ATP-dependent RNA helicase TDRD9

Overview
NameATP-dependent RNA helicase TDRD9
Smed IDSMED30027258
Length (bp)4974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase TDRD9 (SMED30027258) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase TDRD9 (SMED30027258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase TDRD9 (SMED30027258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase TDRD9 (SMED30027258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027258

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027258SMESG000016118.1 SmedASXL_013249SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30027258SMESG000016118.1 dd_Smed_v4_5842_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail stripeSMED30027258SMESG000016118.1 isotig23459be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30027258SMESG000016118.1 isotig23459be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30027258SMESG000016118.1 dd_Smed_v4_5842_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Human
Match: TDRD9 (tudor domain containing 9 [Source:HGNC Symbol;Acc:HGNC:20122])

HSP 1 Score: 523.472 bits (1347), Expect = 4.002e-159
Identity = 426/1339 (31.81%), Postives = 672/1339 (50.19%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQ--LEMGSVLIFLPGLSDITELNEYLL-LGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDF--STLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----------LKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVLMVDH-QDKI-LNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINF-MKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGID-SEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI R++++++  IE+N  ++I G+TG GKSTQ+PQ+ILD+        +IVVTQPR+I A S+A  ++ ER W +G  VGYQVGL++  + +T + ++TTGVLL++++  ++L ++THII+DEVHER  +MD LL VV+ LL  ++R  K++LMSAT++  +F+ YF+  +  K     P  IF +EGK   VEE++L+DL  +   + +P+   + ++P +T ++ E+   L+      +M  S  K  +  Q  LE  SVL+FLPGL +I  ++E L  L +KR                       L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRL+ +  + N + +   PE+L  PL   IL++K  +  +PRALL  AL  P L DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP++  +GKLI LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD + ++  FK W    +TG  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+ VD     +D++   +  F                       +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N        T+      +V M+IKM Q              ++ ++    ++    T++    +K+++      P+   + +  ++     ++    + I VT   E G F+G   +E ++E  +KL  EI+        LV        D  CLAP+    +  ++RA+++  S  +  VFFVDYGN   +  + L ++P   L+  P  A++F + +M+P   +      WS    + F + ++       GC    K++SVV + + V V      QD I + + LI    AE  EESY S+Q + +     +K   ++     ++  + F MK+                ES S N+    L    C  +       L  P +PY +K H +T   K R V +  +S+NS+II   P++   RM+VA  +  +     G+ +LLR T+LMP IPG P L++++F P  EL  D+    Y G  CGLG + + G  + P +DME+  DV+F   D+  VN +R+ +N
Sbjct:  133 PISRYKEEVVSLIESNSVVIIHGATGSGKSTQLPQYILDHYVQRSAYCSIVVTQPRKIGASSIARWISKERAWTLGGVVGYQVGLEKIATEDTRLIYMTTGVLLQKIVSAKSLMEFTHIIIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVVLMSATISCKEFADYFAVPVQNKMN---PAYIFEVEGKPHSVEEYYLNDLEHIHHSKLSPH---LLEEPVITKDIYEVAVSLIQMFDDLDMKESGNKAWSGAQFVLERSSVLVFLPGLGEINYMHELLTSLVHKR-----------------------LQVYP-------------------------LHSSVALEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCNQRKGRAGRVSRGYCYRLVHKDFWDNSIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPGLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVNQQLGKLIVLGHVFGCLDECLIIAAALSL-KNFFAMPF----------------RQHLDGYRNKVNFSGSSKSDCIALVEAFKTWKACRQTGELRYPKDELNWGRLNYIQIKRIREVAELYEELKTRISQ-FNMHVDSRRPVMDQEYIYKQRF-----------------------ILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGKDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRN-------PTERFKTLPAVYMAIKMSQLKVSLELSVHSAEEIEGKVQGMNVSKLRNTRVNVDFQKQTVD-----PMQVSFNTSDRS----QTVTDLLLTIDVTEVVEVGHFWGYRIDENNSEILKKLTAEINQL-----TLVPLPTHPHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLLMEIPCQFLE-LPFQALEFKICKMRPSAKSLVCGKHWSDGASQWFASLVS-------GCTLLVKVFSVVHSVLHVDVYQYSGVQDAINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENM-----TDGSVPFPMKDDEKYLIRILL------ESFSTNK----LGTPNCKAE-------LHGPFNPYELKCHSLTRISKFRCVWIEKESINSVIISDAPEDLHQRMLVAASLSINA---TGSTMLLRETSLMPHIPGLPALLSMLFAPVIELRIDQNGKYYTGVLCGLGWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAIN 1294          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Human
Match: TDRD9 (tudor domain containing 9 [Source:HGNC Symbol;Acc:HGNC:20122])

HSP 1 Score: 315.849 bits (808), Expect = 8.770e-90
Identity = 294/976 (30.12%), Postives = 460/976 (47.13%), Query Frame = 2
Query:  878 TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQ--LEMGSVLIFLPGLSDITELNEYLL-LGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFS--TLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----------LKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVLMVDH-QDKI-LNEELILMRIAEYAEESYASRQDNILRTKCN 3703
             K++LMSAT++  +F+ YF+  +  K     P  IF +EGK   VEE++L+DL  +   + +P+   + ++P +T ++ E+   L+      +M  S  K  +  Q  LE  SVL+FLPGL +I  ++E L  L +KR                       L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRL+ +  + N + +   PE+L  PL   IL++K  +  +PRALL  AL  P L DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP++  +GKLI LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD + ++  FK W    +TG  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+ VD     +D++   +  F                       +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N        T+      +V M+IKM Q              ++ ++    ++    T++    +K+++      P+   + +  ++     ++    + I VT   E G F+G   +E ++E  +KL  EI+        LV        D  CLAP+    +  ++RA+++  S  +  VFFVDYGN   +  + L ++P   L+  P  A++F + +M+P   +      WS    + F + ++       GC    K++SVV + + V V      QD I + + LI    AE  EESY S+  NILR   N
Sbjct:    8 VKVVLMSATISCKEFADYFAVPVQNKMN---PAYIFEVEGKPHSVEEYYLNDLEHIHHSKLSPH---LLEEPVITKDIYEVAVSLIQMFDDLDMKESGNKAWSGAQFVLERSSVLVFLPGLGEINYMHELLTSLVHKR-----------------------LQVYP-------------------------LHSSVALEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCNQRKGRAGRVSRGYCYRLVHKDFWDNSIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPGLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVNQQLGKLIVLGHVFGCLDECLIIAAALSL-KNFFAMPF----------------RQHLDGYRNKVNFSGSSKSDCIALVEAFKTWKACRQTGELRYPKDELNWGRLNYIQIKRIREVAELYEELKTRISQ-FNMHVDSRRPVMDQEYIYKQRF-----------------------ILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGKDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRN-------PTERFKTLPAVYMAIKMSQLKVSLELSVHSAEEIEGKVQGMNVSKLRNTRVNVDFQKQTVD-----PMQVSFNTSDRS----QTVTDLLLTIDVTEVVEVGHFWGYRIDENNSEILKKLTAEINQL-----TLVPLPTHPHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLLMEIPCQFLE-LPFQALEFKICKMRPSAKSLVCGKHWSDGASQWFASLVS-------GCTLLVKVFSVVHSVLHVDVYQYSGVQDAINIRDVLIQQGYAELTEESYESKV-NILRAAIN 830          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Human
Match: TDRD9 (tudor domain containing 9 [Source:HGNC Symbol;Acc:HGNC:20122])

HSP 1 Score: 308.145 bits (788), Expect = 1.780e-87
Identity = 287/960 (29.90%), Postives = 453/960 (47.19%), Query Frame = 2
Query:  893 MSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQ--LEMGSVLIFLPGLSDITELNEYLL-LGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFS--TLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----------LKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDH-QDKI-LNEELILMRIAEYAEESYASRQDN 3682
            MSAT++  +F+ YF+  +  K     P  IF +EGK   VEE++L+DL  +   + +P+   + ++P +T ++ E+   L+      +M  S  K  +  Q  LE  SVL+FLPGL +I  ++E L  L +KR                       L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRL+ +  + N + +   PE+L  PL   IL++K  +  +PRALL  AL  P L DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP++  +GKLI LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD + ++  FK W    +TG  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+ VD     +D++   +  F                       +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N        T+      +V M+IKM Q              ++ ++    ++    T++    +K+++      P+   + +  ++     ++    + I VT   E G F+G   +E ++E  +KL  EI+        LV        D  CLAP+    +  ++RA+++  S  +  VFFVDYGN   +  + L ++P   L+  P  A++F + +M+P   +      WS    + F + ++  T   +  K++SVV + + V V      QD I + + LI    AE  EESY S+Q +
Sbjct:    1 MSATISCKEFADYFAVPVQNKMN---PAYIFEVEGKPHSVEEYYLNDLEHIHHSKLSPH---LLEEPVITKDIYEVAVSLIQMFDDLDMKESGNKAWSGAQFVLERSSVLVFLPGLGEINYMHELLTSLVHKR-----------------------LQVYP-------------------------LHSSVALEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCNQRKGRAGRVSRGYCYRLVHKDFWDNSIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPGLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVNQQLGKLIVLGHVFGCLDECLIIAAALSL-KNFFAMPF----------------RQHLDGYRNKVNFSGSSKSDCIALVEAFKTWKACRQTGELRYPKDELNWGRLNYIQIKRIREVAELYEELKTRISQ-FNMHVDSRRPVMDQEYIYKQRF-----------------------ILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGKDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRN-------PTERFKTLPAVYMAIKMSQLKVSLELSVHSAEEIEGKVQGMNVSKLRNTRVNVDFQKQTVD-----PMQVSFNTSDRS----QTVTDLLLTIDVTEVVEVGHFWGYRIDENNSEILKKLTAEINQL-----TLVPLPTHPHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLLMEIPCQFLE-LPFQALEFKICKMRPSAKSLVCGKHWSDGASQWFASLVSGCT---LLVKVFSVVHSVLHVDVYQYSGVQDAINIRDVLIQQGYAELTEESYESKQSH 812          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Human
Match: DHX36 (DEAH-box helicase 36 [Source:HGNC Symbol;Acc:HGNC:14410])

HSP 1 Score: 248.054 bits (632), Expect = 6.590e-68
Identity = 220/693 (31.75%), Postives = 323/693 (46.61%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQ----------PRLTAELKEMIYQ--------------LLMFITYTEMSDTKCTNINQL-----------EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALH 2392
            P +  +K+++  I+N+Q  VI G TGCGK+TQV QFILDN           IV TQPRRI+AISVA  VA+ER    GS    GYQ+ L  R    +  I + TTG++L+ L  +  L+  +HI+LDE+HER++  D+L++VVKDLL   +  K+ILMSAT+ A+KFS YF               +  I G  FPV E+ L+D+  +   +  P   +   Q           R   E KE IY+                  +   EM +    ++N +           E G++L+FLPG  +I+ L++ L+                      S  +F                        D F ++ LHS +    Q + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D + + S++ AEW SK++ KQR GRAGRV+ G  Y L +    + LD++  PEIL  PL ++ L+IK       A  L R +D PS E +  +   L E  AL                                Q ELT +G  ++ LP++ H+GK+I  G  F  L+  + IA+ L+     F  PF     K           K  DA  K+  L++   SD LT++N F+ W +  + G FR  +D   +C   +L    L 
Sbjct:  122 PSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFGN-----------CPMIHIPGFTFPVVEYLLEDV--IEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGAILVFLPGWDNISTLHDLLM----------------------SQVMFK----------------------SDKFLIIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRHLMELNALDK------------------------------QEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLS-----FKDPFVIPLGKE----------KIADARRKE--LAKDTRSDHLTVVNAFEGWEEARRRG-FRYEKD---YCWEYFLSSNTLQ 706          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Human
Match: DHX36 (DEAH-box helicase 36 [Source:HGNC Symbol;Acc:HGNC:14410])

HSP 1 Score: 247.669 bits (631), Expect = 1.170e-66
Identity = 220/693 (31.75%), Postives = 323/693 (46.61%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQ----------PRLTAELKEMIYQ--------------LLMFITYTEMSDTKCTNINQL-----------EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALH 2392
            P +  +K+++  I+N+Q  VI G TGCGK+TQV QFILDN           IV TQPRRI+AISVA  VA+ER    GS    GYQ+ L  R    +  I + TTG++L+ L  +  L+  +HI+LDE+HER++  D+L++VVKDLL   +  K+ILMSAT+ A+KFS YF               +  I G  FPV E+ L+D+  +   +  P   +   Q           R   E KE IY+                  +   EM +    ++N +           E G++L+FLPG  +I+ L++ L+                      S  +F                        D F ++ LHS +    Q + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D + + S++ AEW SK++ KQR GRAGRV+ G  Y L +    + LD++  PEIL  PL ++ L+IK       A  L R +D PS E +  +   L E  AL                                Q ELT +G  ++ LP++ H+GK+I  G  F  L+  + IA+ L+     F  PF     K           K  DA  K+  L++   SD LT++N F+ W +  + G FR  +D   +C   +L    L 
Sbjct:  208 PSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFGN-----------CPMIHIPGFTFPVVEYLLEDV--IEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGAILVFLPGWDNISTLHDLLM----------------------SQVMFK----------------------SDKFLIIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRHLMELNALDK------------------------------QEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLS-----FKDPFVIPLGKE----------KIADARRKE--LAKDTRSDHLTVVNAFEGWEEARRRG-FRYEKD---YCWEYFLSSNTLQ 792          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Celegans
Match: rha-1 (ATP-dependent RNA helicase A [Source:UniProtKB/Swiss-Prot;Acc:Q22307])

HSP 1 Score: 219.164 bits (557), Expect = 2.697e-57
Identity = 194/703 (27.60%), Postives = 320/703 (45.52%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNE-TVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYD-----------------------------VCQQPRLTAELKEMIYQLL-----MFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRL 2431
            P+ ++ ++I++ +  N+  +I+G TGCGKSTQV QF+L++    +N    N VV+QPRRI+AIS+A  VA+ERG E+G   GY V  D         I F T GVLL  +     L   +H+I+DE+HERDVD D +L V+++++      +++LMSAT+  D F+ +FS   D   + P P  +  + G+ FPV+ F+L+D+  L   Q  P   D                             +   P +   LK  + ++        +    ++D     ++    G+VL+FLPG ++I  L                                           R+LE ++  +   + + +L LHS +   EQ++ F     G+RKII+STNIAE+SIT+ D+ YVID C  K   Y    +       WASK++  QR GRAGRVR G  + L S+  +  LD+    E+L  PL Q+ L IK          L +AL  P  + +  +   L+  GAL   RN                             ELT +G++++ +P++  + K++ LG A         +AS ++     F  PF   +  +++ S              + + + +K+SD + +++  + + + ++ GA  +   E ++C    L    L     +TD  +R+L
Sbjct:  382 PVAQYRENIVQTVAENRVTLIKGETGCGKSTQVAQFLLESFLENSNGASFNAVVSQPRRISAISLAERVANERGEEVGETCGYNVRFDSATPRPYGSIMFCTVGVLLRMM--ENGLRGISHVIIDEIHERDVDTDFVLIVLREMISTYRDLRVVLMSATIDTDLFTNFFSSIPD---VGPTP--VITMHGRTFPVQSFYLEDI--LHNLQHMPEEPDQKKRKKGGPPPPDDDEGDEEVDDKGRNMNILTDPSINESLKTAMSRISEKDIPFGVIEAILNDIASRGVD----GAVLVFLPGWAEIMTL-----------------------------------------CNRLLEHQEFGQA--NKYEILPLHSQLTSQEQRKVFNHYP-GKRKIIVSTNIAETSITIDDVVYVIDSCKAKERMYTSNNNMVHFATVWASKTNVIQRRGRAGRVRAGYAFHLCSKMRFEALDDHGTAEMLRIPLHQIALTIKLLRLGSVGEFLGKALQPPPYDMVVESEAVLQAMGALD--RNL----------------------------ELTSLGKMLARMPIEPVIAKVLILGTALGAGSVMCDVASAMS-----FPTPFVPREKHHSRLSGT------------QRKFAGNKFSDHVAIVSVIQGYREAVQMGASAA---EREFCERYSLSNPVLK----MTDGARRQL 973          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Celegans
Match: smgl-2 (pep chromosome:WBcel235:IV:3726112:3735495:1 gene:WBGene00021365.1 transcript:Y37E11AM.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:smgl-2)

HSP 1 Score: 194.512 bits (493), Expect = 6.712e-50
Identity = 189/670 (28.21%), Postives = 308/670 (45.97%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN--RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLW-YQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            PI     +I+  ++ NQ L++ G TGCGKSTQVPQ++L   F       +  TQPRRIA  ++A  VA E   + GS V +Q+  +   S +T + F+T G+LL Q+  +  L  Y  IILDEVHER +  DLL+ +++DL       K+ILMSAT+  D F  YF    +   +  +PG +F I+ +  P+++F         I Q    ++ +  +P               ++   E+ D +  +  +   G  LIFL G+++I+ + E+L             K      NG                                + +L LHS++ + EQ + F+   +G RK ILSTN+AE+S+T+  I++VID   +  ++++  T    L   W SK+S  QR GRAGR   G+ YRL SQ  + ++D+F   EI    L ++ L++   N   DPR      ++ PS + +      LK    L   R +I             LT             LT +G ++S LP+++ + K++  G   D LE  + +A+ L+V       PF      N  Y       + L+  E++  L+ S   D  T+++ F+ W  Q+   G  R      +W     +D   L+E+  L  + ++ L++
Sbjct:  145 PIAERAGEIVELLKTNQVLIVAGDTGCGKSTQVPQYLLKAGFTG-----VACTQPRRIACTALARRVAYETLNQYGSEVAFQIRFETTKSQKTKLLFLTEGLLLRQMEKDSLLEKYNVIILDEVHERHLTSDLLIGLLRDLCTKRDDLKLILMSATINLDLFKGYF----EGAPVVQVPGRLFPIDVRWHPIKQF---------IDQSDKKTHKIDPEP---------------YLKILELIDKQFPSTQR---GDALIFLNGVAEISMVAEHL-------------KNYAELTNG--------------------------------WIILMLHSTLSVEEQDKVFDQAPVGIRKCILSTNVAETSVTIDGIRFVIDSGKVNLIKHEPGTGTQKLTEFWVSKASANQRKGRAGRTGPGICYRLYSQEQFEKMDDFTVSEINRVSLQEMALKMISLNLGLDPRTF--PFIEKPSEDVLNEGLEVLKFQRVLRSDRGDI-------------LT-------------LTALGNMVSKLPVEVPIAKMLVYGCVVDELEVMLTVAAGLSV-----QSPF-----TNRSY-------RELEIVERRASLT-SPLGDPFTLISIFREWVLQKAFEGTAR------RWTMENGIDEHRLYEISKLRAQYRQILED 681          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Celegans
Match: mog-4 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 [Source:UniProtKB/Swiss-Prot;Acc:O45244])

