V+ +AV TD     A  +K
Sbjct:   10 KSNYFLKIIQLLNDYPKCFIVGADNVGSKQMQTIRLSLRGKAVVLMGKNTMMRKAIRGHLENNPSLEKLLPHIRGNVGFVFTKEDLTEVRDLLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSNVQLIKPGDKVGASEATLLNMLNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASIPHSVINGYKRVLAVAVETDISFPLADKVK 266          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Cavefish
Match: mrto4 (MRT4 homolog, ribosome maturation factor [Source:NCBI gene;Acc:103032884])

HSP 1 Score: 63.5438 bits (153), Expect = 2.355e-11
Identity = 50/211 (23.70%), Postives = 104/211 (49.29%), Query Frame = 3
Query:   69 IQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVP----KQLT-TLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDD 680
            ++ K N  E+LR     Y  +FI + +N+ + +L+++R   + +     GKN +M   + K        +L ++   L+G VG +FTN     V++   S K    A++  +A ++V +     +Q T ++ P+     + L +PT + +G + +I D ++ K GD +   ++++L++      ++ L I+ ++ N      + LD  E D
Sbjct:   20 LEAKQNLIEELRKCVDTYRYVFIFSVENMRNNKLKDIRAAWKHS-RFFFGKNKVMMIALGKGPTDEYKDNLHRVSKFLRGEVGVLFTNKTKEEVQEYFNSFKEVDYARSGNVAQMAVTLDEGPLEQFTHSMEPQ----LRQLGLPTALKKGVVTLIKDYEVCKEGDTLTPEQARILKLFGFEMAEFKLSIKCMW-NSESGDFEMLDGDEGD 224          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Cavefish
Match: mrto4 (MRT4 homolog, ribosome maturation factor [Source:NCBI gene;Acc:103032884])

HSP 1 Score: 63.5438 bits (153), Expect = 2.410e-11
Identity = 50/211 (23.70%), Postives = 104/211 (49.29%), Query Frame = 3
Query:   69 IQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVP----KQLT-TLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDD 680
            ++ K N  E+LR     Y  +FI + +N+ + +L+++R   + +     GKN +M   + K        +L ++   L+G VG +FTN     V++   S K    A++  +A ++V +     +Q T ++ P+     + L +PT + +G + +I D ++ K GD +   ++++L++      ++ L I+ ++ N      + LD  E D
Sbjct:   26 LEAKQNLIEELRKCVDTYRYVFIFSVENMRNNKLKDIRAAWKHS-RFFFGKNKVMMIALGKGPTDEYKDNLHRVSKFLRGEVGVLFTNKTKEEVQEYFNSFKEVDYARSGNVAQMAVTLDEGPLEQFTHSMEPQ----LRQLGLPTALKKGVVTLIKDYEVCKEGDTLTPEQARILKLFGFEMAEFKLSIKCMW-NSESGDFEMLDGDEGD 230          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Sea Lamprey
Match: rplp0 (ribosomal protein, large, P0 [Source:NCBI gene;Acc:58101])

HSP 1 Score: 279.641 bits (714), Expect = 2.220e-93
Identity = 140/262 (53.44%), Postives = 180/262 (68.70%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      + K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +   NP L ++ P+++GNVGFVFT  DL  ++D+LL+ K+ A A+A  +AP  VMVP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LIKAGD V  SE+ LL ML I PF +GL I Q+Y+NGS YSPD LDITEDD+ + F+E  + VA+V L I  PT+ASIPH I N  K V+ +AV T+Y    A  +K +L D
Sbjct:   10 KSNYFLKIIQLLEDFPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLEKNPALERVLPYIRGNVGFVFTKEDLAEIRDMLLANKVPASARAGGLAPCDVMVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKAGDKVGASEATLLNMLNISPFTFGLHILQVYDNGSIYSPDVLDITEDDLRKRFLEGVRNVASVCLQIGYPTVASIPHSIVNGYKRVLAIAVETNYSFPLADKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Sea Lamprey
Match: rplp0 (ribosomal protein, large, P0 [Source:NCBI gene;Acc:58101])

