Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30027269
Length (bp)2826
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30027269) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30027269) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027269

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30027269h1SMcG0001261 SmedASXL_017377SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027269h1SMcG0001261 dd_Smed_v4_11944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 51.9878 bits (123), Expect = 4.192e-6
Identity = 73/308 (23.70%), Postives = 129/308 (41.88%), Query Frame = 2
Query: 1244 ADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITM------VNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINIL-YPARD-MKITPKREEYRNGD--TVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFV---------EYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLND 2110
            A +A   EY  R+  R   TI  T   +  + P IT       V  G      C     G+P   ++  + +   +++T S  N  +   +++ N   + D     C+ KN   E K+QE+ +  L  PAR    I P+  E   G+  T+ C A G+P P ITW  T+ D   +   P  + +TP    ++         EY C A N +    +SI    +I    +    F+V P     +  V +E +  +    +    + + Q +++ T+G S + ++ ++  L+    S ++R     L+D
Sbjct:  213 AQAAATCEYPRRIQGRSVATI--TPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQN-TQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQITW--TRGDRTPLPIDP-RVNITPSGGLYIQNVAQSDSGEYTCFASNSV----DSIHATAFI--IVQALPQFTVTP-----QSRVVIEGQTVDFQCAA----KGHPQPVIAWTKGGSQLSVDRRHLVLS----SGTLRISGVALHD 493          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 51.9878 bits (123), Expect = 4.387e-6
Identity = 73/308 (23.70%), Postives = 129/308 (41.88%), Query Frame = 2
Query: 1244 ADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITM------VNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINIL-YPARD-MKITPKREEYRNGD--TVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFV---------EYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLND 2110
            A +A   EY  R+  R   TI  T   +  + P IT       V  G      C     G+P   ++  + +   +++T S  N  +   +++ N   + D     C+ KN   E K+QE+ +  L  PAR    I P+  E   G+  T+ C A G+P P ITW  T+ D   +   P  + +TP    ++         EY C A N +    +SI    +I    +    F+V P     +  V +E +  +    +    + + Q +++ T+G S + ++ ++  L+    S ++R     L+D
Sbjct:   33 AQAAATCEYPRRIQGRSVATI--TPEELNCERPRITSEPQDADVTSGNTVYFTCRAE--GNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQN-TQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQITW--TRGDRTPLPIDP-RVNITPSGGLYIQNVAQSDSGEYTCFASNSV----DSIHATAFI--IVQALPQFTVTP-----QSRVVIEGQTVDFQCAA----KGHPQPVIAWTKGGSQLSVDRRHLVLS----SGTLRISGVALHD 313          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A267EK00 (Ig-like domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007081g1 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.833e-8
Identity = 76/321 (23.68%), Postives = 134/321 (41.74%), Query Frame = 2