HSP 1 Score: 184.882 bits (468), Expect = 5.309e-47
Identity = 171/662 (25.83%), Postives = 287/662 (43.35%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEI 2419
            P++      +  ++ +Q L+I+G TG GK+TQ+PQ++ +  F       I  TQPRR+AA+SVA  VA E G ++G+ VGY +  +   S +TV+ ++T G+LL + ++   L  Y+ +++DE HER +  D+L  +VKD+       K+++ SAT+ A+KFS +F               IFRI G+ FPV+ ++                    Q P       E  Y     +T  ++      ++ Q   G +L+FL G  +I  + E L+   +R   +  + ++                                         L +++++    Q + FE      RK++L+TNIAE+S+T+  I YVID    K+  +D  +    L     SK++  QRAGRAGR   G  +RL + + Y ++L+E   PEI    L  V+L +K             LD P  E +      L   GAL                              + +GELT +GR ++  P D  M K+I     ++  EE + IA+ L+ + ++F +P            KA  Q+   D+  K      S   D +T++N +  W +     +F  R     WC   Y+  + +     + D++
Sbjct:  365 PVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGK-RIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDD-----------APIFRIPGRRFPVDIYY-------------------TQAP-------EADYVDAAIVTIMQI------HLTQPLPGDILVFLTGQEEIETVQEALM---ERSKALGSKIKELIP--------------------------------------LPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFD-FLDPPPQETLVIALEQLYALGAL------------------------------NHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRP------------KA--QVIHADSARKGFW---SPAGDHITLMNVYNKWQE----SSFSQR-----WCVENYVQHRTMKRARDVRDQL 884          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Celegans
Match: let-355 (pep chromosome:WBcel235:I:5472321:5479438:-1 gene:WBGene00020263.1 transcript:T05E8.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-355)

HSP 1 Score: 179.104 bits (453), Expect = 1.712e-45
Identity = 145/494 (29.35%), Postives = 235/494 (47.57%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRT----KIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGAL 1903
            PI   E+ ++ E+ + +TL++ G TG GKSTQVPQ  +    AN    +I VTQPRR+AAIS+A  VA+E G  IG  VGY V  +    ++T I ++T G++L + + +  L  Y+ +I+DE HER +  D+L+ +++        T    ++I+MSAT+ A+KF  YF+              +  + G+ FP+E F ++  PK+    +  +S              + +Y  ++ + Y  +++ K  +I        L+FL G  +I  +   L                    NG   A                          D    + L++++   +QK AF     G RK+I+STNIAE+S+T+  I+ VID   +K  R++       LK    SK+  KQRAGRAGR   G  YRL S+  +++ +    PEIL   L+   L + +   ++P  L  + +D P  ++I    L L   GA+
Sbjct:  162 PIDAVEQQLMYELASQETLIVIGETGSGKSTQVPQLCVRAGIANSG--SIAVTQPRRVAAISLASRVATEMGTNIGGIVGYHVRFENATCHKTKIEYMTDGIVLRKALVSPLLDKYSCVIIDEAHERSLHSDVLMCILRQCQDQRRETNNPLRLIIMSATLQAEKFQSYFNN-----------AKVVLVAGRTFPIEVFHVN--PKI----NKSFSST------------DYVYNAVICVKYVHLTEPKGRDI--------LVFLTGSEEIEAVASQLA-----------------ELNGSLPA------------------------SADVLMPVPLYAALRPEKQKEAFRKTPQGARKVIISTNIAETSVTIPGIRVVIDSGKVKTKRFEAFNRIDVLKVHNVSKAQAKQRAGRAGRDAPGKCYRLYSREDFHKFEAENMPEILRCNLSATFLELMKLGMKNPHRL--KLIDPPETDNINAALLELTSLGAI 573          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 174.096 bits (440), Expect = 1.688e-43
Identity = 201/770 (26.10%), Postives = 326/770 (42.34%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEM-GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQ-RALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE-----KFNITVDFSTLD-KKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIA---GAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPM 2710
            P+    + ++  I  N  ++I G TG GK+TQ+ Q++L++ F +   +    TQPRR+AA+SVA  VA E G ++G  VGY +  +   S +T+I ++T G+LL + + + +L  Y+ II+DE HER ++ D+L  ++++++      K+I+ SAT+ ADKF+ +F                F I G+ FPVE F                        R   E             Y + +  +   I+   M G +LIF+PG  DI    E +     +E              G+     PL + P                         ++S +    Q + F+    G RK I++TNIAE+S+TV  I +VID    K   Y+      +L     S++S  QR GRAGR   G  YRL ++  + ++L +   PEI    L  V+L +K    D   LL+   +D P  +++  +   L   GAL                                 G+LT +GR +   P+D  + K++ +       +E + I S L+V  +IF +P                + +  DA ++K ++ E   SD LT LN +  W         R+ +   KWC+  YL  +AL +V     E++ +LKE     K  +  + S  D  + C   A+F  +A  +  I   V  +T     L  T A     F P+Y +         + M+    +D     E+G  PM
Sbjct:  442 PVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIG--CTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNC----------PTFTIPGRTFPVELF----------------------HARTPVE------------DYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMI-----KEKL------------GELDEAPPLAVLP-------------------------IYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDD--LLKFHFMDAPPQDNMLNSMYQLWTLGALDN------------------------------TGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVP-AIFFRP--------------KGREEEADAKKEKFQVPE---SDHLTFLNVYIQW---------RTHKYSAKWCADNYLHVKALKKVR----EVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYFH-NAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELG--PM 1057          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Fly
Match: spn-E (gene:FBgn0003483 transcript:FBtr0083183)

HSP 1 Score: 417.927 bits (1073), Expect = 1.777e-121
Identity = 391/1356 (28.83%), Postives = 618/1356 (45.58%), Query Frame = 2
Query:  440 IHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNE-TVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQ--PRLTAELKEMIYQLLMFITYTEMS---DTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYN-QLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDD--AMRTFDGLDPFQCVEIGNL-PMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRN--------------TKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFE----LTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFY---GIYEEEKDNEQKLF---MEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQNCT-----VFFVDYGNSVTLQYNQLFDLPDFLLKS---CPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQ--------------TVVLSAPCHPYIMKFHGITE-SCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIR 4327
            I+   ++IL  I  +  ++I+G TGCGK+TQVPQ+ILD A+ + +  NIVVTQPRRIAAIS+A  V  ER W+  +   +QVGL R  S E T + + TTGVLL  LI+N+TLT YTHI+LDEVHERD +MD LL VV+ LL  ++R  KIILMSAT+ A + S YF+      T   +P  I     +   +E+F+ D L  +   ++     DV  Q  P +         ++++ I   E      ++ +    L  G+VLIFLPG+ +I  + E L                                   +C+   LE++   KV      ++   S +    Q+  F     G RKIIL+TNIAESSITV D+ YVID C+ K    D  + FSSL+  WASK++C+QRAGR GR+R+G VYR+++++ Y  ++ EF  PE+L  PL   +L+ K  N   P  +L  AL  P+L DI  T L LKE GAL +  + I                   P+D    G+LT+ G ++S LP+D    +LI LGY F++LEE IIIA+ L       S P          ++    + +  D+F      S+   SDL+ +   +  +   ++ G    +E   +W    ++  ++L E+ +L  E++ R      I    +     D  E A                       ++L++ IAGAFYPNYF R      + D    +T  G DP + V   N  P   G LY   I + F+   ++  P+   V  +                +G  K+ P +G   +E          V  ++ M Q    +P I +      ++  ++  +  ++E   I      PLN +        +  PS+    I   +T    CG F+     +EE   N  ++F    ++ ++VT+A  + K  +       LA  +  F RA +I   NQ+       V F+DYGN   L    +  +P  L +     P    +  L+ ++P +    +++WS    ++      C     +  ++YS+ +N   V  +++  +D I+N++L+ + +   ++E Y SR+D+  R +               ES  N                     S++Q + ++      C    +PQ               V+L  P  P       IT     + V +   SVN++++D +PQ+H   ++VAH +  S  G+    L  R TTLMP++ GF  L+ ++F+P  +L  +K  T Y+    GLG D +   P    +D+ +  DV     D+  +N IR
Sbjct:  117 IYAKREEILAAINAHPVVIIKGETGCGKTTQVPQYILDEAYKSGKYCNIVVTQPRRIAAISIANRVCQEREWQQNTVCSFQVGLHRPNSLEDTRLLYCTTGVLLNNLINNKTLTHYTHIVLDEVHERDQNMDFLLIVVRRLLATNSRHVKIILMSATIDAKELSDYFT------TTNSIPPVITTNHRRKHSIEKFYRDQLGSIIWNEE-----DVGHQQVPEINKHGYRAAVKIIVIIDNMERKAAIQSRQSYDEALRYGAVLIFLPGIYEIDTMAENL-----------------------------------TCM---LENDPNIKV-----SIVRCFSLMTPENQRDVFNPPPPGFRKIILTTNIAESSITVPDVSYVIDFCLAKVKVTDTASSFSSLRLTWASKANCRQRAGRVGRLRSGRVYRMVNKHFYQREMPEFGIPEMLRLPLQNSVLKAKVLNMGSPVEILALALSPPNLSDIHNTILLLKEVGALYLTVDGIYD-----------------PLD----GDLTYWGTIMSRLPLDTRQSRLIILGYIFNMLEEAIIIAAGL-------STPGL--------FAHEGGRSQLGDSFWMHYIFSDGSGSDLVAIWRVYLTYLNIVENG--HDQESAIRWAKRFHVSLRSLKEIHLLVQELRVRCTHLGLIPFPVNPNQMMDDREKA-----------------------IMLKVIIAGAFYPNYFTRSKESCADTDRNIYQTISGHDPCRTVYFTNFKPAYMGELYTRRIKELFQE--VRIPPENMDVTFQEGSQKVFVTFKQDDWIEGSSKYVPVSGRVQSE----------VYKAVMMRQNRVERP-IHIMNPSAFMSYVQQRGIGDVIEGRWIPPTK--PLNVE-------LLALPSVFDKTISGSITCIVNCGKFFFQPQSFEECIRNMSEIFNAPQQLRNYVTNASAIAKGMM------VLAKRDSYFQRATVIRPENQSNRQPMFYVRFIDYGNCTLLPMQLMRLMPRELTEQYGDLPPRVFECRLAMVQPSSVVSGNNRWSTAANDMLKTVAQCGL---IDIEVYSLFNN---VAAVLIHMRDGIINDKLVELMLCRRSDEDYMSRKDHDFRLR-------------RQESARNL--------------------STAQRQQINEEYLRSC---QLPQDHDLPPPPLEKCKTVVMLKGPNSPLECTMRSITRVGLSKRVNIDHLSVNALLLDADPQDHHDHLIVAHEIAESRNGQT---LTARGTTLMPNVQGFGALMVMLFSPTMQLKCNKEGTSYVSVLGGLGCDPDTNEPYFAEHDVLINLDVNILEDDVILINQIR 1284          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Fly
Match: Rhau (gene:FBgn0032883 transcript:FBtr0081459)

HSP 1 Score: 245.743 bits (626), Expect = 1.309e-66
Identity = 232/764 (30.37%), Postives = 350/764 (45.81%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAND--EPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLD-RKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL--------------------PKLGICQDA---PY------SYD--VCQQPRLT----AELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFN-ITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPN 2608
            P  ++  DI++ +  NQ ++I GSTGCGK+TQVPQ +LD+A +        I+ TQPRRI+AI++A  V+ ER   +G+ VGYQ+ L+ RK      I++ TTGVLL+QL  +  + + + +ILDE+HER V+ DLL+ ++K +L H    K+ILMSATV    F  YF+              +FRIEG MFPV+  +L+D+                    P+  +  +A   PY      SYD  V  + RL      E  + I  L+ +I         C N  +   G++L+FLPG   I++L  Y +L  K +     R RD         A+FP                              LHS +   EQ+  F     G+RK+I+ST IAE+S+T+ D+ YVI+    K   YD ET+  SL   W +K++ +QR GRAGRVR G+ Y L S+   +++D+   PEIL   L  +IL +K  +  DP   LQ  ++ P+ E I      LK   AL                                 G LT +G  ++ LP+D  MGK+I +   F  L+     A+ L+     F  PF+S   K ++              E K R++ +  SD L + N    +     + A      E  +C   +L    L ++E        R+K +F+ +  ++  L   +C++ A         SN +S       +I LL+  I    YPN
Sbjct:  154 PTMKYADDIIQAVRENQVILIVGSTGCGKTTQVPQILLDDAISRGCASSCRIICTQPRRISAIAIAEWVSYERCESLGNSVGYQIRLESRKARERASITYCTTGVLLQQLQSDPLMHNLSVLILDEIHERSVETDLLMGLLKVILPHRPDLKVILMSATVREQDFCDYFNN-----------CPMFRIEGVMFPVKMLYLEDVLSKTNYEFQKFRDRRPKRDPPERRMKHEAMIEPYLRRIRNSYDSRVLDKLRLPESEGCEDIDFIADLVYYI---------CENEPE---GAILVFLPGYDKISQL--YNILD-KPKTSKGQRWRDHM-------AVFP------------------------------LHSLMQSGEQQAVFRRPPAGQRKVIISTIIAETSVTIDDVVYVINSGRTKATNYDIETNIQSLDEVWVTKANTQQRRGRAGRVRPGICYNLFSRAREDRMDDIPTPEILRSKLESIILSLKLLHIDDPYRFLQTLINAPNPEAIKMGVELLKRIEALD------------------------------QTGTLTPLGMHLAKLPIDPQMGKMILMSALFCCLDPITSAAAALS-----FKSPFYSPLGKESRVD------------EIKRRMARNMRSDHLMVHNTIIAYRDSRYSHA------ERDFCYKNFLSSMTLQQLE--------RMKNQFSELLYNYKFLASSNCKDAA---------SNKNSE------KIPLLRAIIGAGLYPN 778          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Fly
Match: Rhau (gene:FBgn0032883 transcript:FBtr0335147)

HSP 1 Score: 245.743 bits (626), Expect = 1.309e-66
Identity = 232/764 (30.37%), Postives = 350/764 (45.81%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAND--EPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLD-RKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL--------------------PKLGICQDA---PY------SYD--VCQQPRLT----AELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFN-ITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPN 2608
            P  ++  DI++ +  NQ ++I GSTGCGK+TQVPQ +LD+A +        I+ TQPRRI+AI++A  V+ ER   +G+ VGYQ+ L+ RK      I++ TTGVLL+QL  +  + + + +ILDE+HER V+ DLL+ ++K +L H    K+ILMSATV    F  YF+              +FRIEG MFPV+  +L+D+                    P+  +  +A   PY      SYD  V  + RL      E  + I  L+ +I         C N  +   G++L+FLPG   I++L  Y +L  K +     R RD         A+FP                              LHS +   EQ+  F     G+RK+I+ST IAE+S+T+ D+ YVI+    K   YD ET+  SL   W +K++ +QR GRAGRVR G+ Y L S+   +++D+   PEIL   L  +IL +K  +  DP   LQ  ++ P+ E I      LK   AL                                 G LT +G  ++ LP+D  MGK+I +   F  L+     A+ L+     F  PF+S   K ++              E K R++ +  SD L + N    +     + A      E  +C   +L    L ++E        R+K +F+ +  ++  L   +C++ A         SN +S       +I LL+  I    YPN
Sbjct:  154 PTMKYADDIIQAVRENQVILIVGSTGCGKTTQVPQILLDDAISRGCASSCRIICTQPRRISAIAIAEWVSYERCESLGNSVGYQIRLESRKARERASITYCTTGVLLQQLQSDPLMHNLSVLILDEIHERSVETDLLMGLLKVILPHRPDLKVILMSATVREQDFCDYFNN-----------CPMFRIEGVMFPVKMLYLEDVLSKTNYEFQKFRDRRPKRDPPERRMKHEAMIEPYLRRIRNSYDSRVLDKLRLPESEGCEDIDFIADLVYYI---------CENEPE---GAILVFLPGYDKISQL--YNILD-KPKTSKGQRWRDHM-------AVFP------------------------------LHSLMQSGEQQAVFRRPPAGQRKVIISTIIAETSVTIDDVVYVINSGRTKATNYDIETNIQSLDEVWVTKANTQQRRGRAGRVRPGICYNLFSRAREDRMDDIPTPEILRSKLESIILSLKLLHIDDPYRFLQTLINAPNPEAIKMGVELLKRIEALD------------------------------QTGTLTPLGMHLAKLPIDPQMGKMILMSALFCCLDPITSAAAALS-----FKSPFYSPLGKESRVD------------EIKRRMARNMRSDHLMVHNTIIAYRDSRYSHA------ERDFCYKNFLSSMTLQQLE--------RMKNQFSELLYNYKFLASSNCKDAA---------SNKNSE------KIPLLRAIIGAGLYPN 778          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Fly
Match: CG1582 (gene:FBgn0030246 transcript:FBtr0073403)