HSP 1 Score: 126.331 bits (316), Expect = 7.492e-36
Identity = 63/116 (54.31%), Postives = 79/116 (68.10%), Query Frame = 3
Query:  516 NDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            +DV LIKAGD V  SE+ LL ML I PF +GL I Q+Y+NGS YSPD LDITEDD+ + F+E  + VA+V L I  PT+ASIPH I N  K V+ +AV T+Y    A  +K +L D
Sbjct:    3 SDVQLIKAGDKVGASEATLLNMLNISPFTFGLHILQVYDNGSIYSPDVLDITEDDLRKRFLEGVRNVASVCLQIGYPTVASIPHSIVNGYKRVLAIAVETNYSFPLADKVKAFLAD 118          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Yeast
Match: RPP0 (Conserved ribosomal protein P0 of the ribosomal stalk; involved in interaction between translational elongation factors and the ribosome; phosphorylated on serine 302; homologous to mammalian ribosomal protein LP0 and bacterial L10 [Source:SGD;Acc:S000004332])

HSP 1 Score: 220.32 bits (560), Expect = 1.879e-70
Identity = 116/264 (43.94%), Postives = 174/264 (65.91%), Query Frame = 3
Query:   72 QKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            +KK  Y  KLR    +Y+ +F+V  DNVSSQQ+  VRKELR  A +++GKNTM++  I    +  PD  KL P +KGNVGFVFTN  L  +K++++S ++ APA+A A+AP  + V    T + P KTSFFQAL +PTKI RGTIEI++DV ++ AG+ V QSE+ LL +L I PF +GL + Q+Y+NG  +    LDIT+++++  F+ +   +A++SLAI  PTL S+ H + N  K ++ +A+   Y   E  D+ + +++
Sbjct:    6 EKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISPFTFGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIASISLAIGYPTLPSVGHTLINNYKDLLAVAIAASYHYPEIEDLVDRIEN 269          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Yeast
Match: YLR339C_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; partially overlaps the essential gene RPP0 [Source:SGD;Acc:S000004331])

HSP 1 Score: 69.3218 bits (168), Expect = 1.356e-14
Identity = 59/138 (42.75%), Postives = 70/138 (50.72%), Query Frame = -2
Query:   92 IVPRVILVGICKAWKNEVFSGPNVVSCLGTITLTXXXXXXXXXXXXX*ERRISFTPLRSPFVKTKPTLPFKCGNNFNKSGFDALFFVMTNFIIVFLPNTISAVLLNSFRTFCNC*LDTLSAFTMNIFSYWANLVLNFS 505
            +VP  ILVG  KAWK EV  G   V    T   +GA A A AGA    E       +    VKTKPTLP   GNNF+KSG      +M    +VFLP   +A+ LNSF T C C  +TLS  T N   Y +   LN +
Sbjct:    1 MVPLAILVGTPKAWKKEVLPGSIPVLTALTQMSSGATAPALAGAATLLETITFLISVNGSLVKTKPTLPLTKGNNFSKSGKSDKKPLMALLTMVFLPIKTTALPLNSFLTSCICWEETLSTPTTNKDLYSSKYSLNLA 138          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Yeast
Match: MRT4 (Protein involved in mRNA turnover and ribosome assembly; required at post-transcriptional step for efficient retrotransposition; localizes to the nucleolus [Source:SGD;Acc:S000001492])