Query: 1913 LEKMVTVECRVDNMNATSVLNIE---------DNDQLIVSVTQGSSSIQINYKNRT-LNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYL---------------KQSLEI--KYGNITR-----EGEYFNVSCLQNVGN--------NMSITLNLVGS-QNW-----KSLQLISVLSEPVIFSVLVSVSYHQSLFYCSL-------HMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTAN--GEYQYKCSAEIQYRTELMSVSKTIKFRV 2710
            L + VTV+CR   +  T ++ +             ++ VS +    +++  +K+R    ++  + S+ F M   ++G  +  C    L G      V L               KQ+L +  K  +  R     EG+   + C  NVG         ++S   +L G+ + W        + ++V S  V  SV + +  H +++ C L       H+N T   +S  + + V Y    IE+ P + +Y   + I C A+GRP+P IQWT I     + +  ++L L      G Y Y CSA  + R     + ++I F +
Sbjct:   43 LGQRVTVQCR--PLRPTDIVLVRLLRRPLTGGAEVEVFVSASGSRGALRPPWKSRRDATFSVKTASLSFNMTTADEG--SYKCLALTLDGPSAGGRVQLLTAMTPAEPRLFVNGKQTLPMASKKSSAKRRIELVEGQAIMIRCNANVGKPPGSLSLLDLSRRAHLKGAVRTWTGPVTAGSKTMTVYSS-VTHSVKIELGSHGAVYGCQLKPHPMFAHLNITYGVKS--DPIRVLYTVRRIELQPYRDNYFHGDRIDCLAKGRPAPKIQWTRIRGAGPLQVNGSSLYLQPGAKVGYYAYTCSASNRVRGHYHRLLQSIGFHL 356          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4W6FNJ1 (Heparan sulfate proteoglycan 2 OS=Lates calcarifer OX=8187 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.074e-7
Identity = 102/509 (20.04%), Postives = 195/509 (38.31%), Query Frame = 2
Query: 1229 LSYRIADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITM------VNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYPARD------MKITPKREEYRNGDTVR--CEAAGNPSPNITWWST----QNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIY--INETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYK---NRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYGNITREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEI----IPQKTDYLT---SETIQCSAEGRPSPMIQWTSI-SPLTGI-LIANNNLILSTANGE--YQYKCSA 2653
            L++   D A  GEYTC+  N + E  +  + F+Q   P + +      V+EG+   + C  +  GSP   +   K    G +   +  +++++  +++ N      G ++ C+  N      S   PI +     D      + I P   + + G ++   C A GNP P +TW        ++  ++ S    +  TP      EY C     + G T +   +I+           +  +  P + +E              ++ + + ++      V  G+  +++ +K   N+ L  N         + + N  P N   Y     G  L     +     ++     R GE  N+ C  +     S++ + + S     L     +    +  +LV+       + C+   N  E S     +++V   S V  +    +P+    +    + T++C A G PSP I W+ + SPL     + NN+L+L     +   +Y CSA
Sbjct: 1793 LTFSAVDPADEGEYTCKALNTHGEHTARVSLFVQSTQPQVQVSPQNIEVHEGDTLRLYCRAS--GSPTPKLTWLK--NGGQIPPQARMDRTDIGTLLIPNIKMSDSGTYM-CVGSNRI---GSNSAPIKVTVLKADHISSSVVSIQPSIADVQEGQSLELNCFAPGNPPPQVTWTRASGRLSSNHEVLGSQLRILSATPEDSG--EYIC----RVQGNTGNPGTHIHQASVSVSVTSSSSRLQSPIIAIEPH------------SAAVRVGESASFRCRVYSGAQPVRLEWKLASNQPLPDNVKVSPDGSVITITNARPINHGAYRCVAKGFPLSPVATVTPVGPVR----VRVGEPINLECQASGEPRPSVSWHRLDSNRKTMLSSPVPMESNAVMQILVARPEDSGTYVCTARNN--EGSTETKVEVVVEGGSQVPSVPRASVPEPLMVVVEGQTVTLRCEAHGFPSPKITWSKLRSPLPWRHKVVNNSLVLPNVGRQDSGEYICSA 2269          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000018709.1 (SMESG000018709.1)

HSP 1 Score: 1500.34 bits (3883), Expect = 0.000e+0