HSP 1 Score: 246.514 bits (628), Expect = 1.072e-65
Identity = 212/687 (30.86%), Postives = 310/687 (45.12%), Query Frame = 2
Query:  461 ILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF---------ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFI-------------------------TYTEMSDTKCTNINQLE-------------------------MGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCP-PEILTGPLTQVILRIKEF----NRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAF 2329
            IL  IE++  +VI G TGCGKSTQVPQFILDN F          N   V I+ TQPRR++AI VA  VA+ER   IG  VGYQ+ L+ K S  T +SF TTG+LL +L  +  L   TH+I+DEVHER  + D LL ++K+LL      K+ILMSAT+ A  FS YF               +  I G+ FPV++ FL+D+ ++    D    YD     +L  + +E++ + L +                           Y E S   C +I  +E                          G++LIFLPG  +I  +++ LL                        A+F  R                       F L+ LHS++   +Q   F+    G+RKI+LSTNIAE+S+T+ D  +V+D  ++K   +D   +  SL   W S+++ KQR GRAGRV  GV   L + Y Y       P PEI   PL Q++LRIK      +R+  ++L   L+ P+ + +      L++ GAL                                + +LT +G  +++LP+D+ +GKL+  G  F  L+  + IA+CL+        PF S   K T+  K               R+     SD LT+LN ++ W    + G +
Sbjct:  462 ILALIESSPVVVISGETGCGKSTQVPQFILDNWFFRALQLPAKENLPHVEIICTQPRRLSAIGVAERVAAERLDRIGQLVGYQIRLENKVSQSTRLSFCTTGILLRRLASDPLLGSVTHVIVDEVHERSEESDFLLLILKNLLRERKDLKVILMSATLNAALFSDYFGG-----------APVLDIPGRTFPVQQLFLEDILEMS---DFVMEYDTKYCRKLKKQEQEILERELEYADVQASGEAPGKKIKDEKLTLAETYQRYAEYSKPTCKSIYLMEPMTINPELIESVLKYIVEGSHDWPREGTILIFLPGFGEIQSVHDSLL----------------------DNALFSPR--------------------AGKFILVPLHSALSGEDQALVFKKAPPGKRKIVLSTNIAETSVTIDDCVFVVDCGLMKEKCFDSNRNMESLDLVWVSRANAKQRKGRAGRVMPGVCIHLYTSYRYQYHILAQPVPEIQRVPLEQIVLRIKTLQTFASRNTLSVLLETLEAPTEDSVLGALTRLRDVGALDA------------------------------EDQLTPLGHHLAALPVDVRIGKLMLYGAIFQCLDSVLTIAACLS-----NKSPFVSPLNKRTEADKCK-------------RMFALGNSDHLTVLNAYRKWLDVARRGNY 1044          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Fly
Match: CG1582 (gene:FBgn0030246 transcript:FBtr0339768)

HSP 1 Score: 246.514 bits (628), Expect = 1.072e-65
Identity = 212/687 (30.86%), Postives = 310/687 (45.12%), Query Frame = 2
Query:  461 ILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF---------ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFI-------------------------TYTEMSDTKCTNINQLE-------------------------MGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCP-PEILTGPLTQVILRIKEF----NRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAF 2329
            IL  IE++  +VI G TGCGKSTQVPQFILDN F          N   V I+ TQPRR++AI VA  VA+ER   IG  VGYQ+ L+ K S  T +SF TTG+LL +L  +  L   TH+I+DEVHER  + D LL ++K+LL      K+ILMSAT+ A  FS YF               +  I G+ FPV++ FL+D+ ++    D    YD     +L  + +E++ + L +                           Y E S   C +I  +E                          G++LIFLPG  +I  +++ LL                        A+F  R                       F L+ LHS++   +Q   F+    G+RKI+LSTNIAE+S+T+ D  +V+D  ++K   +D   +  SL   W S+++ KQR GRAGRV  GV   L + Y Y       P PEI   PL Q++LRIK      +R+  ++L   L+ P+ + +      L++ GAL                                + +LT +G  +++LP+D+ +GKL+  G  F  L+  + IA+CL+        PF S   K T+  K               R+     SD LT+LN ++ W    + G +
Sbjct:  462 ILALIESSPVVVISGETGCGKSTQVPQFILDNWFFRALQLPAKENLPHVEIICTQPRRLSAIGVAERVAAERLDRIGQLVGYQIRLENKVSQSTRLSFCTTGILLRRLASDPLLGSVTHVIVDEVHERSEESDFLLLILKNLLRERKDLKVILMSATLNAALFSDYFGG-----------APVLDIPGRTFPVQQLFLEDILEMS---DFVMEYDTKYCRKLKKQEQEILERELEYADVQASGEAPGKKIKDEKLTLAETYQRYAEYSKPTCKSIYLMEPMTINPELIESVLKYIVEGSHDWPREGTILIFLPGFGEIQSVHDSLL----------------------DNALFSPR--------------------AGKFILVPLHSALSGEDQALVFKKAPPGKRKIVLSTNIAETSVTIDDCVFVVDCGLMKEKCFDSNRNMESLDLVWVSRANAKQRKGRAGRVMPGVCIHLYTSYRYQYHILAQPVPEIQRVPLEQIVLRIKTLQTFASRNTLSVLLETLEAPTEDSVLGALTRLRDVGALDA------------------------------EDQLTPLGHHLAALPVDVRIGKLMLYGAIFQCLDSVLTIAACLS-----NKSPFVSPLNKRTEADKCK-------------RMFALGNSDHLTVLNAYRKWLDVARRGNY 1044          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Zebrafish
Match: tdrd9 (tudor domain containing 9 [Source:NCBI gene;Acc:553222])

HSP 1 Score: 499.204 bits (1284), Expect = 7.322e-151
Identity = 392/1334 (29.39%), Postives = 658/1334 (49.33%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKL---GICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTK----CTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIK--------IYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEV----NDFCLAPYE-----GDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRV-LMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLR-QTVPQT-VVLSAPCHPYIMKFHGITE-SCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGR-PLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI ++ ++++  IENN  ++I+G+TG GK+TQ+PQFILD+    + P N+VVTQPR+I A S+A  VA ER   +GS VGYQVGL++  +  T + +VTTGVLL++L+ ++TLT+Y+HI +DEVHER  ++D LL VV+ LL  ++R  K+ILMSAT+   +F+ YF   I  +     P  +F +EG  + VEE++LD+L  +   G+  D      + Q P +T E+  +   L+      E  D +      +    E GSVL+FLPGL++I    +Y+                                            E L K+ +    +  LHS++ + EQ   F     G RKIILSTNIAESS+TV D+KYVID C++++L  D+ET++  L+  WASK+SC QR GRAGRV  G  YRL++++ + N++  F  PE+L  PL   +L++K  +  DPR++L  AL  P L DI  T L LK+ GALS++ N                          + G+LTF+GR+++ LP+DL +GKLI LG+ F  LEE +IIA+ L++ +S F+ P                 ++ L  +  KL  +++  SD +  +N FK WY     G  R  +DE +W     +  + + EV  L +++K+R+  +FN+ +  S+              +    +++H        +  +LQ+ IAGA +PNYF +      E  A +   G DP   + I NLP      Y+  +   F+  C +       +    ++  ++F      + +   +S   +  +L  ++     AL       ++ +A++ +  A  + + I +     +N   +S   + +G  S   N  K        I +T   + G F+G   +E   E++  +      T A N+   +   V    N  C+AP++       +YRA+++     N  VFFVD+GN+  +  + L +LP  L+      A +F ++ M P   +     +WS++ +  F    +  +       ++S++   +RV + +  +  D  + + L+    A +  ES+ S+Q + +            F  + +   +N                          + ++ L+   C    + P+   V+  P  P+ + FH +++ S  R V +  DS+N ++++  PQ+   RM+VA  V  S  G +   +LL+ T+LMP I G P L+ ++FTP  EL +++ +T + GA CGLG +S  +  + P +D+E+  DV+F+  DI  +N +R  +N
Sbjct:   90 PITKNRQELVSLIENNSVVIIRGATGSGKTTQLPQFILDHYAERNIPCNLVVTQPRKIGATSIARWVARERKCTLGSLVGYQVGLEKMATEHTKLIYVTTGVLLQKLVSSKTLTEYSHIFIDEVHERSEELDFLLLVVRKLLRSNSRYVKVILMSATINCIEFAEYFGSPIRNQMN---PAYVFEVEGAPYAVEEYYLDELKTMLPVGVNLD----LTLPQDPYITEEMYNVAVSLIQSFDEMEAKDHRRSEQTGSTTHPERGSVLVFLPGLAEI----QYM-------------------------------------------KEALSKLVRKRLQVYPLHSTVTLEEQNGVFLVPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLVRQLACDKETNYRCLRITWASKTSCNQRRGRAGRVSKGFCYRLVTRHFWENEIPNFSIPEMLRSPLASTLLKVKLLDMGDPRSVLSTALTPPILGDIERTVLQLKQIGALSVQSNS----------------------QRQFDGDLTFLGRVLAQLPVDLQLGKLIVLGHVFGCLEECLIIAASLSL-KSFFAMP----------------SLQQLAGYRSKLSFAQNVPSDFIAYVNAFKAWYTSRAKGELRHPKDELEWGKENCIQIKRIREVAELFEDLKKRVS-RFNMHISSSS--------------NPTDYTSLHK-------QRFILQVVIAGALFPNYFSQ--GEIDEQLASKELSGNDPKTTILIRNLPPFAFLCYKQ-LQSLFRQ-CGQVKS----IAFDGSRAYVEF------HRSCVRESGVLHEVLLALLRSRHTPALH-----LQVHHADEVEFHA--KGKPIAHLRYTRVNVDVQSHTVSPVGVLSSSVNPEKLPTSRDFVINITEVIDVGHFWGFQTDENSVEKQCQL------TAALNMRDLRPLSVSLYPNLLCVAPFKDGQQMAKYYRAKVLHILGSNVEVFFVDFGNTTVVPSSSLRELPSDLMTPA-FQAQEFCIARMAPSAQSLILGDRWSSRARNRFKTLTSGRSAI---VSLFSILHGVMRVDLHISTETGDVSVADLLVQEGHACHTPESFESQQSHEVLISLYEDMASGRFTPSFASGSLN-------------------SRMEEDKQLINQLLLHFCSSGSSAPKCKAVVHGPSSPHKVNFHSMSKVSNFRSVNIERDSINCVMVNENPQDWHERMLVAASVSLSASGSR---ILLKETSLMPHIHGLPSLVTMLFTPVMELRTNEDRTCFTGALCGLGWNSVSQEAVLPEHDIEIAFDVKFEIEDITEINALRGTVN 1255          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Zebrafish
Match: dhx9 (DEAH (Asp-Glu-Ala-His) box helicase 9 [Source:ZFIN;Acc:ZDB-GENE-070912-171])

HSP 1 Score: 234.187 bits (596), Expect = 9.587e-62
Identity = 206/693 (29.73%), Postives = 321/693 (46.32%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILD----NAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSN-ETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYD-------------------VCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEM-GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            P+   ++ I+  I NN  ++I+G+TGCGK+TQVPQ+ILD       A+D   NIVVTQPRRI+A+SVA  V+ ERG ++G   GY V  +         I F T GVLL +L     +   +H+I+DE+HERD++ D LL V++D++      ++ILMSAT+    F  YF               +  + G+  PV+E+FL+D   + + Q  P   D                   +C     + E K  + QL    T  E+ +     I  LE+ G+VL+FLPG + I  + ++L +        NP     F  +                                 + +L LHS I   EQ+R FE +  G  K+ILSTNIAE+SIT+ D+ +V+D C  K   +    + ++    WASK++ +QR GRAGRVR G  + L S+  + +L+    PEI   PL +V L IK          L +A++ P L+ +     TL+E  AL                                  ELT +GR+++ LP++  +GK++ +G  F+V +     A C   + + F +PF              N+ K L    +    + S++SD + +L+ F+ W   ++ G     + E ++C    L+   L     +T E K +LKE
Sbjct:  396 PVKNFQEQIMSTIYNNPVVIIRGATGCGKTTQVPQYILDEFIKGGRASD--CNIVVTQPRRISAVSVAERVSFERGEDVGKSCGYSVRFESFLPRPHASILFCTVGVLLRKL--ESGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPDVRVILMSATIDTTMFKEYF-----------FNCPVIEVHGRAHPVQEYFLEDC--IQMTQFVPPPMDRKRKDKDDEGGDEDVNCNVICGS-EYSPETKRAMSQLNEKETSFELIEALLKYIETLEVPGAVLVFLPGWNLIYFMQKHLEM--------NPH----FGGH--------------------------------QYRILPLHSQIPREEQRRVFEPVPDGVTKVILSTNIAETSITINDVVFVLDSCKQKVKLFTSHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRARFEKLETHMTPEIFRTPLHEVALSIKLLRLGGIGNFLSKAIEPPPLDAVIEAEHTLRELDALDS------------------------------NDELTPLGRILAKLPIEPRLGKMMIMGCIFNVGD-----AVCTISAATCFPEPFI-------------NEGKRLGFVHRN--FAGSRFSDHVALLSVFQAW-DEVRVGG---EDAEIRFCEHKRLNMPTLR----MTWEAKVQLKE 968          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Zebrafish
Match: dhx29 (DEAH (Asp-Glu-Ala-His) box polypeptide 29 [Source:ZFIN;Acc:ZDB-GENE-130530-606])

HSP 1 Score: 233.417 bits (594), Expect = 2.028e-61
Identity = 214/721 (29.68%), Postives = 334/721 (46.32%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFA---NDEPVNIVVTQPRRIAAISVAMHVASERGWEIG-----SYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL-PKLG--ICQDAPYSY-----------DVCQQPRLTAELKEMIY-----------QLLMFITYTEMSDTKCTNINQLEM--------------------GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            P+ +H + +L  + +++ LVI G TG GKSTQ+PQFIL+   A     +P ++VVTQPRRI+A+S+A  V+ E G E G     S  GYQ+ ++ + S  T + + TTGVLL +L  ++ L   THII+DEVHER V  D LL+++K+++      ++ILMSATV   KF+ YF++             +  I G+ FPVE F L+D+  + G  + QD+ YS             + Q+   T + +E+I            +L  F + T     +  N N++ M                    G+VL+FLPGL+ I +L++ LL   KR           FS+                               +D + L+ALHSS+   +Q  AF     G RKI+LSTNIAE+ +T+ D+ +VID    K  RY   +  SSL   + SK+S  QR GRAGRVR G  +RL  ++ +    ++  PEIL  PL ++ L I +     P   L R+LD P  + +      L+  GA                    Q T  + P+  H           +++LP+++ +GK++  G  F  LE    IA+ ++  +S F+ P    +  N   S               L ++    SD +T+   +  W      G       E  +C   +L+  AL  +E +  E+ R +++
Sbjct:  577 PVFQHREQVLEALRHHRVLVIAGETGSGKSTQIPQFILEELLAAGDTAQPCSVVVTQPRRISAMSLACRVSQELGSEDGPGSMNSLCGYQIRMENRSSEATRLLYCTTGVLLRKLQQDRHLNSLTHIIVDEVHERSVQSDFLLTILKEVVHKRADLRLILMSATVDCQKFANYFNR-----------CPVVSIPGRTFPVEVFHLEDIVEETGYVLEQDSEYSQKFVEEEEEVNIGITQKGGKTVQHQELIVRDSASGWDLGPELDHFSSRTRHI-LQYMNPNKINMDLILDLLAYLDKSPQFNAVDGAVLVFLPGLAHIQQLHD-LLSTDKR-----------FSS-------------------------------KDRYKLVALHSSLSSQDQSSAFTVPPAGVRKIVLSTNIAETGVTIPDVVFVIDTGRTKENRYHESSQMSSLVEMFVSKASALQRQGRAGRVREGFCFRLYPKFRFESFIDYSIPEILRVPLEELCLHIMKCEYGSPEDFLSRSLDAPQQQAVCNAVSLLRRIGACQ------------------QDTHTLTPLGHH-----------LAALPVNVKIGKMLIFGAIFGCLEPIATIAAAMS-EKSPFATPMSRKEEANLAKS--------------ALAVAN---SDHMTIYKAYLGWRSSRTEGT----RAEMNYCRRHFLNRTALITIEEVKQELMRMVEQ 1191          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Zebrafish
Match: dhx36 (DEAH (Asp-Glu-Ala-His) box polypeptide 36 [Source:ZFIN;Acc:ZDB-GENE-050419-20])