HSP 1 Score: 50.447 bits (119), Expect = 8.631e-8
Identity = 41/202 (20.30%), Postives = 94/202 (46.53%), Query Frame = 3
Query:   93 EKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPK-----------------QLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGS 641
            +++R     Y  +++++ D+V +  LQ +R    + +++++GK  +++  + + +      +L +L     G  G +FT+ D+N VK+   S      ++ +  AP++  +P+                  + +L P   + F+   IPTKI  G I I +   +   G+ +   ++ +L+   I   ++ +K+   Y+N S
Sbjct:   28 DEVREALDTYRYVWVLHLDDVRTPVLQEIRTSW-AGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGLLFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAEEDVPMIHSLEPTMRNKFE---IPTKIKAGKITIDSPYLVCTEGEKLDVRQALILKQFGIAASEFKVKVSAYYDNDS 225          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Nematostella
Match: EDO34194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ36])

HSP 1 Score: 275.404 bits (703), Expect = 1.427e-91
Identity = 139/262 (53.05%), Postives = 174/262 (66.41%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+     +Y K+F+V  DNV S+Q+Q +R+ LR   E+++GKNTM++  I  +  +NPDL KL PH+KGN+GFVFT  DL  V+ I++  K+ APAKA  IAP+ V VP   T LGPEKTSFFQAL IPTKI RGTIEIINDV LIK  + V  SES LL MLKI PF YGL+I Q+YE+GS Y P  LDIT DDIL  F      VA+V L I  PT+ S+PH I N  K +  +AV TD +  +   +K +L D
Sbjct:   10 KSNYFLKIIQYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKLLPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFFQALAIPTKIARGTIEIINDVHLIKKDEKVGASESTLLNMLKISPFSYGLQICQVYESGSVYDPSVLDITNDDILARFRMGIANVASVCLEIGYPTVVSVPHSIINGFKNIAAVAVETDIEFPQVEKLKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Nematostella
Match: EDO30123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1P1])

HSP 1 Score: 47.3654 bits (111), Expect = 2.410e-6
Identity = 32/159 (20.13%), Postives = 73/159 (45.91%), Query Frame = 3
Query:  117 QYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASN--PDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTS-FFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQML 584
            +Y  +++ + +N+ + +L++ R++ + +     GKN +M   + K        +L ++   LKG  G +FTN   + V            A+A   A     +        P  T    + L +PT + +G + +++D  + K GD++   ++++L++ 
Sbjct:   36 EYAFVYVFSVENMRNSKLKDAREKWKQS-RFFFGKNKVMAIALGKTPEDEYKENLCEVSKRLKGQCGLLFTNQSKDDVTSWFKEYSEMDFARAGNKAICDFQLDAGPLDQFPHSTEPNLRQLGLPTALKKGVVTLLSDHTVCKEGDVLTPEQARILKLF 193          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Medaka
Match: rplp0 (ribosomal protein lateral stalk subunit P0 [Source:NCBI gene;Acc:101155762])

HSP 1 Score: 266.159 bits (679), Expect = 1.853e-87
Identity = 143/262 (54.58%), Postives = 179/262 (68.32%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL  H+KGNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LI+ GD V  SE+ LL ML I PF +GL IQQ+Y+NGS YSP+ LDITE  +   F+E  + +A+VSL I  PTLASIPH + N  K V+ +AV TDY   +A  +K +L D
Sbjct:   10 KSNYFIKIIQLLDDYPKCFIVGADNVGSKQMQTIRLSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLTHIKGNVGFVFTKEDLTEVRDLLLANKVPAAARAGAIAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIRTGDKVGASEATLLNMLNISPFSFGLIIQQVYDNGSVYSPEVLDITEASLQARFLEGVRNIASVSLEIGYPTLASIPHSVINGYKRVLAVAVETDYTFPQAEKVKAFLAD 271          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Medaka
Match: rplp0 (ribosomal protein lateral stalk subunit P0 [Source:NCBI gene;Acc:101155762])