Identity = 749/895 (83.69%), Postives = 811/895 (90.61%), Query Frame = 2
Query:  116 NRSIVFRGPVHVIENQIGQFICSLNTREEFQNISVKNLKTEIISWLESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNATSPVFNSTDRLIYYENETFSFSCQSVXXXXXXXXXXXXXXVYANGIQEDLDY----SSXXXXXXXXXXXXXHDASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCYTEGNPTPTVEWELITTDFDDWINRSSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWKNIKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNTDIIEHSDFIYDTNVTFSSLSYRIADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYPARDMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYGNITREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCSAEIQYRTELMSVSKTIKFRVGQASC-LKVCWMNLALVLLAIAFPLF 2785
            NRS++F GPVHVIENQ+ QFICSLNTRE+FQNISVK+  +EI+ W  +N +EKC V  ++++ Y+SNC+ D+G+LSYEMAF+ AFEG  TCQI I NE Y+R+INV VNA+SP+FNST+RLIYYENETFSFSCQSVN     +++     VYANGIQEDL+Y    SSLIT TQLNLNQTLHDASIGCGIQY+FSRYNQNFTKLNISY+MKRIE YP RDVYNPTDIIRCY++GNPTPTVEW+LITTDFDDWIN S L IGN LGNRTCNCRAQQN++NQTILLSTQFVIVVKA+QSTVP T TTERW+NIKIEFSGDKLS SNISEHRWEIVPKWAGFINGT+T  STHIIRFN+T+IIEHSDFIYDTNVTFSSLSYRI DSATYGEYTCRMYNRYNETISA+TYFIQGQNPNITMV EGENFIINCSTTTLGSP GIMMIFKR K G +  +SPFN S+L++IVVANFNWK DGD   CIIKNEFY W+SQEIPINILY  RD+KITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDN QLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYGNITREGEYFNVSCLQNVGNN+SITLNLVGSQNWKSLQLISVLSEPV F VLVS  YHQ+ FYCSLHMNSTELSRSVGEKL VYYLSN+I I+P+ TDY  SE IQCSAEGRP+P IQWTS++P TGI I NNNLILS+ANGEYQYKCSAE+QY+TELMSVSKTIKFRVG+AS  L++C MN  LVL+AIAFP F
Sbjct:   19 NRSVIFTGPVHVIENQMEQFICSLNTREDFQNISVKHSNSEILFW--TNLNEKCSV-SKDFKNYLSNCTKDSGMLSYEMAFIQAFEGKITCQIEINNERYDRNINVFVNASSPIFNSTERLIYYENETFSFSCQSVNKKTNVMIINYI--VYANGIQEDLNYASTNSSLITITQLNLNQTLHDASIGCGIQYEFSRYNQNFTKLNISYEMKRIEFYPKRDVYNPTDIIRCYSDGNPTPTVEWQLITTDFDDWINGSRLRIGNVLGNRTCNCRAQQNFKNQTILLSTQFVIVVKAFQSTVPTTMTTERWRNIKIEFSGDKLSKSNISEHRWEIVPKWAGFINGTITVKSTHIIRFNHTNIIEHSDFIYDTNVTFSSLSYRITDSATYGEYTCRMYNRYNETISASTYFIQGQNPNITMVKEGENFIINCSTTTLGSPKGIMMIFKRTKMGPLVNYSPFNISSLYIIVVANFNWKDDGDRALCIIKNEFYTWESQEIPINILYSVRDIKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNGQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYGNITREGEYFNVSCLQNVGNNLSITLNLVGSQNWKSLQLISVLSEPVTFPVLVSAIYHQAQFYCSLHMNSTELSRSVGEKLFVYYLSNLITIVPENTDYSISEIIQCSAEGRPTPKIQWTSVTPSTGIQITNNNLILSSANGEYQYKCSAEVQYKTELMSVSKTIKFRVGKASGYLRLCLMNFTLVLMAIAFPSF 908          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000018945.1 (SMESG000018945.1)

HSP 1 Score: 1300.8 bits (3365), Expect = 0.000e+0
Identity = 679/869 (78.14%), Postives = 737/869 (84.81%), Query Frame = 2
Query:   59 MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIGQFICSLNTREEFQNISVKNLKTEIISWLESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNATSPVFNSTDRLIYYENETFSFSCQSVXXXXXXXXXXXXXXVYANGIQEDLDYSSXXXXXXXXXXXXXHDASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCYTEGNPTPTVEWELITTDFDDWINRSSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWKNIKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNTDIIEHSDFIYDTNVTFSSLSYRIADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYPARDMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYG-NITREGEYFNVSCLQNVGNNMSITLNL-VGSQN--WKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCSA 2653
            MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIGQFICSLNTREEFQNISVKNLKTEIISW ESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNA SPVFNSTDRLIYYENETFSFSC SVNNNNTNILMIINYIVYANGIQEDLDYSSLITTTQLNLNQT++DASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCY+EGN TPTVEWELITTDFDDWIN SSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWK+IKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNTDIIEHSDFIYDTNVTFSSLSYRIADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYP RDMKITPKREEYRNGDTV+CEA GNP P ITWWS+ NDS+ ISSFP+TI LTPPS+ FV Y CVALNVINGVTNSIA  I+IN TY EFVNFSVNPP VG+EKMV  ECRVDNMN  S++NI+DNDQL+VS+ QG  +++ +Y+N+  N +    S+ F      D PRNLSCYV F S T+L++ V LK ++EI+Y       G+ F+VSCLQN  N   + + + VGS+N   K+ + +S  S  +I +      Y     +CSL  N   L   +GE+L+  +    + I P    Y    T++C A G P+  I W++    + I+ +  N+I   +N    Y C+A
Sbjct:    1 MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIGQFICSLNTREEFQNISVKNLKTEIISWFESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNAPSPVFNSTDRLIYYENETFSFSCHSVNNNNTNILMIINYIVYANGIQEDLDYSSLITTTQLNLNQTMNDASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCYSEGNHTPTVEWELITTDFDDWINGSSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWKDIKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNTDIIEHSDFIYDTNVTFSSLSYRIADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYPVRDMKITPKREEYRNGDTVKCEAVGNPLPKITWWSSVNDSYFISSFPNTITLTPPSNAFVTYTCVALNVINGVTNSIANAIFINGTYYEFVNFSVNPPVVGIEKMVMAECRVDNMNVISLMNIKDNDQLMVSINQGILTVEKSYRNKISNTSLTQNSISFMSEFSKDQPRNLSCYVIFASKTRLERRVELKNAIEIEYKTKYIVIGKPFSVSCLQNYRNMSELKVGINVGSENIVLKTFKNVSQSSVELI-NFDFEKRYINGNIFCSLIFNGELLKTVIGERLVETFGIWEVIISPNLPRYEAGMTVKCDANGNPTMNISWSATVVDSFIITSPPNVITLISNETTVYTCTA 868          

HSP 2 Score: 487.649 bits (1254), Expect = 1.335e-152
Identity = 265/412 (64.32%), Postives = 312/412 (75.73%), Query Frame = 2
Query: 1442 KNGAVETFSPFNKSNLHVIVVANFNWK---VDGDFIFC--IIKNEFYEWKSQEIPINILYPARDMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKY--GNITREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCSAE 2656
            +N  ++TF   ++S++ +I   NF+++   ++G+ IFC  I   E  +    E  +   +   ++ I+P    Y  G TV+C+A GNP+ NI+W +T  DSFII+S P+ I L     T   Y C A N++N  TN   KNI I    +EF  F V P  VGL K VTV C VD + + +V+NI+DND +++SVT GSSSIQINY+NR +NY QDS+SV FEMNLLND PRN SCY  FLSG  LQK V+LK+SLEIKY  GN+TREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPV FSVLVSVSYHQS FYC+LHMNSTELSRSVG KLIVYYLSNVIEIIP+KTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKC A+