HSP 1 Score: 226.868 bits (577), Expect = 6.223e-60
Identity = 204/690 (29.57%), Postives = 313/690 (45.36%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEP--VNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL----------------------------PKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCT-------NINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQK-------RAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFS--GKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKW 2356
            P +   ++++R I  N+ LVI G TGCGK+TQV QFILD+     +     +V TQPRRI+AISVA  VA ER   +G     GYQ+ L  R    +  + + TTGV+L+ L  +  L+  TH++LDE+HER V  D+L+++VKDLL      K++LMSAT+ A+KFS YF+              +  I G  FPV E+ L+D+                            P+ G  +   +    C    L     +   ++L  +   +  D + T        +N+ E G++L+FLPG  +I+ LN+ L+                                           +++ K  +  F ++ LHS +    Q        + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D + +  ++ AEW S ++ KQR GRAGRV  G  Y L +    + LD +  PEI   PL ++ L+IK     P A  LQ+ +D PS   I      L +  AL   R+E                            +LT +G  ++ +P++ H+GK+I  G     L+  + IA+ L+     F  PFF   GK K               A +++   S++  SD L+++N F  W    + G+   R  EY W
Sbjct:  221 PSYGMREELVRLISANRVLVISGETGCGKTTQVTQFILDDFIQRGQGSLCRVVCTQPRRISAISVAERVAVERAEPVGEGKSCGYQIRLQSRLPRKQGSLLYCTTGVILQWLHSDPYLSSITHLVLDEIHERSVQSDILITIVKDLLTARDDLKVVLMSATLNAEKFSKYFNN-----------CPMIHIPGYTFPVTEYLLEDVVELLGFQPRYKQRKPHYRKRNNHGSSARPEKGKIEAKYHESWPCYARTLRDRFSDTTIEVLGMMDDDDNIDLELTAALIRHIAVNENE-GAILVFLPGWDNISTLNDLLM------------------------------------------SDQMFKSGRYRFIIIPLHSLMPTVSQTQVISLFPQVFKKPPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNIRTMTAEWVSIANAKQRKGRAGRVSPGKCYHLYNGLRASLLDNYQLPEIQRTPLEELCLQIKVLKLGPIATFLQKTMDPPSDRAIELAITHLVDLNALD--RDE----------------------------KLTPLGFHLARMPVEPHIGKMILFGALLGCLDPVLTIAASLS-----FKDPFFIPLGKEKI--------------ADQRRKMFSQNSRSDHLSIVNAFLGWEDAKRRGSRFER--EYCW 805          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Zebrafish
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 217.624 bits (553), Expect = 8.771e-57
Identity = 190/667 (28.49%), Postives = 302/667 (45.28%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLK 2434
            PI ++   I+  +  +  +V+ G TGCGKSTQVPQ++L +   N     I  TQPRRIA IS+A  V+ E   + GS VGYQ+  +   +  T + F+T G+LL Q+  + +L  Y  +I+DEVHER +  D LL V++ LL      +++LMSAT+    FS YF+              + ++ G++FP++  +    P+  + +           PR    + + I Q                   Q E G +L+FL G+++I+ + E                                     +C        +    +   + +L LHS++ +++Q + F+    G RK I+STNIAE+S+T+  +++V+D   +K + +D +     L+  W S++S +QR GRAGR   GV YRL S+  Y+    +  PEI    L  +IL++K     DPR      +D P    I      L+E GAL                            D+H  GELT IGRL++ LP+D+ +GK++ LG  F+++E  + +A+ L+V       PF      N   S A   +              S + D  T++N F  W Q        SR    KWC    L+ Q L+E+  L  + K  L+
Sbjct:  163 PIFQYRDKIVELVRTHPVVVVAGDTGCGKSTQVPQYLLASGINN-----IACTQPRRIACISLAKRVSFESLNQYGSKVGYQIRFETSRTLATKLLFLTEGLLLRQIQQDASLGQYQVLIVDEVHERHLHCDFLLGVLRSLLSLRPDLRLVLMSATINIKLFSSYFND-----------APVLQVPGRLFPIQVIYQPIPPEEQVSRSEKLD------PRPYLRVLQGIDQ----------------RYPQEERGDLLLFLSGVAEISTIQE-------------------------------------AC--------QTYATHTQRWIVLPLHSTLSLAQQDKVFDIAPPGVRKCIISTNIAETSVTIDGVRFVVDSGKVKEMSFDPKAKMQRLQEFWISRASSEQRKGRAGRTGPGVCYRLYSESDYDAFAPYPVPEIHRVALDSLILQMKSMGLGDPRTFT--FIDPPPASSIQTAVTYLREQGAL----------------------------DEH--GELTSIGRLLAQLPVDVVIGKMLVLGSVFNLVEPVLTVAAALSV-----QSPFLRSAQHNPDCSTARQPLN-------------SNHGDPFTLMNTFNAWVQVKADRGSGSR----KWCRRRGLEEQRLYEMVNLRRQFKELLR 692          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Xenopus
Match: ppp4r1 (protein phosphatase 4 regulatory subunit 1 [Source:Xenbase;Acc:XB-GENE-945302])

HSP 1 Score: 539.65 bits (1389), Expect = 2.336e-165
Identity = 424/1369 (30.97%), Postives = 675/1369 (49.31%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMF---ITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQ-YVYNQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----LKPRIDVFE----LTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEG----DFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVL--MVDHQDKILNEELILMRIAEYAEESYASRQDN-----ILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIAL-----GSSMHSQDAMDKYQSGIKKFIASLLLK 4429
            PI +  ++++  IENN  +VI G+TG GKSTQ+PQFILD    + +  NIVVTQPR+IAA S+A  ++++R W +G  VGYQVGL++  S ET + ++TTGVLL++++  ++L ++THI +DEVHER  +MD LL VV+ LL  ++R  K+ILMSAT+   +F+ YF+  +  K     P  IF +EGK   +E F+LDDL  +   + A +  D   +P ++ E+ E+   L+     +   E+   K ++   +E  SVL+FLPGL +I  ++E                   F+N                             + Q   ++  LHSSI + EQ   F    +G RK+ILSTNIAESSITV D+KYVID C+ K L  D ET++ SL+  WASK++C QR GRAGRV  G  YR + + +  N + E   PE+L  PL   IL++K  +  +PRALL  AL  P++ DI  T L LKE GAL++          +EN             ++ + GELTF+G++++ LP+DL +GKLI LG+ F  LEE IIIA+ L++ ++ F+ PF                   LD +  KL  S S  SD + +++ FK W    + G  R  +DE +W    Y   + + EV  L D++K+R+   FN+ V                +P+ +   N     I        LQI +AGAFYPNYF    +   E  A+R     DP   V + N+P +   LY   I   F+  C +       ++   ++  ++F  N        T+      +V +++KM Q        + P  D+ +    +T+ + +++    + ++ ++ H+     K+           ++D   + + +T   E G F+G   + K     +  E++  +   + +  ++    N  CLAP+       +YRA+I+  S     VFFVDYGN   ++   L  + + +L + P  A++F + +M+P   +     +W     E F   +N       GC    K++S+V + + V V     + ++K + + LI    AE AEESY S Q N     +   +CN K +   F     +++I  M                  +  +QN+        + ++Q      VL  P  PY +KFH +    K R V +  +S+NS++++  P+    R+ VA  V  +     G+ ++LR T+L+P IPG P LI+++F P  EL  D  +  Y G   GLG   E G  + P +D+E+  DV F   D+  +N +RS +N  L     GS   S +    +Q  I++ + +L+ K
Sbjct:  105 PILKSREELIALIENNSVVVIHGATGSGKSTQLPQFILDYLRQHGQYCNIVVTQPRKIAARSIATWISNQRCWTLGGRVGYQVGLEKVASEETQLIYMTTGVLLQKIVSAKSLLEFTHIFIDEVHERTEEMDFLLMVVRKLLCTNSRFVKVILMSATINCKEFADYFAVPVLNKMT---PAYIFEVEGKPHDIEVFYLDDLKDIPQAKIAAHYSD---EPLISKEMYEVATSLIHLFDEMEKEELKKGKMSHKAYIESNSVLVFLPGLMEINYMHE------------------LFTN-----------------------------MVQKRLHVYPLHSSITLDEQNLVFMPPVIGYRKVILSTNIAESSITVPDVKYVIDFCLTKTLVCDEETNYQSLRLSWASKTNCDQRKGRAGRVSKGYCYRFVQKDFWKNIIPENVIPEMLRSPLGSTILKVKLLDMGEPRALLATALSPPNITDIERTILLLKELGALAVSG-------KREN-------------ENPYDGELTFLGKVLAQLPVDLQLGKLIVLGHVFGCLEECIIIAAALSL-KNFFAMPF----------------RHLLDGYRSKLSFSGSSRSDCIALVDAFKSWQSCKERGELRLSKDELEWGKRNYFQIKRIREVAALYDDLKKRISH-FNMHVT---------------QPARDPDYNFKQRFI--------LQIVMAGAFYPNYFTFGQSD--ERSAVRDLSAKDPRTTVVLKNVP-NYSFLYYKQIQSLFRQ-CGQVKS----ILFDGSRAFVEFSRN-------PTERFKTLTAVYLALKMAQLKIPLILNVHPTEDIEKADDTITSLKLSRINVDCQTQTFESVHVAKTMEKH---------LETLDGLTLSVNITEVVEVGHFWGFSIDTKS--MAILEELATNIRQQQLVPLTERPHSNMMCLAPFTNKDSESYYRAQILYISGSTAMVFFVDYGNKSQVELTLLRMIHETIL-NIPFQALEFKICKMRPSAKSLICGEQWCRSASERFDALVN-------GCALMVKVHSIVHDILHVDVYRHFENLEEKSIRDLLIADGYAEPAEESYESNQSNEVLKELFLPECNKKPYKQGFAKDDEKNQIEKM-----------------LDKFTQNK--------LGIQQC---KAVLHGPFSPYEVKFHSLMRVSKFRSVWIEKESINSVVLNEAPEAPHQRIFVAASVSVNAS---GSVIMLRETSLLPPIPGLPALISMLFAPVIELRVDGARKHYTGVLFGLGWHHESGTSIWPEHDIELAFDVHFSVDDLVKINLLRSTINKVLRQNYNGSLNSSYERPGFFQEDIREKLLNLIQK 1294          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Xenopus
Match: ppp4r1 (protein phosphatase 4 regulatory subunit 1 [Source:Xenbase;Acc:XB-GENE-945302])

HSP 1 Score: 462.225 bits (1188), Expect = 9.702e-138
Identity = 403/1371 (29.39%), Postives = 643/1371 (46.90%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMF---ITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQ-YVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKR-NEITKVINKENGEKVQLTQVV--MPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----LKPRIDVFE----LTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEG----DFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVL--MVDHQDKILNEELILMRIAEYAEESYASRQDN-----ILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIAL-----GSSMHSQDAMDKYQSGIKKFIASLLLK 4429
            PI +  ++++  IENN  +VI G+TG GKSTQ+PQFILD    + +  NIVVTQPR+IAA S+A  ++++R W +G  VGYQVGL++  S ET + ++TTGVLL++++  ++L ++THI +DEVHER  +MD LL VV+ LL  ++R  K+ILMSAT+   +F+ YF+  +  K     P  IF +EGK   +E F+LDDL  +   + A +  D   +P ++ E+ E+   L+     +   E+   K ++   +E  SVL+FLPGL +I  ++E                   F+N                             + Q   ++  LHSSI + EQ   F    +G RK+ILSTNIAESSITV D+KYVID C+ K L  D ET++ SL+  WASK++C QR GRAGRV  G  YR + + +  N + E   PE+L G L                                         A+S KR NE     N  +GE   L +V+  +P+D         +G+L             I LG+ F  LEE IIIA+ L++ ++ F+ PF                   LD +  KL  S S  SD + +++ FK W    + G  R  +DE +W    Y   + + EV  L D++K+R+   FN+ V                +P+ +   N     I        LQI +AGAFYPNYF    +   E  A+R     DP   V + N+P +   LY   I   F+  C +       ++   ++  ++F  N        T+      +V +++KM Q        + P  D+ +    +T+ + +++    + ++ ++ H+     K+           ++D   + + +T   E G F+G   + K     +  E++  +   + +  ++    N  CLAP+       +YRA+I+  S     VFFVDYGN   ++   L  + + +L + P  A++F + +M+P   +     +W     E F   +N       GC    K++S+V + + V V     + ++K + + LI    AE AEESY S Q N     +   +CN K +   F     +++I  M                  +  +QN+        + ++Q      VL  P  PY +KFH +    K R V +  +S+NS++++  P+    R+ VA  V  +     G+ ++LR T+L+P IPG P LI+++F P  EL  D  +  Y G   GLG   E G  + P +D+E+  DV F   D+  +N +RS +N  L     GS   S +    +Q  I++ + +L+ K
Sbjct:  105 PILKSREELIALIENNSVVVIHGATGSGKSTQLPQFILDYLRQHGQYCNIVVTQPRKIAARSIATWISNQRCWTLGGRVGYQVGLEKVASEETQLIYMTTGVLLQKIVSAKSLLEFTHIFIDEVHERTEEMDFLLMVVRKLLCTNSRFVKVILMSATINCKEFADYFAVPVLNKM---TPAYIFEVEGKPHDIEVFYLDDLKDIPQAKIAAHYSD---EPLISKEMYEVATSLIHLFDEMEKEELKKGKMSHKAYIESNSVLVFLPGLMEINYMHE------------------LFTN-----------------------------MVQKRLHVYPLHSSITLDEQNLVFMPPVIGYRKVILSTNIAESSITVPDVKYVIDFCLTKTLVCDEETNYQSLRLSWASKTNCDQRKGRAGRVSKGYCYRFVQKDFWKNIIPENVIPEMLLGAL-----------------------------------------AVSGKRENE-----NPYDGELTFLGKVLAQLPVDLQ-------LGKL-------------IVLGHVFGCLEECIIIAAALSL-KNFFAMPF----------------RHLLDGYRSKLSFSGSSRSDCIALVDAFKSWQSCKERGELRLSKDELEWGKRNYFQIKRIREVAALYDDLKKRISH-FNMHVT---------------QPARDPDYNFKQRFI--------LQIVMAGAFYPNYFTFGQSD--ERSAVRDLSAKDPRTTVVLKNVP-NYSFLYYKQIQSLFRQ-CGQVKS----ILFDGSRAFVEFSRN-------PTERFKTLTAVYLALKMAQLKIPLILNVHPTEDIEKADDTITSLKLSRINVDCQTQTFESVHVAKTMEKH---------LETLDGLTLSVNITEVVEVGHFWGFSIDTKS--MAILEELATNIRQQQLVPLTERPHSNMMCLAPFTNKDSESYYRAQILYISGSTAMVFFVDYGNKSQVELTLLRMIHETIL-NIPFQALEFKICKMRPSAKSLICGEQWCRSASERFDALVN-------GCALMVKVHSIVHDILHVDVYRHFENLEEKSIRDLLIADGYAEPAEESYESNQSNEVLKELFLPECNKKPYKQGFAKDDEKNQIEKM-----------------LDKFTQNK--------LGIQQC---KAVLHGPFSPYEVKFHSLMRVSKFRSVWIEKESINSVVLNEAPEAPHQRIFVAASVSVNAS---GSVIMLRETSLLPPIPGLPALISMLFAPVIELRVDGARKHYTGVLFGLGWHHESGTSIWPEHDIELAFDVHFSVDDLVKINLLRSTINKVLRQNYNGSLNSSYERPGFFQEDIREKLLNLIQK 1250          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Xenopus
Match: ppp4r1 (protein phosphatase 4 regulatory subunit 1 [Source:Xenbase;Acc:XB-GENE-945302])

HSP 1 Score: 391.349 bits (1004), Expect = 3.455e-114
Identity = 350/1220 (28.69%), Postives = 567/1220 (46.48%), Query Frame = 2
Query:  881 KIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMF---ITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQ-YVYNQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----LKPRIDVFE----LTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEG----DFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVL--MVDHQDKILNEELILMRIAEYAEESYASRQDN-----ILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIAL-----GSSMHSQDAMDKYQSGIKKFIASLLLK 4429
            ++ILMSAT+   +F+ YF+  +  K     P  IF +EGK   +E F+LDDL  +   + A +  D   +P ++ E+ E+   L+     +   E+   K ++   +E  SVL+FLPGL +I  ++E                   F+N                             + Q   ++  LHSSI + EQ   F    +G RK+ILSTNIAESSITV D+KYVID C+ K L  D ET++ SL+  WASK++C QR GRAGRV  G  YR + + +  N + E   PE+L  PL   IL++K  +  +PRALL  AL  P++ DI  T L LKE GAL++          +EN             ++ + GELTF+G++++ LP+DL +GKLI LG+ F  LEE IIIA+ L++ ++ F+ PF                   LD +  KL  S S  SD + +++ FK W    + G  R  +DE +W    Y   + + EV  L D++K+R+   FN+ V                +P+ +   N     I        LQI +AGAFYPNYF    +   E  A+R     DP   V + N+P +   LY   I   F+  C +       ++   ++  ++F  N        T+      +V +++KM Q        + P  D+ +    +T+ + +++    + ++ ++ H+     K+           ++D   + + +T   E G F+G   + K     +  E++  +   + +  ++    N  CLAP+       +YRA+I+  S     VFFVDYGN   ++   L  + + +L + P  A++F + +M+P   +     +W     E F   +N       GC    K++S+V + + V V     + ++K + + LI    AE AEESY S Q N     +   +CN K +   F     +++I  M                  +  +QN+        + ++Q      VL  P  PY +KFH +    K R V +  +S+NS++++  P+    R+ VA  V  +     G+ ++LR T+L+P IPG P LI+++F P  EL  D  +  Y G   GLG   E G  + P +D+E+  DV F   D+  +N +RS +N  L     GS   S +    +Q  I++ + +L+ K
Sbjct:   25 QVILMSATINCKEFADYFAVPVLNKMT---PAYIFEVEGKPHDIEVFYLDDLKDIPQAKIAAHYSD---EPLISKEMYEVATSLIHLFDEMEKEELKKGKMSHKAYIESNSVLVFLPGLMEINYMHE------------------LFTN-----------------------------MVQKRLHVYPLHSSITLDEQNLVFMPPVIGYRKVILSTNIAESSITVPDVKYVIDFCLTKTLVCDEETNYQSLRLSWASKTNCDQRKGRAGRVSKGYCYRFVQKDFWKNIIPENVIPEMLRSPLGSTILKVKLLDMGEPRALLATALSPPNITDIERTILLLKELGALAVSG-------KREN-------------ENPYDGELTFLGKVLAQLPVDLQLGKLIVLGHVFGCLEECIIIAAALSL-KNFFAMPF----------------RHLLDGYRSKLSFSGSSRSDCIALVDAFKSWQSCKERGELRLSKDELEWGKRNYFQIKRIREVAALYDDLKKRISH-FNMHVT---------------QPARDPDYNFKQRFI--------LQIVMAGAFYPNYFTFGQSD--ERSAVRDLSAKDPRTTVVLKNVP-NYSFLYYKQIQSLFRQ-CGQVKS----ILFDGSRAFVEFSRN-------PTERFKTLTAVYLALKMAQLKIPLILNVHPTEDIEKADDTITSLKLSRINVDCQTQTFESVHVAKTMEKH---------LETLDGLTLSVNITEVVEVGHFWGFSIDTKS--MAILEELATNIRQQQLVPLTERPHSNMMCLAPFTNKDSESYYRAQILYISGSTAMVFFVDYGNKSQVELTLLRMIHETIL-NIPFQALEFKICKMRPSAKSLICGEQWCRSASERFDALVN-------GCALMVKVHSIVHDILHVDVYRHFENLEEKSIRDLLIADGYAEPAEESYESNQSNEVLKELFLPECNKKPYKQGFAKDDEKNQIEKM-----------------LDKFTQNK--------LGIQQC---KAVLHGPFSPYEVKFHSLMRVSKFRSVWIEKESINSVVLNEAPEAPHQRIFVAASVSVNAS---GSVIMLRETSLLPPIPGLPALISMLFAPVIELRVDGARKHYTGVLFGLGWHHESGTSIWPEHDIELAFDVHFSVDDLVKINLLRSTINKVLRQNYNGSLNSSYERPGFFQEDIREKLLNLIQK 1065          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Xenopus
Match: ppp4r1 (protein phosphatase 4 regulatory subunit 1 [Source:Xenbase;Acc:XB-GENE-945302])