HSP 1 Score: 228.794 bits (582), Expect = 4.127e-73
Identity = 129/262 (49.24%), Postives = 164/262 (62.60%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL  H+KGNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI++DV LI+ GD                        +Q+Y+NGS YSP+ LDITE  +   F+E  + +A+VSL I  PTLASIPH + N  K V+ +AV TDY   +A  +K +L D
Sbjct:   10 KSNYFIKIIQLLDDYPKCFIVGADNVGSKQMQTIRLSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLTHIKGNVGFVFTKEDLTEVRDLLLANKVPAAARAGAIAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIRTGD------------------------KQVYDNGSVYSPEVLDITEASLQARFLEGVRNIASVSLEIGYPTLASIPHSVINGYKRVLAVAVETDYTFPQAEKVKAFLAD 247          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Medaka
Match: rplp0 (ribosomal protein lateral stalk subunit P0 [Source:NCBI gene;Acc:101155762])

HSP 1 Score: 147.132 bits (370), Expect = 6.001e-42
Identity = 83/147 (56.46%), Postives = 101/147 (68.71%), Query Frame = 3
Query:   78 KINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIIN 518
            K NY  K+      Y K FIV ADNV S+Q+Q +R  LR  A +++GKNTMM+  I  +  +NP L KL  H+KGNVGFVFT  DL  V+D+LL+ K+ A A+A AIAP  V VP Q T LGPEKTSFFQAL I TKI+RGTIEI+ 
Sbjct:   10 KSNYFIKIIQLLDDYPKCFIVGADNVGSKQMQTIRLSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLTHIKGNVGFVFTKEDLTEVRDLLLANKVPAAARAGAIAPCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILG 156          

HSP 2 Score: 55.8398 bits (133), Expect = 1.145e-8
Identity = 33/71 (46.48%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  657 ALDITEDDILRGFME--STQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKD 863
            AL IT   I RG +E    + +A+VSL I  PTLASIPH + N  K V+ +AV TDY   +A  +K +L D
Sbjct:  140 ALGITTK-ISRGTIEILGVRNIASVSLEIGYPTLASIPHSVINGYKRVLAVAVETDYTFPQAEKVKAFLAD 209          
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Medaka
Match: mrto4 (MRT4 homolog, ribosome maturation factor [Source:NCBI gene;Acc:101175392])

HSP 1 Score: 59.3066 bits (142), Expect = 6.518e-10
Identity = 47/193 (24.35%), Postives = 95/193 (49.22%), Query Frame = 3
Query:   69 IQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPD-----LLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTS-FFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIY 629
            ++ K    E+LR     Y  +FI + +N+ + +L+++R   +  +    GKN +M  ++   K S PD     L K+   L+G VG +FTN   + V +     K    A+A   A + V + +      P       + L +PT + +G + ++ D ++ K GDI+   ++++L++  I   ++ +KI+ ++
Sbjct:   20 LESKQKLIEELRKCVDTYRNLFIFSVENMRNNKLKDIRTAWKH-SRFFFGKNKVM--IVALGKGS-PDEYKDNLHKVSKFLRGEVGVLFTNKTKDEVYEYFSHFKEMDFARAGNQAQMDVTLDEGPLEQFPHSMEPQLRQLGLPTALKKGVVTLLKDYEVCKEGDILTPEQARILKLFAIEMAEFKVKIKCMW 208          
BLAST of 60S acidic ribosomal protein P0 vs. Planmine SMEST
Match: SMESG000079482.1 (SMESG000079482.1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 311/311 (100.00%), Query Frame = 3
Query:   63 MVIQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKDXXXXXXXXXXXXXXXXXXXXXQQEAAKXXXXXXXXXDIGMGLFD 995
            MVIQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSE+QLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKDPTKFATATVAVATTAAPAKPVQQEAAKEESSESEGSDIGMGLFD
Sbjct:    1 MVIQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSEAQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKDPTKFATATVAVATTAAPAKPVQQEAAKEESSESEGSDIGMGLFD 311          
BLAST of 60S acidic ribosomal protein P0 vs. Planmine SMEST
Match: SMESG000049529.1 (SMESG000049529.1)