Sbjct: 1034 ENIVLKTFKNVSQSSVELI---NFDFEKRYINGN-IFCSLIFNGELLKTVIGERLVET-FGIWEVIISPNLPRYEAGMTVKCDANGNPTMNISWSATVVDSFIITSPPNVITLISNETTV--YTCTATNMVNNQTNIANKNITIYGRNEEFFRFQVTPQVVGLSKNVTVTCEVDKIESLTVMNIKDNDNIMISVTSGSSSIQINYRNRIVNYTQDSRSVSFEMNLLNDSPRNFSCYAMFLSGVILQKLVFLKKSLEIKYENGNLTREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPVTFSVLVSVSYHQSPFYCALHMNSTELSRSVGGKLIVYYLSNVIEIIPEKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCLAK 1438          

HSP 3 Score: 228.794 bits (582), Expect = 1.534e-61
Identity = 157/413 (38.01%), Postives = 232/413 (56.17%), Query Frame = 2
Query: 1442 KNGAVETFSPFNKSNLHVIVVANFNWK---VDGDFIFC--IIKNEFYEWKSQEIPINILYPARDMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYG-NITREGEYFNVSCLQNVGNNMSITLNL-VGSQN--WKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCSA 2653
            +N  ++TF   ++S++ +I   NF+++   ++G+ IFC  I   E  +    E  +   +   ++ I+P    Y  G TV+C+A GNP+ NI+W +T  DSFII+S P+ I L     T   Y C A N++N  TN   KNI I    +EF  F V P  VGL K VTV C VD + + +V+NI+DND +++SVT GSSSIQINY+NR +NY QDS+SV FEMNLLND PRN SC V FLS  + ++ V LK ++EI+Y       G+ F+VSC+QN  N     + + VGS+N   K+ + +S  S  +I +      Y     +CSL  N   L   +GE+L+  +    + I P    Y    T++C A G P+  I W++    + I+ +  N+I   +N    Y C+A
Sbjct:  749 ENIVLKTFKNVSQSSVELI---NFDFEKRYINGN-IFCSLIFNGELLKTVIGERLVET-FGIWEVIISPNLPRYEAGMTVKCDANGNPTMNISWSATVVDSFIITSPPNVITLISNETTV--YTCTATNMVNNQTNIANKNITIYGRNEEFFRFQVTPQVVGLSKNVTVTCEVDKIESLTVMNIKDNDNIMISVTSGSSSIQINYRNRIVNYTQDSRSVSFEMNLLNDSPRNFSCNVVFLSSIRSERQVELKNAIEIEYKTKYIVIGKPFSVSCIQNYRNMSEFKVGINVGSENIVLKTFKNVSQSSVELI-NFDFEKRYINGNIFCSLIFNGELLKTVIGERLVETFGIWEVIISPNLPRYEAGMTVKCDANGNPTMNISWSATVVDSFIITSPPNVITLISNETTVYTCTA 1153          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000018952.1 (SMESG000018952.1)

HSP 1 Score: 1295.41 bits (3351), Expect = 0.000e+0
Identity = 676/870 (77.70%), Postives = 737/870 (84.71%), Query Frame = 2
Query:   59 MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIGQFICSLNTREEFQNISVKNLKTEIISWLESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNATSPVFNSTDRLIYYENETFSFSCQSVXXXXXXXXXXXXXXVYANGIQEDLDYSSXXXXXXXXXXXXXHDASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCYTEGNPTPTVEWELITTDFDDWINRSSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWKNIKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNTDIIEHSDFIYDTNVTFSSLSYRIADSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYPARDMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYGN--ITREGEYFNVSCLQNVGNNMSITLNL-VGSQN--WKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCSA 2653
            MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIG+FICSLNTREEFQNISVKNLKTEIISW ESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNA SPVFNSTDRLIYYENETFSFSC SVNNNNTNILMIINYIVYANGIQEDLDYSSLITTTQLNLNQT++DASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCY+EGNPTPTVEWELITTDFDDWIN SSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWK+IKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNT+IIEHSDFIYDTNVTFSSLSYRI DSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYP RDMKITPKREEYRNGDTV+CEA GNP P ITWWS+ NDS+ ISSFP+TI LTPPS+ FV Y CVALNVINGVTNSIA  I+IN TY EFVNFSVNPP VG+EKMV  ECRVDNMN  S++NI+DNDQL+VS+ QG  +++ +Y+N+  N +    S+ F      D PRNLSC+V F S  +L++ V LK ++EI+Y    I  E   F+VSC+QN  N   + + + VGS+N   K+ + +S  S  +I +  V   Y     +CSL  N   L   +GE+L+  +    + I P    Y    T++C A G P+  I W++    + I+ +  N+I   +N    Y C+A