HSP 1 Score: 323.553 bits (828), Expect = 2.233e-90
Identity = 298/1037 (28.74%), Postives = 480/1037 (46.29%), Query Frame = 2
Query: 1421 FYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQ-YVYNQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----LKPRIDVFE----LTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEG----DFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVL--MVDHQDKILNEELILMRIAEYAEESYASRQDN-----ILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIAL-----GSSMHSQDAMDKYQSGIKKFIASLLLK 4429
             ++  LHSSI + EQ   F    +G RK+ILSTNIAESSITV D+KYVID C+ K L  D ET++ SL+  WASK++C QR GRAGRV  G  YR + + +  N + E   PE+L  PL   IL++K  +  +PRALL  AL  P++ DI  T L LKE GAL++          +EN             ++ + GELTF+G++++ LP+DL +GKLI LG+ F  LEE IIIA+ L++ ++ F+ PF                   LD +  KL  S S  SD + +++ FK                                 V  L D++K+R+   FN+ V                +P+ +   N     I        LQI +AGAFYPNYF    +   E  A+R     DP   V + N+P +   LY   I   F+  C +       ++   ++  ++F  N        T+      +V +++KM Q        + P  D+ +    +T+ + +++    + ++ ++ H+     K+           ++D   + + +T   E G F+G   + K     +  E++  +   + +  ++    N  CLAP+       +YRA+I+  S     VFFVDYGN   ++   L  + + +L + P  A++F + +M+P   +     +W     E F   +N       GC    K++S+V + + V V     + ++K + + LI    AE AEESY S Q N     +   +CN K +   F     +++I  M                  +  +QN+        + ++Q      VL  P  PY +KFH +    K R V +  +S+NS++++  P+    R+ VA  V  +     G+ ++LR T+L+P IPG P LI+++F P  EL  D  +  Y G   GLG   E G  + P +D+E+  DV F   D+  +N +RS +N  L     GS   S +    +Q  I++ + +L+ K
Sbjct:  322 LHVYPLHSSITLDEQNLVFMPPVIGYRKVILSTNIAESSITVPDVKYVIDFCLTKTLVCDEETNYQSLRLSWASKTNCDQRKGRAGRVSKGYCYRFVQKDFWKNIIPENVIPEMLRSPLGSTILKVKLLDMGEPRALLATALSPPNITDIERTILLLKELGALAVSG-------KREN-------------ENPYDGELTFLGKVLAQLPVDLQLGKLIVLGHVFGCLEECIIIAAALSL-KNFFAMPF----------------RHLLDGYRSKLSFSGSSRSDCIALVDAFK---------------------------------VAALYDDLKKRISH-FNMHVT---------------QPARDPDYNFKQRFI--------LQIVMAGAFYPNYFTFGQSD--ERSAVRDLSAKDPRTTVVLKNVP-NYSFLYYKQIQSLFRQ-CGQVKS----ILFDGSRAFVEFSRN-------PTERFKTLTAVYLALKMAQLKIPLILNVHPTEDIEKADDTITSLKLSRINVDCQTQTFESVHVAKTMEKH---------LETLDGLTLSVNITEVVEVGHFWGFSIDTKS--MAILEELATNIRQQQLVPLTERPHSNMMCLAPFTNKDSESYYRAQILYISGSTAMVFFVDYGNKSQVELTLLRMIHETIL-NIPFQALEFKICKMRPSAKSLICGEQWCRSASERFDALVN-------GCALMVKVHSIVHDILHVDVYRHFENLEEKSIRDLLIADGYAEPAEESYESNQSNEVLKELFLPECNKKPYKQGFAKDDEKNQIEKM-----------------LDKFTQNK--------LGIQQC---KAVLHGPFSPYEVKFHSLMRVSKFRSVWIEKESINSVVLNEAPEAPHQRIFVAASVSVNAS---GSVIMLRETSLLPPIPGLPALISMLFAPVIELRVDGARKHYTGVLFGLGWHHESGTSIWPEHDIELAFDVHFSVDDLVKINLLRSTINKVLRQNYNGSLNSSYERPGFFQEDIREKLLNLIQK 1199          

HSP 2 Score: 188.348 bits (477), Expect = 2.076e-47
Identity = 104/234 (44.44%), Postives = 151/234 (64.53%), Query Frame = 2
Query:  473 IENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTK 1171
            IENN  +VI G+TG GKSTQ+PQFILD    + +  NIVVTQPR+IAA S+A  ++++R W +G  VGYQVGL++  S ET + ++TTGVLL++++  ++L ++THI +DEVHER  +MD LL VV+ LL  ++R  K+ILMSAT+   +F+ YF+  +  K     P  IF +EGK   +E F+LDDL    I Q A +  D   +P ++ E+ E+   L+      E  + K
Sbjct:   96 IENNSVVVIHGATGSGKSTQLPQFILDYLRQHGQYCNIVVTQPRKIAARSIATWISNQRCWTLGGRVGYQVGLEKVASEETQLIYMTTGVLLQKIVSAKSLLEFTHIFIDEVHERTEEMDFLLMVVRKLLCTNSRFVKVILMSATINCKEFADYFAVPVLNKM---TPAYIFEVEGKPHDIEVFYLDDLKD--IPQIAAHYSD---EPLISKEMYEVATSLIHLFDEMEKEELK 321          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Xenopus
Match: dhx57 (DEAH-box helicase 57 [Source:NCBI gene;Acc:100124795])

HSP 1 Score: 251.521 bits (641), Expect = 6.910e-67
Identity = 238/801 (29.71%), Postives = 353/801 (44.07%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAN--DEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFL-DDLPKLG-ICQD-APYSYDVCQQP--------------RLTAELKEMIYQLL---------------------MFITYTEMSDTKCTNINQLEM------------------------GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLIS--QYVYNQLDEFCPPEILTGPLTQVILRIK--EFNRDPR--ALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLD-------KKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPN 2608
            P  + +  IL  +   Q LV+ G TGCGK+TQ+PQFILD +         NI+ TQPRRI+AISVA  VA ER   +G  VGYQ+ L+   S  T + + TTGVLL +L  + TL + TH+++DEVHER  + D LL V+KD+++     KIILMSAT+ A+ FSCYF               +  I G+ FPV+++FL D + K   + +D +PY     Q P               L  EL++ I   L                     + + Y  +S +    ++ +++                        G+VL+FLPGL++I  L + L                      QS A+F  R   K C+                  +  LHSS+   EQ+  F     G  KII+STNIAE+SIT+ D+ YVID   ++  RYD      SL+  W S+++  QR GRAGRV +GV + L +   Y Y  LD+   PEI   PL Q+ LRIK  E   + R   +  R ++ P +E +  + + L++ GAL+           KE                    +LT +G  ++SLP+D+ +GKL+  G  F  L+  + IA+ L      F  PF     K  + +K   +  T +             SD L +L  ++ W   +K     S    Y++C   +L  + L E+  L  +    L +   +T      D         D  +DA  E +  +  NI            L+   +  A YPN
Sbjct:  519 PAWQKQDQILELLSKYQVLVVSGMTGCGKTTQIPQFILDASLKGPPSHVSNIICTQPRRISAISVAERVAQERAERVGISVGYQIRLESVKSAATRLLYCTTGVLLRRLEGDTTLQNVTHVVVDEVHERTEESDFLLLVLKDVMVLRPDLKIILMSATLNAELFSCYFQD-----------CPVLHIPGRTFPVDQYFLEDAIAKTRYVLEDGSPYQRSSKQLPGPDSARGKKGNSYNELLDELEQQISSSLRIQDSKIVKDSVPDQQLNVKELSVRYNGISKSVIKTLSSMDLDKINLDLIEALLEWIVNGDHSYPPGAVLVFLPGLAEIKTLYDQL----------------------QSNALFNNR-RSKRCV------------------IYPLHSSLSSDEQQSVFLKPPPGVTKIIISTNIAETSITIDDVVYVIDSGKMREKRYDPGKSMESLEDTWVSRANAMQRKGRAGRVASGVCFHLFTSHHYQYQLLDQQL-PEIQRIPLEQLCLRIKILEMFSECRLDLVFARLIEPPRMESLHASKIRLQDLGALT-----------KEE-------------------KLTPLGYHLASLPVDVRIGKLMLFGAIFRCLDPALTIAASLA-----FKSPFVCPWDKKEEANKKKQEFATAN-------------SDHLALLQAYQAWSSVIK----ESSRAAYQYCRDNFLSVRVLQEIASLKRQFTELLSDIGFVTEGLRARDIERRWAHGGDGVKDATGEEANTNADNIK-----------LISAMLCAALYPN 1203          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Mouse
Match: Tdrd9 (tudor domain containing 9 [Source:MGI Symbol;Acc:MGI:1921941])

HSP 1 Score: 509.22 bits (1310), Expect = 4.726e-154
Identity = 418/1333 (31.36%), Postives = 656/1333 (49.21%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQL--EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQ-LDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTF---RIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMS-------IKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCN-FIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMR--IAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCL-RQTVPQT-VVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGR-PLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI+R +++++  IE+N  ++I G+TG GKSTQ+PQ++LD+        NIVVTQPR+I A S+A  ++ ER W +G  VGYQVGL++  + +T + ++TTGVLL++++  ++L ++THI +DEVHER  +MD LL VV+ LL  ++R  K++LMSAT+   +F+ YF+  +  K     P  +F +EGK   +EE++L+DL  +      PY     ++P +T ++ E+   L+      +M  S  K  +  Q   E  SVL+FLPGL +I  ++E L       N ++ R                L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRLI +  ++  + +   PE+L  PL   IL++K  +  +PRALL  AL  PSL DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP+   +GKL+ LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD L ++  F+ W    + G  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+                F  P        H  V+ + +   +  +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N    T         NL+V MS       + +     ++ ++    ++    T++    +K+++      P+   +     N +  P    +  + I VT   E G F+G   +E++ E  ++L  EI+        LV   I    D  CLAP+    +  ++RA+I+  S  +  VFFVDYGN   +  + L ++P   L+  P  A++F + +M+P   +      WS      F   +      P+  K++S+V + + V V         +N   +L+R   AE AEESY S+Q   +  K    + +D        S +                         +   L  L+++    R   P    VL  P +PY +K H +T   K R V +  +S+NS++I   P +   RM+VA  +  +   E G+ +LLR T+LMP IPG P L++++F P  EL  D+    Y G  CGLG +S    P+ P +D+E+  DVR +  DI  +N +R+ +N
Sbjct:  135 PINRCKEEVISLIESNSVVIIHGATGSGKSTQLPQYVLDHYTQRSAFCNIVVTQPRKIGASSIARWISKERSWTLGGLVGYQVGLEKIATEDTRLIYMTTGVLLQKIVSAKSLMEFTHIFIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVVLMSATINCKQFADYFAVPVQNKMN---PAYVFEVEGKPHAIEEYYLNDLGHI-YHSGLPYR---LEEPVITKDVYEVAVSLIQMFDDLDMKESGNKTWSGAQFVSERSSVLVFLPGLGEINYMHELL------TNMIHKR----------------LQVYP-------------------------LHSSVTLEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCDQRKGRAGRVSKGYCYRLIPRDFWDSAIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPSLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVSQQLGKLVVLGHVFGCLDECLIIAAALSL-KNFFTMPF----------------RQHLDGYRNKVHFSGSSRSDCLALVEAFRAWQACRQRGELRRPKDELDWGRLNYIQIKRIREVAELYEELKNRISQ-FNM----------------FVGP--------HHPVLDQEYPYKQRFILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGKDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRNP---TERFKTLPAVNLAVKMSQLKVSLELSVHAAEEIEGKVQGGSVSKLRNTRVNVDFQKQTVD-----PMQVSF-----NTLDRPRTVADLLLTIDVTEVVEVGHFWGYRIDERNAELLKQLTAEINRL-----ELVPLPIHPHPDLVCLAPFTDYNKESYFRAQILYVSGNSAEVFFVDYGNRSHVDLDLLREIPCQFLE-LPFQALEFKICKMRPSAKSLICGEHWSGGAHGRFAALVG---GCPLLVKVFSIVHSVLHVDVYRYSGAQDAVNVRDVLIREGYAELAEESYESKQSYEV-LKGFFAKSVDTMPDGSVSSPLK----------------------DDEKHLLRILLESFASNRLGAPNCKAVLHGPFNPYELKCHSLTRISKFRCVWIEKESINSVVISDSPADLHQRMLVAASLSVN---ETGSTMLLRETSLMPHIPGLPALLSMLFAPVMELRVDREGKCYTGVLCGLGWNSATEAPILPEHDIELAFDVRLNVEDIVEINILRAAIN 1295          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Mouse
Match: Tdrd9 (tudor domain containing 9 [Source:MGI Symbol;Acc:MGI:1921941])

HSP 1 Score: 322.013 bits (824), Expect = 7.459e-96
Identity = 228/614 (37.13%), Postives = 334/614 (54.40%), Query Frame = 2
Query:  512 GCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQL--EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQ-LDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFR 2332
            G GKSTQ+PQ++LD+        NIVVTQPR+I A S+A  ++ ER W +G  VGYQVGL++  + +T + ++TTGVLL++++  ++L ++THI +DEVHER  +MD LL VV+ LL  ++R  K++LMSAT+   +F+ YF+  +  K     P  +F +EGK   +EE++L+DL  +      PY     ++P +T ++ E+   L+      +M  S  K  +  Q   E  SVL+FLPGL +I  ++E L       N ++ R                L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRLI +  ++  + +   PE+L  PL   IL++K  +  +PRALL  AL  PSL DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP+   +GKL+ LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD L ++  F+ W    + G  R
Sbjct:    2 GSGKSTQLPQYVLDHYTQRSAFCNIVVTQPRKIGASSIARWISKERSWTLGGLVGYQVGLEKIATEDTRLIYMTTGVLLQKIVSAKSLMEFTHIFIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVVLMSATINCKQFADYFAVPVQNKM---NPAYVFEVEGKPHAIEEYYLNDLGHI-YHSGLPYRL---EEPVITKDVYEVAVSLIQMFDDLDMKESGNKTWSGAQFVSERSSVLVFLPGLGEINYMHELL------TNMIHKR----------------LQVYP-------------------------LHSSVTLEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCDQRKGRAGRVSKGYCYRLIPRDFWDSAIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPSLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVSQQLGKLVVLGHVFGCLDECLIIAAALSL-KNFFTMPF----------------RQHLDGYRNKVHFSGSSRSDCLALVEAFRAWQACRQRGELR 524          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Mouse
Match: Dhx36 (DEAH (Asp-Glu-Ala-His) box polypeptide 36 [Source:MGI Symbol;Acc:MGI:1919412])

HSP 1 Score: 248.44 bits (633), Expect = 4.859e-67
Identity = 220/691 (31.84%), Postives = 324/691 (46.89%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDD-LPKLGICQDAPYSYDVCQQP-------RLTAELKEMIYQ--------------LLMFITYTEMSDTKCTNINQL-----------EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALH 2392
            P +  +K+++  I N+Q  VI G TGCGK+TQV QFILDN           IV TQPRRI+AISVA  VA+ER    G+    GYQ+ L  R    +  I + TTG++L+ L  +  L+  +HI+LDE+HER++  D+L++V+KDLL   +  K+ILMSAT+ A+KFS YF               +  I G  FPV E+ L+D + K+    D        ++        R   E KE IY+                  +   +M D    ++N +           E G++L+FLPG  +I+ L++ L+                      S  +F                        D F ++ LHS +    Q + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D + + S++ AEW SK++ KQR GRAGRV+ G  Y L +    + LD++  PEIL  PL ++ L+IK       A  L R +D PS            EA  LSIK       ++K                   Q ELT +G  ++ LP++ H+GK+I  G  F  L+  + IA+ L+     F  PF     K           K  DA  K+  L++   SD LT++N F+ W +  + G FR  +D   +C   +L    L 
Sbjct:  201 PSYGMQKELVNLINNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVATERAESCGNGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDSRLSSVSHIVLDEIHERNLQSDVLMTVIKDLLHFRSDLKVILMSATLNAEKFSEYFGN-----------CPMIHIPGFTFPVVEYLLEDIIEKIRYVPDQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPAYIKELRTRYSASTVDVLQMMDDDKVDLNLIAALIRYIVLEEEDGAILVFLPGWDNISTLHDLLM----------------------SQVMFK----------------------SDKFLIIPLHSLMPTVNQTQVFKKTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPS-----------NEAVVLSIKHLMELSALDK-------------------QEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLS-----FKDPFVIPLGKE----------KIADARRKE--LAKETRSDHLTVVNAFEGWEEAKRRG-FRYEKD---YCWEYFLSSNTLQ 785          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Mouse
Match: Dhx57 (DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 [Source:MGI Symbol;Acc:MGI:2147067])