HSP 1 Score: 459.529 bits (1181), Expect = 9.299e-164
Identity = 238/314 (75.80%), Postives = 273/314 (86.94%), Query Frame = 3
Query:   63 MVIQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIVLGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLSQKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDALDITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVVTDYDLKEAADIKEYLKDXXXXXXXXXXXXXXXXXXXXXQQEAAKXXXXXXXX---XDIGMGLFD 995
            MV+QKKI+YA KL+TKF QY KIFIVNADNV+SQQ+QN+RK LR  AEIVLGKNT+MKFVI KNK S P+ +KLFPHLKGNVGFVFTNGDLN VKDI+L+QKIQAPAKADA+APVSV VPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIK GDIVKQSE+QLLQMLKI+PFQYGLKIQQIYENGSCYSP+ALDI+E+DI++GFME  QKVAAVSL++N+PTLAS+PH+IANTIK++I L+V ++Y++KEA  IKEYL DP+KFA A V  +     A+   +EAAK  SS       SDIGMGLFD
Sbjct:    1 MVLQKKIDYAAKLKTKFEQYHKIFIVNADNVASQQMQNIRKLLRGQAEIVLGKNTLMKFVINKNKLSAPEFVKLFPHLKGNVGFVFTNGDLNEVKDIILAQKIQAPAKADALAPVSVQVPKQLTTLGPEKTSFFQALQIPTKITRGTIEIINDVDLIKEGDIVKQSEAQLLQMLKIYPFQYGLKIQQIYENGSCYSPEALDISEEDIMKGFMEGVQKVAAVSLSLNRPTLASVPHLIANTIKSMIALSVESEYNMKEAEGIKEYLADPSKFAAAIVVTSPVEVKAEV--KEAAKVASSSESEEEGSDIGMGLFD 312          
The following BLAST results are available for this feature:
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPLP03.640e-8653.44ribosomal protein lateral stalk subunit P0 [Source... [more]
RPLP03.640e-8653.44ribosomal protein lateral stalk subunit P0 [Source... [more]
RPLP03.640e-8653.44ribosomal protein lateral stalk subunit P0 [Source... [more]
RPLP03.334e-8054.85ribosomal protein lateral stalk subunit P0 [Source... [more]
RPLP04.134e-7655.71ribosomal protein lateral stalk subunit P0 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rla-03.583e-9351.5360S acidic ribosomal protein P0 [Source:UniProtKB... [more]
F10E7.56.540e-822.83Ribosome assembly factor mrt4 [Source:UniProtKB/T... [more]
F10E7.56.540e-822.83Ribosome assembly factor mrt4 [Source:UniProtKB/T... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpLP02.065e-9553.44gene:FBgn0000100 transcript:FBtr0334113[more]
RpLP02.065e-9553.44gene:FBgn0000100 transcript:FBtr0078481[more]
RpLP0-like4.875e-1223.64gene:FBgn0033485 transcript:FBtr0088425[more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rplp01.350e-8955.34ribosomal protein, large, P0 [Source:NCBI gene;Acc... [more]
rplp06.021e-4456.16ribosomal protein, large, P0 [Source:NCBI gene;Acc... [more]
mrto46.874e-1123.33MRT4 homolog, ribosome maturation factor [Source:Z... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
septin35.166e-9254.58septin 3 [Source:Xenbase;Acc:XB-GENE-1002286][more]
septin34.601e-7448.85septin 3 [Source:Xenbase;Acc:XB-GENE-1002286][more]
septin38.829e-4856.46septin 3 [Source:Xenbase;Acc:XB-GENE-1002286][more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rplp01.664e-8452.67ribosomal protein, large, P0 [Source:MGI Symbol;Ac... [more]
Rplp02.165e-7455.05ribosomal protein, large, P0 [Source:MGI Symbol;Ac... [more]
Rplp01.018e-3754.41ribosomal protein, large, P0 [Source:MGI Symbol;Ac... [more]
Mrto45.114e-922.29mRNA turnover 4, ribosome maturation factor [Sourc... [more]
Mrto41.417e-822.67mRNA turnover 4, ribosome maturation factor [Sourc... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19889|RLA0_DROME2.070e-9453.4460S acidic ribosomal protein P0 OS=Drosophila mela... [more]
sp|Q9U3U0|RLA0_CERCA1.466e-9354.2060S acidic ribosomal protein P0 OS=Ceratitis capit... [more]