Sbjct:    1 MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIGKFICSLNTREEFQNISVKNLKTEIISWFESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAFLAAFEGPFTCQIGIKNELYNRSINVLVNAPSPVFNSTDRLIYYENETFSFSCHSVNNNNTNILMIINYIVYANGIQEDLDYSSLITTTQLNLNQTMNDASIGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCYSEGNPTPTVEWELITTDFDDWINGSSLTIGNRLGNRTCNCRAQQNYRNQTILLSTQFVIVVKAYQSTVPITTTTERWKDIKIEFSGDKLSNSNISEHRWEIVPKWAGFINGTVTANSTHIIRFNNTNIIEHSDFIYDTNVTFSSLSYRIVDSATYGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGSPIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKNEFYEWKSQEIPINILYPVRDMKITPKREEYRNGDTVKCEAVGNPLPKITWWSSVNDSYFISSFPNTITLTPPSNAFVTYTCVALNVINGVTNSIANAIFINGTYYEFVNFSVNPPVVGIEKMVMAECRVDNMNVISLMNIKDNDQLMVSINQGILTVEKSYRNKISNTSLTQNSISFMSEFSKDQPRNLSCFVIFASKNRLERRVELKNAIEIEYKTKYIVIEKP-FSVSCVQNYRNMSELKVGINVGSENIVLKTFKNVSQSSVELI-NFDVEKRYINGNIFCSLIFNGELLKTVIGERLVETFGIWEVIISPNLPRYEAGMTVKCDANGNPTMNISWSATVVDSFIITSLPNVITLISNETTVYTCTA 868          

HSP 2 Score: 552.362 bits (1422), Expect = 8.389e-177
Identity = 285/392 (72.70%), Postives = 309/392 (78.83%), Query Frame = 2
Query: 1616 DMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKY--GNITREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCSAEIQYRTELMSVSKTIKFRVGQASCLKVCWMNLALVLLAIAFPLF 2785
            ++ I+P    Y  G TV+C+A GNP+ NI                              Y C A N++N  TN   KNI I    +EF  F V P  VGL K VTV C VD + + +V+NI+DND +++SVT GSSSIQINY+NR +NY QDS+SV FEMNLLND PRN SCY  FLSG  LQK V+LK+SLEIKY  GN+TREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPV FSVLVSVSYHQS FYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIP+KTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKC AEIQYRTELMSVSKTIKFRVGQASCLKVCWMNLALVLLAIAFPLF
Sbjct: 1092 EVIISPNLPRYEAGMTVKCDANGNPTMNII-----------------------------YTCTATNMVNNQTNIANKNITIYGRNEEFFRFQVTPQVVGLSKNVTVTCEVDKIESLTVMNIKDNDNIMISVTSGSSSIQINYRNRIVNYTQDSRSVSFEMNLLNDSPRNFSCYAMFLSGVILQKLVFLKKSLEIKYENGNLTREGEYFNVSCLQNVGNNMSITLNLVGSQNWKSLQLISVLSEPVTFSVLVSVSYHQSPFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPEKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNLILSTANGEYQYKCLAEIQYRTELMSVSKTIKFRVGQASCLKVCWMNLALVLLAIAFPLF 1454          

HSP 3 Score: 222.631 bits (566), Expect = 1.694e-59
Identity = 145/350 (41.43%), Postives = 202/350 (57.71%), Query Frame = 2
Query: 1616 DMKITPKREEYRNGDTVRCEAAGNPSPNITWWSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYINETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSVTQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTKLQKNVYLKQSLEIKYGN--ITREGEYFNVSCLQNVGNNMSITLNL-VGSQN--WKSLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYYLSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGIL-----IANNNLILSTANGEY 2635