HSP 1 Score: 249.595 bits (636), Expect = 1.979e-66
Identity = 221/684 (32.31%), Postives = 331/684 (48.39%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEP---VNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLG--ICQD-APYSYDVCQ---------QPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSA-------AIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYN-QLDEFCPPEILTGPLTQVILRIKEF----NRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVL 2407
            P     + IL+ +  +Q +VI G TGCGK+TQ+PQFILDN+  N  P    NI+ TQPRRI+AISVA  VA ER   +G  VGYQ+ L+   S+ T + + TTGVLL +L  + TL   THII+DEVHER  + D LL V+KD++M     ++ILMSAT+ A  FS YFS              +  I G+ FPV++FFL+D   +   + QD +PY   + Q           R   E  E   +L + +   E S        QL+   +LI   G+S  + +    ++ +++ N         +  +G+ A          P   + K    ++  +            +  LHSS+   EQ+  F    +G  KII+STNIAE+SIT+ D+ YVID   +K  RYD      SL+  + S+++  QR GRAGRV +GV + L + + YN QL +   PEI   PL Q+ LRIK        + +++  R ++ P ++ +  + + L++ GAL+                                 +LT +G  ++SLP+D+ +GKL+ LG  F  L+  + IA+ L      F  PF S   K              +A +KKL  + +  SD L +L  +K W    K  A  S    Y +C   +L  + L E+  L
Sbjct:  493 PAWEERETILKLLSKHQVVVISGMTGCGKTTQIPQFILDNSL-NGPPERVANIICTQPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDATLQGVTHIIVDEVHERTEESDFLLLVLKDIVMQRATLQVILMSATLDAGLFSKYFSY-----------CPVITIPGRAFPVDQFFLEDALAVTRYVLQDGSPYMRSMKQIAKEKLKARHNRTAQEEVEEDLRLSLHLQDEEESVKDTIPDQQLDFKQLLIRYKGVSK-SVIKTMSVMDFEKVNLELIEALLEWIVDGKHAYPPGAVLVFLPGLAEIKMLYEQLQSNSLFNNRRSHRCVIHPLHSSLSSEEQQAVFVKPPMGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDAGKGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSTHNLQSVFSRLIEPPHIDSLRASKVRLRDLGALTPDE------------------------------KLTPLGYHLASLPVDVRIGKLMLLGSIFRCLDPALTIAASLA-----FKSPFVSPWDKKE------------EANQKKLEFAFAN-SDYLALLCAYKGWQLSTKESARAS----YNYCRQNFLSGRTLQEMASL 1111          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Mouse
Match: Dhx57 (DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 [Source:MGI Symbol;Acc:MGI:2147067])

HSP 1 Score: 249.21 bits (635), Expect = 2.763e-66
Identity = 221/684 (32.31%), Postives = 331/684 (48.39%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEP---VNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLG--ICQD-APYSYDVCQ---------QPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSA-------AIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYN-QLDEFCPPEILTGPLTQVILRIKEF----NRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVL 2407
            P     + IL+ +  +Q +VI G TGCGK+TQ+PQFILDN+  N  P    NI+ TQPRRI+AISVA  VA ER   +G  VGYQ+ L+   S+ T + + TTGVLL +L  + TL   THII+DEVHER  + D LL V+KD++M     ++ILMSAT+ A  FS YFS              +  I G+ FPV++FFL+D   +   + QD +PY   + Q           R   E  E   +L + +   E S        QL+   +LI   G+S  + +    ++ +++ N         +  +G+ A          P   + K    ++  +            +  LHSS+   EQ+  F    +G  KII+STNIAE+SIT+ D+ YVID   +K  RYD      SL+  + S+++  QR GRAGRV +GV + L + + YN QL +   PEI   PL Q+ LRIK        + +++  R ++ P ++ +  + + L++ GAL+                                 +LT +G  ++SLP+D+ +GKL+ LG  F  L+  + IA+ L      F  PF S   K              +A +KKL  + +  SD L +L  +K W    K  A  S    Y +C   +L  + L E+  L
Sbjct:  546 PAWEERETILKLLSKHQVVVISGMTGCGKTTQIPQFILDNSL-NGPPERVANIICTQPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDATLQGVTHIIVDEVHERTEESDFLLLVLKDIVMQRATLQVILMSATLDAGLFSKYFSY-----------CPVITIPGRAFPVDQFFLEDALAVTRYVLQDGSPYMRSMKQIAKEKLKARHNRTAQEEVEEDLRLSLHLQDEEESVKDTIPDQQLDFKQLLIRYKGVSK-SVIKTMSVMDFEKVNLELIEALLEWIVDGKHAYPPGAVLVFLPGLAEIKMLYEQLQSNSLFNNRRSHRCVIHPLHSSLSSEEQQAVFVKPPMGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDAGKGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSTHNLQSVFSRLIEPPHIDSLRASKVRLRDLGALTPDE------------------------------KLTPLGYHLASLPVDVRIGKLMLLGSIFRCLDPALTIAASLA-----FKSPFVSPWDKKE------------EANQKKLEFAFAN-SDYLALLCAYKGWQLSTKESARAS----YNYCRQNFLSGRTLQEMASL 1164          
BLAST of ATP-dependent RNA helicase TDRD9 vs. UniProt/SwissProt
Match: sp|Q8NDG6|TDRD9_HUMAN (ATP-dependent RNA helicase TDRD9 OS=Homo sapiens OX=9606 GN=TDRD9 PE=2 SV=3)

HSP 1 Score: 523.472 bits (1347), Expect = 1.922e-158
Identity = 426/1339 (31.81%), Postives = 672/1339 (50.19%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQ--LEMGSVLIFLPGLSDITELNEYLL-LGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDF--STLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSA-----------LKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGC----KIYSVVDNAVRVRVLMVDH-QDKI-LNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINF-MKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGID-SEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI R++++++  IE+N  ++I G+TG GKSTQ+PQ+ILD+        +IVVTQPR+I A S+A  ++ ER W +G  VGYQVGL++  + +T + ++TTGVLL++++  ++L ++THII+DEVHER  +MD LL VV+ LL  ++R  K++LMSAT++  +F+ YF+  +  K     P  IF +EGK   VEE++L+DL  +   + +P+   + ++P +T ++ E+   L+      +M  S  K  +  Q  LE  SVL+FLPGL +I  ++E L  L +KR                       L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRL+ +  + N + +   PE+L  PL   IL++K  +  +PRALL  AL  P L DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP++  +GKLI LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD + ++  FK W    +TG  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+ VD     +D++   +  F                       +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N        T+      +V M+IKM Q              ++ ++    ++    T++    +K+++      P+   + +  ++     ++    + I VT   E G F+G   +E ++E  +KL  EI+        LV        D  CLAP+    +  ++RA+++  S  +  VFFVDYGN   +  + L ++P   L+  P  A++F + +M+P   +      WS    + F + ++       GC    K++SVV + + V V      QD I + + LI    AE  EESY S+Q + +     +K   ++     ++  + F MK+                ES S N+    L    C  +       L  P +PY +K H +T   K R V +  +S+NS+II   P++   RM+VA  +  +     G+ +LLR T+LMP IPG P L++++F P  EL  D+    Y G  CGLG + + G  + P +DME+  DV+F   D+  VN +R+ +N
Sbjct:  133 PISRYKEEVVSLIESNSVVIIHGATGSGKSTQLPQYILDHYVQRSAYCSIVVTQPRKIGASSIARWISKERAWTLGGVVGYQVGLEKIATEDTRLIYMTTGVLLQKIVSAKSLMEFTHIIIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVVLMSATISCKEFADYFAVPVQNKMN---PAYIFEVEGKPHSVEEYYLNDLEHIHHSKLSPH---LLEEPVITKDIYEVAVSLIQMFDDLDMKESGNKAWSGAQFVLERSSVLVFLPGLGEINYMHELLTSLVHKR-----------------------LQVYP-------------------------LHSSVALEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCNQRKGRAGRVSRGYCYRLVHKDFWDNSIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPGLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVNQQLGKLIVLGHVFGCLDECLIIAAALSL-KNFFAMPF----------------RQHLDGYRNKVNFSGSSKSDCIALVEAFKTWKACRQTGELRYPKDELNWGRLNYIQIKRIREVAELYEELKTRISQ-FNMHVDSRRPVMDQEYIYKQRF-----------------------ILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGKDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRN-------PTERFKTLPAVYMAIKMSQLKVSLELSVHSAEEIEGKVQGMNVSKLRNTRVNVDFQKQTVD-----PMQVSFNTSDRS----QTVTDLLLTIDVTEVVEVGHFWGYRIDENNSEILKKLTAEINQL-----TLVPLPTHPHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLLMEIPCQFLE-LPFQALEFKICKMRPSAKSLVCGKHWSDGASQWFASLVS-------GCTLLVKVFSVVHSVLHVDVYQYSGVQDAINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENM-----TDGSVPFPMKDDEKYLIRILL------ESFSTNK----LGTPNCKAE-------LHGPFNPYELKCHSLTRISKFRCVWIEKESINSVIISDAPEDLHQRMLVAASLSINA---TGSTMLLRETSLMPHIPGLPALLSMLFAPVIELRIDQNGKYYTGVLCGLGWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAIN 1294          
BLAST of ATP-dependent RNA helicase TDRD9 vs. UniProt/SwissProt
Match: sp|B0XDC4|SPNE_CULQU (Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus OX=7176 GN=spn-E PE=3 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 2.245e-153
Identity = 439/1428 (30.74%), Postives = 692/1428 (48.46%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDT-RTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIE-GKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMG-------SVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNRD-PRALLQRALDCPSLEDIGYTFLTLKEAGAL--SIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIH---NPFIEDDAMRTFDGLDPFQCVEIGNLPMDE--GCLYRDTI------ADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTF-----NLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESI------------KNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNL---VKSKIFEVNDFCLAPYEGD---FYRAEIISKSN------QNCTVFFVDYGNSVTLQYNQLFDLPDFL--LKSCPLLAVKFILSEMKPYTAYHPDHKWSAQD----KEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKI-LNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHG-ITESCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGID-SEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQD------AMDKYQSGIKKFIASLLLKHSRDLVNNNNVGEYRVKTDISVLENDSYS 4516
            PI+ ++ +IL +I +N  +V+QG+TGCGK+TQVPQ++L+ AF   E  NI+VTQPR+IAAIS+A  VA ER  ++G+ VGY+VGL  + + +T + +VTTGVLL+ LI+++T+  YTH+ILDEVHER+VDMD LL VV+ LL  ++ +TK+ILMSAT+ A  FS YF     PK    L   +  +E  ++  V+EF+ DDL KL +  D    Y+    P ++ ++  +  +L++           C ++   E G       S++IFLPG+++I ++   L               +    + Q+AA  P                           ++ LHS++   +Q   F      +RK+ILSTNIAESSITV DIK+VID C+ + L  D  T+FS+L+ EWASKS+C QRAGRAGR+ +G VYRL+ +  + N +D    PEIL  PL  V+L+ K      P ++L  A+  P+L+DI  T L LKE GA+  ++K N                        D   G+LT++GR++S LP+D+ + KLI LGY F V+EE + I + + V     +Q                N +KT   + +K+  ++   SD + +LN +  W  R +        D Y W   + LD ++L ++  L  E+K RL                     +  +P    +S  + VV +   + ++L++ +AGAFYPNYF+ +       +E  +     G DP   V       +   G LY   I       D+ K+  MK      V+  R T  I  F    G+ T+E     +F     +  V  +IK+ +  A + RI          T+++ + ++++I              N  +P     ++ H + +  P I    +   VT+      F+     E +  + +F EI   + +A+ L        F +     AP + +   + RA + S  N       + TVFF+DYG++  ++      L D L  LK  P  A +  L+E++P     P   W+ +     KE+ L  I          K+YSVV     V +     +D+I +N ELI ++ A+YAEESY S+ D                 H H E K   +    +  +   ++++  + +   +E  D       LR      VVLS P  P        I  S  +PV++ +DSVNSI++D  PQ+   +++VA      G  EQGN L+LR T++MP+IPGF  +++LIF P A+L  DK +TR +    GLG D S G  L+P +DM +  DV  +  DI N+N +R  ++  L +     D      ++ K +  +K++I  +L    R L   +   +Y  + D+++    S S
Sbjct:   59 PINWNKPEILDKIRSNAVVVLQGATGCGKTTQVPQYLLEEAFERKEYCNIIVTQPRKIAAISIARRVAQERKCDLGTLVGYKVGLKEQHNEDTRLLYVTTGVLLQSLINSKTMATYTHVILDEVHEREVDMDFLLIVVRRLLSTNSKKTKVILMSATIDAKGFSEYFKI---PKKSGYLSAPVISVERPRLHVVQEFYFDDLEKLKV--DFQIDYEA---PGISEQMYNIAAKLVVV----------CDHLKGQEFGDSLEYKPSIIIFLPGINEIEKMEGAL---------------EKLIASIQNAAQRP------------------------NLLIMKLHSTLPADDQTAVFRKPGPNQRKVILSTNIAESSITVPDIKFVIDFCLQRILVTDTLTNFSTLRTEWASKSNCIQRAGRAGRLMSGRVYRLVDRRFFENNMDVSTSPEILRCPLETVVLKAKLLEMGTPPSILALAMAPPNLDDIRNTILLLKEVGAMLRTVKGNY-----------------------DQLDGDLTYLGRIMSKLPLDIRISKLIMLGYIFSVMEEAVTIGAGMNVKNIFLNQ----------------NSVKT---YSQKMYWADGSGSDAIAILNAYTAWKSRQEQAG--DTADMYNWARRMSLDRKSLIDMAELIHEVKDRLNR-------------------SGLKP----VSGPNRVVWNAREKTVILKVILAGAFYPNYFIPMSVGGKELMERQSFTELGGRDPCNTVFFTGFDHERYIGPLYTVQIKKILSEGDYSKHQAMK------VMYDRTTNRI--FVTFLGT-TDERDQRGSFMPGKVHADVYRAIKLRKLGA-RNRI----------TEIRTMRQRDAIDYATSAGLGHWEDANGWVPRRKIVRNAHLSVL--PPIFREKVVCQVTHVVHPNKFF--LRPEDNRNKDIFREIHTQL-NARQLHPFPADANFAMGQMVAAPVQENQETYARAVLRSYRNVRTTGSVSWTVFFIDYGHTAAMEETAFRQLDDSLGQLKDIPPRAFEATLTEIQPSAIISPQGSWTTESIHRFKELVLGKIFV-------AKVYSVVGVVASVEL----SRDEIRMNSELIRLKYAQYAEESYISKLD-----------------HDHRERKQREIMMDENLRNEVYRSAELTQNTYEDDELEDVNPPEDKLR----CKVVLSGPHSPLETSASATIRSSVMKPVSIESDSVNSILLDSNPQDTHEKLLVA-----GGVNEQGNRLVLRQTSVMPNIPGFGAIMSLIFCPTAQLKKDKDETRVVTVLSGLGYDPSTGEALYPEHDMALTLDVVLNDDDITNINALRYTMDSILHTGEGQTDPKFGDASIQKLKLQVKQYIIKILEHERRFLDLRHAPNDYNWRCDLNLTAGSSSS 1300          
BLAST of ATP-dependent RNA helicase TDRD9 vs. UniProt/SwissProt
Match: sp|Q14BI7|TDRD9_MOUSE (ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3)

HSP 1 Score: 509.22 bits (1310), Expect = 3.306e-153
Identity = 418/1333 (31.36%), Postives = 656/1333 (49.21%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQL--EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQ-LDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTF---RIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMS-------IKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCN-FIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMR--IAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCL-RQTVPQT-VVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGR-PLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI+R +++++  IE+N  ++I G+TG GKSTQ+PQ++LD+        NIVVTQPR+I A S+A  ++ ER W +G  VGYQVGL++  + +T + ++TTGVLL++++  ++L ++THI +DEVHER  +MD LL VV+ LL  ++R  K++LMSAT+   +F+ YF+  +  K     P  +F +EGK   +EE++L+DL  +      PY     ++P +T ++ E+   L+      +M  S  K  +  Q   E  SVL+FLPGL +I  ++E L       N ++ R                L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRLI +  ++  + +   PE+L  PL   IL++K  +  +PRALL  AL  PSL DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP+   +GKL+ LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD L ++  F+ W    + G  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+                F  P        H  V+ + +   +  +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N    T         NL+V MS       + +     ++ ++    ++    T++    +K+++      P+   +     N +  P    +  + I VT   E G F+G   +E++ E  ++L  EI+        LV   I    D  CLAP+    +  ++RA+I+  S  +  VFFVDYGN   +  + L ++P   L+  P  A++F + +M+P   +      WS      F   +      P+  K++S+V + + V V         +N   +L+R   AE AEESY S+Q   +  K    + +D        S +                         +   L  L+++    R   P    VL  P +PY +K H +T   K R V +  +S+NS++I   P +   RM+VA  +  +   E G+ +LLR T+LMP IPG P L++++F P  EL  D+    Y G  CGLG +S    P+ P +D+E+  DVR +  DI  +N +R+ +N
Sbjct:  135 PINRCKEEVISLIESNSVVIIHGATGSGKSTQLPQYVLDHYTQRSAFCNIVVTQPRKIGASSIARWISKERSWTLGGLVGYQVGLEKIATEDTRLIYMTTGVLLQKIVSAKSLMEFTHIFIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVVLMSATINCKQFADYFAVPVQNKMN---PAYVFEVEGKPHAIEEYYLNDLGHI-YHSGLPYR---LEEPVITKDVYEVAVSLIQMFDDLDMKESGNKTWSGAQFVSERSSVLVFLPGLGEINYMHELL------TNMIHKR----------------LQVYP-------------------------LHSSVTLEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCDQRKGRAGRVSKGYCYRLIPRDFWDSAIPDHVVPEMLRCPLGSTILKVKLLDMGEPRALLATALSPPSLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVSQQLGKLVVLGHVFGCLDECLIIAAALSL-KNFFTMPF----------------RQHLDGYRNKVHFSGSSRSDCLALVEAFRAWQACRQRGELRRPKDELDWGRLNYIQIKRIREVAELYEELKNRISQ-FNM----------------FVGP--------HHPVLDQEYPYKQRFILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGKDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRNP---TERFKTLPAVNLAVKMSQLKVSLELSVHAAEEIEGKVQGGSVSKLRNTRVNVDFQKQTVD-----PMQVSF-----NTLDRPRTVADLLLTIDVTEVVEVGHFWGYRIDERNAELLKQLTAEINRL-----ELVPLPIHPHPDLVCLAPFTDYNKESYFRAQILYVSGNSAEVFFVDYGNRSHVDLDLLREIPCQFLE-LPFQALEFKICKMRPSAKSLICGEHWSGGAHGRFAALVG---GCPLLVKVFSIVHSVLHVDVYRYSGAQDAVNVRDVLIREGYAELAEESYESKQSYEV-LKGFFAKSVDTMPDGSVSSPLK----------------------DDEKHLLRILLESFASNRLGAPNCKAVLHGPFNPYELKCHSLTRISKFRCVWIEKESINSVVISDSPADLHQRMLVAASLSVN---ETGSTMLLRETSLMPHIPGLPALLSMLFAPVMELRVDREGKCYTGVLCGLGWNSATEAPILPEHDIELAFDVRLNVEDIVEINILRAAIN 1295          
BLAST of ATP-dependent RNA helicase TDRD9 vs. UniProt/SwissProt
Match: sp|Q3MHU3|TDRD9_RAT (ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus OX=10116 GN=Tdrd9 PE=2 SV=3)