sp|Q93572|RLA0_CAEEL4.557e-9251.5360S acidic ribosomal protein P0 OS=Caenorhabditis ... [more]
sp|Q9DG68|RLA0_LITSY1.251e-9154.5860S acidic ribosomal protein P0 OS=Lithobates sylv... [more]
sp|Q90YX1|RLA0_ICTPU3.750e-8855.3460S acidic ribosomal protein P0 OS=Ictalurus punct... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3S1N22.797e-9856.1160S acidic ribosomal protein P0 OS=Elaeophora elap... [more]
A0A1I8EZV81.327e-9756.1160S acidic ribosomal protein P0 OS=Wuchereria banc... [more]
A0A4E9EYX51.327e-9756.1160S acidic ribosomal protein P0 OS=Brugia malayi O... [more]
A0A0K0IYX61.327e-9756.1160S acidic ribosomal protein P0 OS=Brugia malayi O... [more]
A0A1I8AJV99.403e-9753.9260S acidic ribosomal protein P0 OS=Steinernema gla... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rplp02.015e-8654.86ribosomal protein, large, P0 [Source:NCBI gene;Acc... [more]
mrto42.355e-1123.70MRT4 homolog, ribosome maturation factor [Source:N... [more]
mrto42.410e-1123.70MRT4 homolog, ribosome maturation factor [Source:N... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rplp02.220e-9353.44ribosomal protein, large, P0 [Source:NCBI gene;Acc... [more]
rplp07.492e-3654.31ribosomal protein, large, P0 [Source:NCBI gene;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPP01.879e-7043.94Conserved ribosomal protein P0 of the ribosomal st... [more]
YLR339C_mRNA1.356e-1442.75Dubious open reading frame; unlikely to encode a f... [more]
MRT48.631e-820.30Protein involved in mRNA turnover and ribosome ass... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO341941.427e-9153.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301232.410e-620.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rplp01.853e-8754.58ribosomal protein lateral stalk subunit P0 [Source... [more]
rplp04.127e-7349.24ribosomal protein lateral stalk subunit P0 [Source... [more]
rplp06.001e-4256.46ribosomal protein lateral stalk subunit P0 [Source... [more]
mrto46.518e-1024.35MRT4 homolog, ribosome maturation factor [Source:N... [more]
back to top
BLAST of 60S acidic ribosomal protein P0 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000079482.10.000e+099.68SMESG000079482.1[more]
SMESG000049529.19.299e-16475.80SMESG000049529.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027280 ID=SMED30027280|Name=60S acidic ribosomal protein P0|organism=Schmidtea mediterranea sexual|type=transcript|length=1010bp
ATTTTTATGAAAATAGTCTTGTTTAATCATTTAAATTTACATCTAGCGTA
ATTAATTAAAAAATGGTTATCCAAAAGAAAATTAATTATGCCGAAAAATT
GAGAACCAAATTTGCCCAATATGAAAAAATATTCATTGTAAATGCTGATA
ACGTGTCAAGTCAGCAATTACAAAATGTTCGAAAAGAATTAAGAAGTACT
GCAGAAATCGTATTAGGTAAAAACACAATGATGAAATTCGTCATTACAAA
AAACAAGGCGTCAAATCCAGATTTGTTGAAATTATTTCCACATTTGAAAG
GCAACGTTGGTTTTGTTTTTACAAACGGAGATCTTAATGGAGTAAAAGAT
ATTCTTCTTTCTCAAAAAATTCAAGCTCCAGCAAAAGCAGATGCTATTGC
TCCAGTAAGTGTAATGGTACCTAAACAGCTTACAACATTAGGACCCGAAA
AGACTTCATTTTTCCAGGCTTTACAAATACCAACTAAAATCACTCGAGGA
ACTATCGAAATCATCAATGATGTCGATTTAATTAAAGCTGGAGATATAGT
TAAGCAATCTGAATCTCAGCTTCTTCAAATGTTGAAAATATTTCCATTTC
AATACGGATTAAAAATCCAGCAAATATATGAAAATGGCTCTTGTTATAGT
CCAGATGCATTAGATATCACCGAGGATGATATTTTAAGAGGATTTATGGA
ATCGACTCAAAAAGTGGCTGCTGTTTCCTTGGCTATCAACAAGCCAACTC
TAGCGTCGATCCCCCACATAATAGCGAACACCATCAAAGCTGTTATTGGT
CTAGCAGTTGTTACCGATTACGATTTGAAAGAAGCTGCCGATATTAAAGA
ATACCTAAAAGACCCGACGAAATTTGCAACTGCGACGGTTGCTGTGGCAA
CCACAGCAGCGCCTGCAAAACCAGTGCAACAGGAGGCTGCCAAGGAGGAA
TCTTCTGAATCGGAAGGAAGTGATATCGGAATGGGATTGTTTGATTAAAT
GGCAATTATA
back to top