            ++ I+P    Y  G TV+C+A GNP+ NI+W +T  DSFII+S P+ I L     T   Y C A N++N  TN   KNI I    +EF  F V P  VGL K VTV C VD + + +V+NI+DND +++SVT GSSSIQINY+NR +NY QDS+SV FEMNLLND PRN SC V FLS  + ++ V LK ++EI+Y    I  E   F+VSC+QN  N   + + + VGS+N   K+ + +S  S  +I +  V   Y     +CSL  N   L   +GE+L+  +    + I P    Y    T++C A G P+  I +T  +  T ++     IAN N+ +   N E+
Sbjct:  807 EVIISPNLPRYEAGMTVKCDANGNPTMNISWSATVVDSFIITSLPNVITLISNETTV--YTCTATNMVNNQTNIANKNITIYGRNEEFFRFQVTPQVVGLSKNVTVTCEVDKIESLTVMNIKDNDNIMISVTSGSSSIQINYRNRIVNYTQDSRSVSFEMNLLNDSPRNFSCNVVFLSSIRSERQVELKNAIEIEYKTKYIVIEKP-FSVSCVQNYRNMSELKVGINVGSENIVLKTFKNVSQSSVELI-NFDVEKRYINGNIFCSLIFNGELLKTVIGERLVETFGIWEVIISPNLPRYEAGMTVKCDANGNPTMNIIYTCTA--TNMVNNQTNIANKNITIYGRNEEF 1150          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pxdn4.192e-623.70peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
Pxdn4.387e-623.70peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A267EK001.833e-823.68Ig-like domain-containing protein OS=Macrostomum l... [more]
A0A4W6FNJ12.074e-720.04Heparan sulfate proteoglycan 2 OS=Lates calcarifer... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018709.10.000e+083.69SMESG000018709.1[more]
SMESG000018945.11.335e-15278.14SMESG000018945.1[more]
SMESG000018952.18.389e-17777.70SMESG000018952.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027269 ID=SMED30027269|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2826bp
AGCTCATATATAAATAAATATTGAAGAACCGCTGAATTCACTTTTAAAAA
ACTATTCAATGTTTCTTTACGTTTTCTGGCTCATCTATATCTCTCACGTG
ACATCATCCAATGGGAACCGGTCTATCGTTTTCAGGGGCCCTGTCCATGT
CATTGAGAACCAAATCGGGCAATTCATTTGCTCTTTAAATACCCGAGAAG
AGTTTCAAAATATTTCTGTAAAAAATTTAAAAACCGAGATTATTTCTTGG
TTAGAATCAAACGGAGACGAAAAGTGTGTAGTTTTTCAAAGAGAATATCG
AAAATATATATCCAATTGTAGCATCGACAATGGAGTGTTATCATATGAAA
TGGCCTTTCTAGCGGCATTTGAAGGCCCATTCACTTGTCAGATCGGGATT
AAGAACGAACTATACAACAGAAGCATCAATGTGTTAGTTAACGCGACGAG
TCCCGTTTTCAATTCGACTGATCGATTAATCTATTACGAAAATGAAACTT
TCAGTTTTTCATGTCAGTCGGTGAATAATAATAACACGAATATATTGATG
ATTATCAACTATATCGTCTATGCAAACGGGATACAAGAGGACCTGGATTA
CTCATCCTTGATTACAACTACTCAATTGAATCTCAATCAAACATTGCATG
ACGCAAGCATTGGATGCGGAATCCAGTATCAATTCTCCCGATACAATCAG
AACTTCACAAAGCTCAATATATCATATAAAATGAAACGCATTGAAATCTA
CCCGAACAGAGATGTCTACAATCCAACCGACATTATCCGTTGCTATACTG
AAGGAAATCCCACTCCAACTGTCGAATGGGAGCTGATAACCACCGATTTC
GATGATTGGATAAACAGGTCGAGTTTAACGATTGGAAATCGATTGGGAAA
TCGGACATGTAATTGCAGGGCTCAACAAAATTACAGAAACCAAACAATAC
TCCTATCGACTCAATTTGTGATAGTAGTTAAAGCGTACCAATCGACCGTT
CCAATAACAACAACAACTGAAAGGTGGAAAAATATTAAAATAGAATTTTC
CGGTGACAAATTATCCAACTCTAACATATCGGAACATCGGTGGGAAATAG
TCCCGAAATGGGCCGGATTCATTAATGGCACAGTAACAGCGAATAGCACT
CACATAATCCGGTTCAATAACACAGACATCATAGAGCATTCCGATTTCAT
ATATGATACAAATGTGACGTTTTCCAGCTTGTCGTATAGGATTGCGGATT
CAGCAACATATGGAGAGTACACATGTCGAATGTATAACCGATACAATGAG
ACAATTAGCGCTACTACATATTTCATTCAGGGACAAAATCCAAATATAAC
AATGGTTAATGAGGGGGAGAATTTTATCATAAACTGCTCAACTACAACTT
TGGGTTCTCCAATCGGAATCATGATGATTTTTAAGAGAGATAAAAACGGC