HSP 1 Score: 504.982 bits (1299), Expect = 1.047e-151
Identity = 419/1331 (31.48%), Postives = 656/1331 (49.29%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEM--SDTKCTNINQL--EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQ-LDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVD--FSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMS-------IKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCN-FIKIYVTYASECGSFYGIYEEEKDNE--QKLFMEISDFVTHAKNLVKSKIFEVNDF-CLAPY----EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMR--IAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQT-VVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGR-PLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI+R +++++  IE+N  ++I G+TG GKSTQ+PQ++LD+        NIVVTQPR+I A S+A  ++ ER W +G  VGYQVGL++  + +T + ++TTGVLL++++  ++L ++TH+ +DEVHER  +MD LL VV+ LL  ++R  K+ILMSAT+   +F+ YF+  +  K     P  +F +EGK   +E+++L+DL  +      PY  +   +P +T ++ E+   L+      +M  S  K  +  Q   E  SVL+FLPGL +I  ++E L       N ++ R                L++ P                         LHSS+ + EQ   F S   G RKIILSTNIAESS+TV D+KYVID C+ + L  D +T++ SL+  WASK+SC QR GRAGRV  G  YRLI +  ++  + +   PE+L  PL   +L++K  +  +PRALL  AL  PSL DI  T L LKE GAL++           EN           P D    GELTF+GR+++ LP+   +GKLI LG+ F  L+E +IIA+ L++ ++ F+ PF                 + LD +  K+  S S  SD L ++  F+ W    + G  R  +DE  W    Y+  + + EV  L +E+K R+ + FN+ VD     LD++   +  F                       +LQ+ +AGAFYPNYF     P  E+ A+R   G DP   V + ++P   G LY   +   F+  C +       ++    K  ++F  N    T         NL+V MS       + +     ++ ++    ++    T++    +K+++      P+   +     N +  P    +  + + VT   E G F+G   +E++ E  ++L  EI+        LV   I    D  CLAP+    +  ++RA+I+  S  +  VFFVDYGN   +  + L ++P  LL+  P  A++F + +M+P   +      WS      F   +   +  P+  K++S+V + + V V         +N   +L+R   AE AEESY S+Q   +  K    + +D        S +                     ES + N            R   P    VL  P +PY +K H +T   K R V +  +S+NS++I   P +   RM+VA  +  +   E G+ +LLR T+LMP IPG P L++++F P  EL  D+    Y G  CGLG +S    P+ P +D+E+  DV F+  DI  +N +R+ +N
Sbjct:  135 PINRCKEEVISLIESNSVVIIHGATGSGKSTQLPQYVLDHYTQRSAFCNIVVTQPRKIGASSIARWISKERSWTLGGLVGYQVGLEKTATEDTRLIYMTTGVLLQKIVSAKSLMEFTHVFIDEVHERTEEMDFLLLVVRKLLRTNSRFVKVILMSATINCKQFADYFAVPVQNKMN---PAYVFEVEGKPHTIEQYYLNDLGHIYHSGLPPYRLE---EPVITKDVYEVAVSLIQMFDDLDMKESGNKTWSGAQFVSERSSVLVFLPGLGEINYMHELL------TNMIHKR----------------LQVYP-------------------------LHSSVTLEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDEDTNYQSLRLSWASKTSCDQRKGRAGRVSKGYCYRLIHRDFWDSAIPDHVVPEMLRCPLGSTVLKVKLLDMGEPRALLATALSPPSLSDIERTILLLKEVGALAVSGQR-----EDEN-----------PHD----GELTFLGRVLAQLPVSQQLGKLIVLGHVFGCLDECLIIAAALSL-KNFFTMPF----------------RQHLDGYRNKVHFSGSSRSDCLALVEAFRAWQACRQRGELRHPKDELDWGRLNYIQIKRIREVAELYEELKNRISQ-FNMFVDPRHPVLDQEYPYKQRF-----------------------ILQVVLAGAFYPNYF-TFGQP-DEEMAVRELAGRDPKTTVVLKHIP-PYGFLYYKQLQSLFRQ-CGQVKS----IVFDGAKAFVEFSRNP---TERFKTLPAVNLAVKMSQLKVSLELSIHAAEEIEGKVQGGSVSKLRNTRVNVDFQKQTVD-----PMQVSF-----NTLDRPRTVADLLLTVDVTEVVEVGHFWGYRIDERNAELLRQLTAEINRL-----ELVPLPIHPHPDLVCLAPFTDYNKESYFRAQILYVSGNSAEVFFVDYGNRSHVDLDLLREIPCQLLE-LPFQALEFKICKMRPSAKSLICGEHWSGGANGRFAALV---SGCPLLVKVFSIVHSVLHVDVYRYSGAQDAVNIRDVLIREGYAELAEESYESKQSYEV-LKGFFAKSVDTMPDGSVSSPMK---------DDEKHLIQILLESFASN------------RLGAPNCKAVLHGPFNPYELKCHSLTRISKFRCVWIEKESINSVVISDSPADLHQRMLVAASLSVN---ETGSTMLLRETSLMPHIPGLPALLSMLFAPVMELRVDREGKCYTGVLCGLGWNSTTEAPILPEHDIELAFDVCFNVEDIVEINILRAAIN 1296          
BLAST of ATP-dependent RNA helicase TDRD9 vs. UniProt/SwissProt
Match: sp|B8A4F4|TDRD9_DANRE (ATP-dependent RNA helicase TDRD9 OS=Danio rerio OX=7955 GN=tdrd9 PE=2 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 5.527e-150
Identity = 392/1334 (29.39%), Postives = 658/1334 (49.33%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKL---GICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTK----CTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIK--------IYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEV----NDFCLAPYE-----GDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRV-LMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLR-QTVPQT-VVLSAPCHPYIMKFHGITE-SCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGR-PLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            PI ++ ++++  IENN  ++I+G+TG GK+TQ+PQFILD+    + P N+VVTQPR+I A S+A  VA ER   +GS VGYQVGL++  +  T + +VTTGVLL++L+ ++TLT+Y+HI +DEVHER  ++D LL VV+ LL  ++R  K+ILMSAT+   +F+ YF   I  +     P  +F +EG  + VEE++LD+L  +   G+  D      + Q P +T E+  +   L+      E  D +      +    E GSVL+FLPGL++I    +Y+                                            E L K+ +    +  LHS++ + EQ   F     G RKIILSTNIAESS+TV D+KYVID C++++L  D+ET++  L+  WASK+SC QR GRAGRV  G  YRL++++ + N++  F  PE+L  PL   +L++K  +  DPR++L  AL  P L DI  T L LK+ GALS++ N                          + G+LTF+GR+++ LP+DL +GKLI LG+ F  LEE +IIA+ L++ +S F+ P                 ++ L  +  KL  +++  SD +  +N FK WY     G  R  +DE +W     +  + + EV  L +++K+R+  +FN+ +  S+              +    +++H        +  +LQ+ IAGA +PNYF +      E  A +   G DP   + I NLP      Y+  +   F+  C +       +    ++  ++F      + +   +S   +  +L  ++     AL       ++ +A++ +  A  + + I +     +N   +S   + +G  S   N  K        I +T   + G F+G   +E   E++  +      T A N+   +   V    N  C+AP++       +YRA+++     N  VFFVD+GN+  +  + L +LP  L+      A +F ++ M P   +     +WS++ +  F    +  +       ++S++   +RV + +  +  D  + + L+    A +  ES+ S+Q + +            F  + +   +N                          + ++ L+   C    + P+   V+  P  P+ + FH +++ S  R V +  DS+N ++++  PQ+   RM+VA  V  S  G +   +LL+ T+LMP I G P L+ ++FTP  EL +++ +T + GA CGLG +S  +  + P +D+E+  DV+F+  DI  +N +R  +N
Sbjct:   90 PITKNRQELVSLIENNSVVIIRGATGSGKTTQLPQFILDHYAERNIPCNLVVTQPRKIGATSIARWVARERKCTLGSLVGYQVGLEKMATEHTKLIYVTTGVLLQKLVSSKTLTEYSHIFIDEVHERSEELDFLLLVVRKLLRSNSRYVKVILMSATINCIEFAEYFGSPIRNQMN---PAYVFEVEGAPYAVEEYYLDELKTMLPVGVNLD----LTLPQDPYITEEMYNVAVSLIQSFDEMEAKDHRRSEQTGSTTHPERGSVLVFLPGLAEI----QYM-------------------------------------------KEALSKLVRKRLQVYPLHSTVTLEEQNGVFLVPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLVRQLACDKETNYRCLRITWASKTSCNQRRGRAGRVSKGFCYRLVTRHFWENEIPNFSIPEMLRSPLASTLLKVKLLDMGDPRSVLSTALTPPILGDIERTVLQLKQIGALSVQSNS----------------------QRQFDGDLTFLGRVLAQLPVDLQLGKLIVLGHVFGCLEECLIIAASLSL-KSFFAMP----------------SLQQLAGYRSKLSFAQNVPSDFIAYVNAFKAWYTSRAKGELRHPKDELEWGKENCIQIKRIREVAELFEDLKKRVS-RFNMHISSSS--------------NPTDYTSLHK-------QRFILQVVIAGALFPNYFSQ--GEIDEQLASKELSGNDPKTTILIRNLPPFAFLCYKQ-LQSLFRQ-CGQVKS----IAFDGSRAYVEF------HRSCVRESGVLHEVLLALLRSRHTPALH-----LQVHHADEVEFHA--KGKPIAHLRYTRVNVDVQSHTVSPVGVLSSSVNPEKLPTSRDFVINITEVIDVGHFWGFQTDENSVEKQCQL------TAALNMRDLRPLSVSLYPNLLCVAPFKDGQQMAKYYRAKVLHILGSNVEVFFVDFGNTTVVPSSSLRELPSDLMTPA-FQAQEFCIARMAPSAQSLILGDRWSSRARNRFKTLTSGRSAI---VSLFSILHGVMRVDLHISTETGDVSVADLLVQEGHACHTPESFESQQSHEVLISLYEDMASGRFTPSFASGSLN-------------------SRMEEDKQLINQLLLHFCSSGSSAPKCKAVVHGPSSPHKVNFHSMSKVSNFRSVNIERDSINCVMVNENPQDWHERMLVAASVSLSASGSR---ILLKETSLMPHIHGLPSLVTMLFTPVMELRTNEDRTCFTGALCGLGWNSVSQEAVLPEHDIEIAFDVKFEIEDITEINALRGTVN 1255          
BLAST of ATP-dependent RNA helicase TDRD9 vs. TrEMBL
Match: A0A0M4H5T1 (Tudor domain-containing 9 OS=Macrostomum lignano OX=282301 GN=tdrd9 PE=2 SV=1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 496/1586 (31.27%), Postives = 754/1586 (47.54%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLL-MHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTA--------ELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNT----------FNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQN-CTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIF--------LNYINCYTNT-PVGCKIYSVVDNAVRVRVLMVDHQDKILNEEL--------------------------ILMRI-------------AEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVP----QTVVLSAPCHPYIMKFHGITESCKRP-VTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQ-TRYIGAKCGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQDA---------MDKYQSGIKKFIASLLLKHSRDLVNNN------NVGEYRVKTDISVLENDSYSNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEEN--------------LKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNVLQMR 4885
            PI +H +DILR ++ +  + IQG+TGCGKSTQVPQ+ILDNA   ++PVNI+VTQPRRIAA+SV+  +  +R W   +  GYQ+GLD + S +T I +VTTGVLLE+LIH++ L  ++HIILDE HERD++MD+ L V+K L+    T TK+++MSAT+   K   Y        TL+ +     R+    + VE ++  D  +  +    P   DV Q PRLT         EL +   QL+  +            I   E G+VL+FLPGL DI  L++YL                                DP  C+           +    + ++ LHS++   +Q+RAF + +  +RK+IL+TNIAESSIT++DI YVIDLC  K L  D  +  SSL+  WASKS+ KQR+GRAGR+++GV YRLI+  +  +L+EF P  +L  P+   IL++K     P + L  A+D PS   I  + + LK   ALS                          + DH+ GELTF+GR+I+ LP+D+ +GKLI L + F  LE+ +II +C++ S+S+FS+P    +     YS           FE+KL  S+   SD + M + FK + Q  ++G F S  +  +WC + ++DP+AL EVE L  ++ RRL EKFNI          +  + A  +   + +  I            LL I +AGAFYPN+F+R  + + E  A + F G DP   V     P++EG LYR  +AD  K +CM     +P V   N+K  + F   +   T   ++ +T           + SVL+++K G+ +  + R   +   N +++K  ++L++   K    L        G K+ +     + NF  +  T+    G FYGI ++    E ++  ++ +     K  + S+ F V    LAPY+GD+YR  ++         V F+DYGN+ ++  N+L  +P+  L+  P LAV+  L+E+KP    H D +W+ ++  +F         + I+  T+   V C+I+S+V + VRVRV M+  +  ++++E+                          IL RI             AE A E Y SR+DN  R +     H    G T+S +  +                            LD L++   L    P           P HP+ MKF G+  S +R  + L  DSVNS+ IDPEPQN   R+++A  V      +  N L+L +TTL P IPG P L+ L+F P  E   +    T Y G  CG+G   +G+P+ PA+D+ +  DV  D+SD+  VN IR   N  LG    S            +   Q+ ++  +  L  K +  LV         N   +     + V      + +   + I+  H  I+ +            G      A  + LP   A A  N              L D LQ    ++R   SR       +C +C  +          G+ +    +LEDH+ SN+H +NV   R
Sbjct:  174 PILQHREDILRSLQCSDIVFIQGNTGCGKSTQVPQYILDNAVDKEQPVNIIVTQPRRIAAVSVSDWICKQRNWAKNARCGYQIGLDNQQSQDTCILYVTTGVLLEKLIHSKRLDYWSHIILDEAHERDLEMDMCLLVIKQLMGASGTGTKLVVMSATMDDAKIRRYLCSDKADDTLDTI-----RVSEAPYDVETYYYHDAIER-VNNSQPMQNDV-QLPRLTPQDVDPDDFELNDHKMQLIKRL------------IASFESGAVLVFLPGLYDIISLSDYLK-------------------------------DPSKCV----------GIDPHDWEIIPLHSTVSADQQRRAFNNYEF-KRKVILATNIAESSITIEDIVYVIDLCQTKYLCKDDNSTLSSLRVGWASKSNLKQRSGRAGRLQSGVCYRLITPEIDAELEEFEPSAMLRCPIENCILKVKLMGEAPLSFLTAAIDPPSPVRIAESVIRLKLVSALSSN------------------------VADHFDGELTFLGRVIAHLPVDILVGKLIVLSFIFGCLEDGVIIGACMSSSKSLFSRPIVDFQPDQAIYS-----------FEEKLIYSQGSCSDSVAMCSAFKNFLQNRQSGVFHSDMEVIRWCRTKFIDPRALKEVESLHTDLLRRL-EKFNIR-------PTNSRQGANAKEPQDEVDKI------------LLPIVLAGAFYPNFFIRDTSAYGETGASKEFAGHDPSNTVMFSGFPLNEGDLYRRQLADLVKKYCMHKVLGEPSVSSENSKCFVSFDVEHVMDTEAKSNPDTACGLPSLVGRIHPSVLLALKAGKMAVFRLR---YRDAN-QRSKFMSVLQEFYSKRPDRLAAG-AANDGPKSPLACLGSEQNFF-VEPTHVVNVGHFYGIPKDFFGMEHEMLNQLQNCT---KTRLSSEPF-VGLMALAPYQGDYYRCCVLGAPQAGKILVRFIDYGNTGSVLVNELCSMPEN-LREYPPLAVEIKLAEIKPRGFTHFDGEWTCKESSLFKKILSSRLFSTIHSRTDKLLVHCRIFSIVCDVVRVRVSMIKDKTALIDDEVPTLNMILVQGSACRNMPDWASATLSEILRRIGAPRIQDGFDLSLAESATECYESRRDNSHRRRTFTTSH----GKTNSAASTSGGNGSYGRLF--------------DRSELDVLVRNFELTAGAPVFGRGYFTPRGPSHPFEMKFRGLCNSYRRKQIGLDADSVNSVAIDPEPQNPTDRLLIAGSVMLDSKNQ--NRLVLSHTTLFPHIPGLPALLCLLFAPQMEPRCNPHGLTHYTGFLCGMGA-IDGQPVDPAHDLLVQPDVLLDNSDLVRVNQIRMQANFMLGDRGGSSSLQLVECDLVNLRNRQNMLRSLLRQLFFKTAYPLVPKTLETAGPNADYWGWPRRLGVTMGTPTNQIANCS-IYSLHNAIQDIGAN--------KGRLLATSAGGQLLPDNGANANYNKSGWDAWVLRWRQFLNDQLQ---CLNRAVQSRRDDGWAFVCPVCYDSC------GNAGLFLHDLKELEDHLGSNEHAENVAYWR 1593          
BLAST of ATP-dependent RNA helicase TDRD9 vs. TrEMBL