protein sequence of SMED30027280-orf-1

>SMED30027280-orf-1 ID=SMED30027280-orf-1|Name=SMED30027280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MVIQKKINYAEKLRTKFAQYEKIFIVNADNVSSQQLQNVRKELRSTAEIV
LGKNTMMKFVITKNKASNPDLLKLFPHLKGNVGFVFTNGDLNGVKDILLS
QKIQAPAKADAIAPVSVMVPKQLTTLGPEKTSFFQALQIPTKITRGTIEI
INDVDLIKAGDIVKQSESQLLQMLKIFPFQYGLKIQQIYENGSCYSPDAL
DITEDDILRGFMESTQKVAAVSLAINKPTLASIPHIIANTIKAVIGLAVV
TDYDLKEAADIKEYLKDPTKFATATVAVATTAAPAKPVQQEAAKEESSES
EGSDIGMGLFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043164RL10_insert_sf
IPR040637RL10P_insert
IPR043141Ribosomal_L10-like_sf
IPR001790Ribosomal_L10P
IPR030670L10E_eukaryotes
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
GO:0002181cytoplasmic translation
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005840ribosome
GO:0022625cytosolic large ribosomal subunit
GO:0022626cytosolic ribosome
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0003906DNA-(apurinic or apyrimidinic site) lyase activity
GO:0016829lyase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR03067060S acidic ribosomal protein P0PIRSFPIRSF039087L10Ecoord: 1..311
e-value: 1.8E-118
score: 392.8
IPR001790Ribosomal protein L10PPFAMPF00466Ribosomal_L10coord: 3..99
e-value: 1.1E-22
score: 80.0
IPR04316450S ribosomal protein L10, insertion domain superfamilyGENE3DG3DSA:3.90.105.20coord: 106..178
e-value: 1.6E-26
score: 93.8
IPR04063760S ribosomal protein L10P, insertion domainPFAMPF17777RL10P_insertcoord: 107..176
e-value: 1.0E-17
score: 63.8
NoneNo IPR availablePFAMPF00428Ribosomal_60scoord: 228..310
e-value: 5.3E-12
score: 46.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..311
NoneNo IPR availablePANTHERPTHR4569960S acidic ribosomal protein P0coord: 4..311
NoneNo IPR availablePANTHERPTHR45699:SF360S ACIDIC RIBOSOMAL PROTEIN P0coord: 4..311
NoneNo IPR availableCDDcd05795Ribosomal_P0_L10ecoord: 4..178
e-value: 8.43997E-76
score: 227.842
IPR043141Ribosomal protein L10-like domain superfamilySUPERFAMILYSSF160369Ribosomal protein L10-likecoord: 1..127