GCAGTCGAAACCTTTTCCCCTTTCAATAAGTCAAATCTGCACGTAATTGT
TGTTGCGAATTTCAATTGGAAAGTTGATGGGGATTTTATTTTTTGTATTA
TTAAAAATGAGTTTTATGAATGGAAAAGCCAGGAAATTCCCATAAATATT
TTGTATCCAGCCAGGGACATGAAAATCACACCGAAAAGAGAGGAGTATAG
AAATGGGGATACAGTGAGGTGTGAAGCAGCAGGAAATCCTTCGCCAAACA
TTACGTGGTGGTCTACTCAAAACGACTCATTCATCATATCATCCTTCCCA
GATACCATTAAGTTAACTCCTCCTTCTGATACCTTCGTGGAGTACTTTTG
TGTAGCATTAAATGTAATAAATGGAGTTACAAACTCGATTGCCAAAAACA
TTTATATTAATGAAACTTATAAAGAATTTGTCAATTTTTCCGTTAATCCA
CCTGCTGTAGGACTAGAGAAAATGGTTACAGTCGAATGTAGGGTTGACAA
CATGAATGCCACATCAGTCTTGAATATCGAGGATAATGATCAGTTGATTG
TCTCCGTAACTCAGGGTTCATCGTCCATACAAATCAACTATAAAAATAGA
ACTTTGAATTATAATCAAGATTCGAAATCGGTACGTTTTGAAATGAATCT
ATTGAATGACGGTCCGAGAAACCTCAGCTGTTACGTCACATTTTTGTCTG
GTACTAAACTGCAAAAAAATGTTTATTTAAAACAATCTTTGGAAATAAAA
TATGGAAACATTACGAGAGAAGGAGAATATTTTAATGTCTCATGTTTACA
AAATGTCGGAAATAATATGTCAATTACTCTCAATTTGGTTGGTAGTCAAA
ACTGGAAGTCATTGCAATTAATATCAGTGTTATCGGAGCCTGTCATATTT
TCGGTTTTAGTAAGTGTAAGTTATCACCAGTCACTATTTTATTGTTCATT
GCACATGAATTCAACTGAACTTTCTCGATCAGTCGGTGAGAAATTAATTG
TATATTATCTGTCCAATGTCATCGAAATTATTCCGCAGAAAACCGATTAT
TTAACTTCCGAAACTATTCAATGTTCTGCTGAAGGAAGACCTTCTCCAAT
GATTCAATGGACATCCATTTCACCTTTAACTGGTATTCTAATAGCAAATA
ATAATTTGATTTTATCAACCGCAAATGGAGAATACCAGTATAAATGTTCA
GCGGAAATTCAATATAGAACCGAGTTAATGTCAGTTAGTAAAACAATTAA
ATTTCGAGTTGGACAGGCCAGTTGCTTGAAAGTGTGTTGGATGAATTTGG
CTTTGGTTCTATTGGCGATCGCTTTTCCTTTATTTTGATCAGTTCACACT
TTTCATTTTTGCTTGATTTTATTTCA
back to top

protein sequence of SMED30027269-orf-1

>SMED30027269-orf-1 ID=SMED30027269-orf-1|Name=SMED30027269-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=910bp
MFLYVFWLIYISHVTSSNGNRSIVFRGPVHVIENQIGQFICSLNTREEFQ
NISVKNLKTEIISWLESNGDEKCVVFQREYRKYISNCSIDNGVLSYEMAF
LAAFEGPFTCQIGIKNELYNRSINVLVNATSPVFNSTDRLIYYENETFSF
SCQSVNNNNTNILMIINYIVYANGIQEDLDYSSLITTTQLNLNQTLHDAS
IGCGIQYQFSRYNQNFTKLNISYKMKRIEIYPNRDVYNPTDIIRCYTEGN
PTPTVEWELITTDFDDWINRSSLTIGNRLGNRTCNCRAQQNYRNQTILLS
TQFVIVVKAYQSTVPITTTTERWKNIKIEFSGDKLSNSNISEHRWEIVPK
WAGFINGTVTANSTHIIRFNNTDIIEHSDFIYDTNVTFSSLSYRIADSAT
YGEYTCRMYNRYNETISATTYFIQGQNPNITMVNEGENFIINCSTTTLGS
PIGIMMIFKRDKNGAVETFSPFNKSNLHVIVVANFNWKVDGDFIFCIIKN
EFYEWKSQEIPINILYPARDMKITPKREEYRNGDTVRCEAAGNPSPNITW
WSTQNDSFIISSFPDTIKLTPPSDTFVEYFCVALNVINGVTNSIAKNIYI
NETYKEFVNFSVNPPAVGLEKMVTVECRVDNMNATSVLNIEDNDQLIVSV
TQGSSSIQINYKNRTLNYNQDSKSVRFEMNLLNDGPRNLSCYVTFLSGTK
LQKNVYLKQSLEIKYGNITREGEYFNVSCLQNVGNNMSITLNLVGSQNWK
SLQLISVLSEPVIFSVLVSVSYHQSLFYCSLHMNSTELSRSVGEKLIVYY
LSNVIEIIPQKTDYLTSETIQCSAEGRPSPMIQWTSISPLTGILIANNNL
ILSTANGEYQYKCSAEIQYRTELMSVSKTIKFRVGQASCLKVCWMNLALV
LLAIAFPLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 511..601
score: 7.558
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 778..883
score: 6.669
NoneNo IPR availableCDDcd00096Igcoord: 535..594
e-value: 7.16107E-4
score: 36.8365
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.654
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 427..591
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 242..419