Match: A0A0L8I0F8 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22039846mg PE=4 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 459/1363 (33.68%), Postives = 705/1363 (51.72%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMH-DTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLG-ICQDAPYSYDVCQQPRLTAELKEMIYQLLM-FITY-TEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQ-YVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSR-EDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITV-DFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPN---NGSYTNESTDSNT--FNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIG----FPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVK-SKIFEVNDFCLAPY---EGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVL-MVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDY----LMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALG----SSMHSQDAMDKYQSGIKKFIASLLLK 4429
            PI  H+  I+  +E+NQ  VIQG TG GK+TQVPQFILD+  + ++  NIVVTQPRRIAAIS+A  +  ER W++G++ GYQVG+DR+ S  T ++++TTGVLL++LI+ + + DYTH+ILDE+HERD + D  + +V+  L     R ++ILMSAT+ ++ F+ YF+  +   TL+P P  I  I+G  F V E++++DL  LG I Q  P        P +T E +++   L+  F T+ T+       +  Q   GSVL+FLPGLSDI +L +                               LR  P                 Q    ++ LHSS+ I EQ + F+    G RK+ILSTNIAESSITV DIKYVID C+ K L  D +T+F+SL+ +WASK++C QR GRAGRV NG VYRLI++ + YN + ++  PE+   PL  ++LR K  +  +P+A+L  AL  P+L+DI  T L LKE GAL++  N +                      + +  +LT++GR+I+SLP D+ +GKL+  G+ F  L+E +I+A+ L++ +S+ S+P+                 K L+++++K   +++ +SD + ++N +K+W +    G F+ R + E +W  + ++  + +HE+  L  E++ RL + FN+ +   S   KKD           NH               +L ++ I GAFYPNYF+R  +   E+  M+T  G DPF  V I  LP ++G LY+  I   F   C         +    +K  I+F  +   N +  N     NT   N +V +++KM + S     ++ +    A K  +K + E +S     +  L     +     +G     P+   + I+I VT   ECG F+  Y    D E  L+   S    + ++L   S    V   C APY   E  +YRA++ +  N    VFFVDYGN   + ++ L  LP  LL   P  A +  LS ++P      D  WS +  + F N ++ +   P+  +IYSVV   + V ++     Q + +N++LI +  A+  EES+ S++D+  R K      + +  ++ + S                               LD+    L     L + V + + L  P +P  M F G+T S + R   + +DSVN + ID  PQN   RMMVA  V  +  G    +++ R+TTLMP I G P L+A++FTPY EL +DK  T Y GA CGLG DSE G  ++P +DME+  D + D  DI  +NGIR  +NI +G    +S    +++ K Q   ++ +  L+ K
Sbjct:  144 PIEEHKSQIINTVESNQVTVIQGPTGSGKTTQVPQFILDHYASKNQYCNIVVTQPRRIAAISIAKRICQERRWKLGTFCGYQVGMDREVSPNTRLTYMTTGVLLQKLINKKDINDYTHVILDEIHERDQETDFCILIVRKFLRSVSKRIRVILMSATLDSEMFANYFALPVR-NTLDPAP--IITIDGSFFSVSEYYVEDLVPLGTIGQLDP------DNPHITPESQQLAVNLIQHFNTFETKEQGNDPHSGQQPICGSVLVFLPGLSDIDKLYD------------------------------KLRTLPG----------------QHRLVVIPLHSSVTIEEQSKVFQPTSPGYRKVILSTNIAESSITVPDIKYVIDFCLTKNLMCDTQTNFTSLQLDWASKANCIQRKGRAGRVSNGRVYRLITRSFWYNHIPDYNTPEMQRCPLDLLVLRTKILDLGEPKAILALALAPPNLDDIERTILELKEIGALALTLNGVP---------------------NRYDADLTYMGRVIASLPTDIRIGKLLVWGHVFGFLKECLILAAALSL-KSVISRPY----------------KKHLESYQRKFSWADASFSDCIAIVNIYKVWERNWAHGIFKRRGQSEVEWGKANFVQIKRIHELAELIRELEFRLTQ-FNLRIPSKSPESKKDL----------NHPE-----------EKLLFKLIICGAFYPNYFIR--DKIDEEQVMKTMSGKDPFNTVMINGLPPNQGSLYKSQIEQLFYP-CGNIL----AIHMEESKIFIEFARHYSMNRALNNIIGMGNTGVVNPAVYLALKMKKTSYRTLELEQYSRETATKM-MKQVSEAQSNVAGKLQMLRTNRITAASAIVGNQVDLPNYSMSVIQIIVTEVLECGHFWARY---VDQENSLYFVQSSLNINPQDLQPISGNVHVGMICAAPYKDEEVHYYRAQVEAIHNNMAHVFFVDYGNMEIVPFHNLKLLPQDLL-DVPFQAFECYLSGIQPSPIKCFDGCWSQESTDYFQNMVSGF---PIYAQIYSVVGRVLHVELIKKKSKQQENINQKLIDLGYADVTEESFLSKKDHEERKKAQESSSLSVCQNSDATS-------------------------------LDWNALGLTNEFSLVRYVGK-IKLHGPSNPLEMTFSGMTNSGRLRGAKIDSDSVNCVAIDDNPQNSTARMMVAAFVHMNANGV---NVITRDTTLMPHIAGLPALVAMLFTPYCELRTDKNMTYYSGAICGLGFDSETGAAIYPEHDMEIEFDSKIDLDDIFKINGIRLAINIIIGNQQTASTWGPESVVKLQESARRKLLDLMQK 1341          
BLAST of ATP-dependent RNA helicase TDRD9 vs. TrEMBL
Match: A0A1I8HLR0 (Tudor domain-containing 9 OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021385g1 PE=4 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 495/1586 (31.21%), Postives = 754/1586 (47.54%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLL-MHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTA--------ELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNT----------FNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQN-CTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIF--------LNYINCYTNT-PVGCKIYSVVDNAVRVRVLMVDHQDKILNEEL--------------------------ILMRI-------------AEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVP----QTVVLSAPCHPYIMKFHGITESCKRP-VTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQ-TRYIGAKCGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQDA---------MDKYQSGIKKFIASLLLKHSRDLVNNN------NVGEYRVKTDISVLENDSYSNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEEN--------------LKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNVLQMR 4885
            PI +H +DILR ++ +  + IQG+TGCGKSTQVPQ+ILDNA   ++PVNI+VTQPRRIAA+SV+  +  +R W   +  GYQ+GLD + S +T I +VTTGVLLE+LIH++ L  ++HIILDE HERD++MD+ L V+K L+    T TK+++MSAT+   K   Y        TL+ +     R+    + VE ++  D  +  +    P   DV Q PRLT         EL +   QL+  +            I   E G+VL+FLPGL DI  L++YL                                DP  C+           +    + ++ LHS++   +Q+RAF + +  +RK+IL+TNIAESSIT++DI YVIDLC  K L  D  +  SSL+  WASKS+ KQR+GRAGR+++GV YRLI+  +  +L+EF P  +L  P+   IL++K     P + L  A+D PS   I  + + LK   ALS                          + DH+ GELTF+GR+I+ LP+D+ +GKLI L + F  LE+ +II +C++ S+S+FS+P    +     YS           FE+KL  S+   SD + M + FK + Q  ++G F S  +  +WC + ++DP+AL EVE L  ++ RRL EKFNI          +  + A  +   + +  I            LL I +AGAFYPN+F+R  + + E  A + F G DP   V     P++EG LYR  +AD  K +CM     +P V   N+K  + F   +   T   ++ +T           + SVL+++K G+ +  + R   +   N +++K  ++L++   K    L        G K+ +     + NF  +  T+    G FYGI ++    E ++  ++ +     K  + S+ F V    LAPY+GD+YR  ++         V F+DYGN+ ++  N+L  +P+  L+  P LAV+  L+E+KP    H D +W+ ++  +F         + I+  T+   V C+I+S+V + VRVRV M+  +  ++++E+                          IL RI             AE A E Y SR+DN  R +     H    G T+S +  +                            LD L++   L    P           P HP+ MKF G+  S +R  + L  DSVNS+ IDPEPQN   R+++A  V      +  N L+L +TTL P IPG P L+ L+F P  E   +    T Y G  CG+G   +G+P+ PA+D+ +  DV  D+SD+  VN IR   N  LG    S            +   Q+ ++  +  L  K +  LV         N   +     + V      + +   + ++  H  I+ +            G      A  + LP   A A  N              L D LQ    ++R   SR       +C +C  +          G+ +    +LEDH+ SN+H +NV   R
Sbjct:  174 PILQHREDILRSLQCSDIVFIQGNTGCGKSTQVPQYILDNAVDKEQPVNIIVTQPRRIAAVSVSDWICKQRNWAKNARCGYQIGLDNQQSQDTCILYVTTGVLLEKLIHSKRLDYWSHIILDEAHERDLEMDMCLLVIKQLMGASGTGTKLVVMSATMDDAKIRRYLCSDKADDTLDTI-----RVSEAPYDVETYYYHDAIER-VNNSQPMQNDV-QLPRLTPQDVDPDDFELNDHKMQLIKRL------------IASFESGAVLVFLPGLYDIISLSDYLK-------------------------------DPSKCV----------GIDPHDWEIIPLHSTVSADQQRRAFNNYEF-KRKVILATNIAESSITIEDIVYVIDLCQTKYLCKDDNSTLSSLRVGWASKSNLKQRSGRAGRLQSGVCYRLITPEIDAELEEFEPSAMLRCPIENCILKVKLMGEAPLSFLTAAIDPPSPVRIAESVIRLKLVSALSSN------------------------VADHFDGELTFLGRVIAHLPVDILVGKLIVLSFIFGCLEDGVIIGACMSSSKSLFSRPIVDFQPDQAIYS-----------FEEKLIYSQGSCSDSVAMCSAFKNFLQNRQSGVFHSDMEVIRWCRTKFIDPRALKEVESLHTDLLRRL-EKFNIR-------PTNSRQGANAKEPQDEVDKI------------LLPIVLAGAFYPNFFIRDTSAYGETGASKEFAGHDPSNTVMFSGFPLNEGDLYRRQLADLVKKYCMHKVLGEPSVSSENSKCFVSFDVEHVMDTEAKSNPDTACGLPSLVGRIHPSVLLALKAGKMAVFRLR---YRDAN-QRSKFMSVLQEFYSKRPDRLAAG-AANDGPKSPLACLGSEQNFF-VEPTHVVNVGHFYGIPKDFFGMEHEMLNQLQNCT---KTRLSSEPF-VGLMALAPYQGDYYRCCVLGAPQAGKILVRFIDYGNTGSVLVNELCSMPEN-LREYPPLAVEIKLAEIKPRGFTHFDGEWTCKESSLFKKILSSRLFSTIHSRTDKLLVHCRIFSIVCDVVRVRVSMIKDKTALIDDEVPTLNMILVQGSACRNMPDWASATLSEILRRIGAPRIQDGFDLSLAESATECYESRRDNSHRRRTFTTSH----GKTNSAASTSGGNGSYGRLF--------------DRSELDVLVRNFELTAGAPVFGRGYFTPRGPSHPFEMKFRGLCNSYRRKQIGLDADSVNSVAIDPEPQNPTDRLLIAGSVMLDSKNQ--NRLVLSHTTLFPHIPGLPALLCLLFAPQMEPRCNPHGLTHYTGFLCGMGA-IDGQPVDPAHDLLVQPDVLLDNSDLVRVNQIRMQANFMLGDRGGSSSLQLVECDLVNLRNRQNMLRSLLRQLFFKTAYPLVPKTLETAGPNADYWGWPRRLGVTMGTPTNQIANCS-MYSLHNAIQDIGAN--------KGRLLATSAGGQLLPDNGANANYNKSGWDAWVLRWRQFLNDQLQ---CLNRAVQSRRDDGWAFVCPVCYDSC------GNAGLFLHDLKELEDHLGSNEHAENVAYWR 1593          
BLAST of ATP-dependent RNA helicase TDRD9 vs. TrEMBL
Match: A0A1I8HGZ0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 495/1586 (31.21%), Postives = 754/1586 (47.54%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLL-MHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTA--------ELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNT----------FNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQN-CTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIF--------LNYINCYTNT-PVGCKIYSVVDNAVRVRVLMVDHQDKILNEEL--------------------------ILMRI-------------AEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVP----QTVVLSAPCHPYIMKFHGITESCKRP-VTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQ-TRYIGAKCGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQDA---------MDKYQSGIKKFIASLLLKHSRDLVNNN------NVGEYRVKTDISVLENDSYSNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEEN--------------LKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNVLQMR 4885
            PI +H +DILR ++ +  + IQG+TGCGKSTQVPQ+ILDNA   ++PVNI+VTQPRRIAA+SV+  +  +R W   +  GYQ+GLD + S +T I +VTTGVLLE+LIH++ L  ++HIILDE HERD++MD+ L V+K L+    T TK+++MSAT+   K   Y        TL+ +     R+    + VE ++  D  +  +    P   DV Q PRLT         EL +   QL+  +            I   E G+VL+FLPGL DI  L++YL                                DP  C+           +    + ++ LHS++   +Q+RAF + +  +RK+IL+TNIAESSIT++DI YVIDLC  K L  D  +  SSL+  WASKS+ KQR+GRAGR+++GV YRLI+  +  +L+EF P  +L  P+   IL++K     P + L  A+D PS   I  + + LK   ALS                          + DH+ GELTF+GR+I+ LP+D+ +GKLI L + F  LE+ +II +C++ S+S+FS+P    +     YS           FE+KL  S+   SD + M + FK + Q  ++G F S  +  +WC + ++DP+AL EVE L  ++ RRL EKFNI          +  + A  +   + +  I            LL I +AGAFYPN+F+R  + + E  A + F G DP   V     P++EG LYR  +AD  K +CM     +P V   N+K  + F   +   T   ++ +T           + SVL+++K G+ +  + R   +   N +++K  ++L++   K    L        G K+ +     + NF  +  T+    G FYGI ++    E ++  ++ +     K  + S+ F V    LAPY+GD+YR  ++         V F+DYGN+ ++  N+L  +P+  L+  P LAV+  L+E+KP    H D +W+ ++  +F         + I+  T+   V C+I+S+V + VRVRV M+  +  ++++E+                          IL RI             AE A E Y SR+DN  R +     H    G T+S +  +                            LD L++   L    P           P HP+ MKF G+  S +R  + L  DSVNS+ IDPEPQN   R+++A  V      +  N L+L +TTL P IPG P L+ L+F P  E   +    T Y G  CG+G   +G+P+ PA+D+ +  DV  D+SD+  VN IR   N  LG    S            +   Q+ ++  +  L  K +  LV         N   +     + V      + +   + ++  H  I+ +            G      A  + LP   A A  N              L D LQ    ++R   SR       +C +C  +          G+ +    +LEDH+ SN+H +NV   R
Sbjct:  159 PILQHREDILRSLQCSDIVFIQGNTGCGKSTQVPQYILDNAVDKEQPVNIIVTQPRRIAAVSVSDWICKQRNWAKNARCGYQIGLDNQQSQDTCILYVTTGVLLEKLIHSKRLDYWSHIILDEAHERDLEMDMCLLVIKQLMGASGTGTKLVVMSATMDDAKIRRYLCSDKADDTLDTI-----RVSEAPYDVETYYYHDAIER-VNNSQPMQNDV-QLPRLTPQDVDPDDFELNDHKMQLIKRL------------IASFESGAVLVFLPGLYDIISLSDYLK-------------------------------DPSKCV----------GIDPHDWEIIPLHSTVSADQQRRAFNNYEF-KRKVILATNIAESSITIEDIVYVIDLCQTKYLCKDDNSTLSSLRVGWASKSNLKQRSGRAGRLQSGVCYRLITPEIDAELEEFEPSAMLRCPIENCILKVKLMGEAPLSFLTAAIDPPSPVRIAESVIRLKLVSALSSN------------------------VADHFDGELTFLGRVIAHLPVDILVGKLIVLSFIFGCLEDGVIIGACMSSSKSLFSRPIVDFQPDQAIYS-----------FEEKLIYSQGSCSDSVAMCSAFKNFLQNRQSGVFHSDMEVIRWCRTKFIDPRALKEVESLHTDLLRRL-EKFNIR-------PTNSRQGANAKEPQDEVDKI------------LLPIVLAGAFYPNFFIRDTSAYGETGASKEFAGHDPSNTVMFSGFPLNEGDLYRRQLADLVKKYCMHKVLGEPSVSSENSKCFVSFDVEHVMDTEAKSNPDTACGLPSLVGRIHPSVLLALKAGKMAVFRLR---YRDAN-QRSKFMSVLQEFYSKRPDRLAAG-AANDGPKSPLACLGSEQNFF-VEPTHVVNVGHFYGIPKDFFGMEHEMLNQLQNCT---KTRLSSEPF-VGLMALAPYQGDYYRCCVLGAPQAGKILVRFIDYGNTGSVLVNELCSMPEN-LREYPPLAVEIKLAEIKPRGFTHFDGEWTCKESSLFKKILSSRLFSTIHSRTDKLLVHCRIFSIVCDVVRVRVSMIKDKTALIDDEVPTLNMILVQGSACRNMPDWASATLSEILRRIGAPRIQDGFDLSLAESATECYESRRDNSHRRRTFTTSH----GKTNSAASTSGGNGSYGRLF--------------DRSELDVLVRNFELTAGAPVFGRGYFTPRGPSHPFEMKFRGLCNSYRRKQIGLDADSVNSVAIDPEPQNPTDRLLIAGSVMLDSKNQ--NRLVLSHTTLFPHIPGLPALLCLLFAPQMEPRCNPHGLTHYTGFLCGMGA-IDGQPVDPAHDLLVQPDVLLDNSDLVRVNQIRMQANFMLGDRGGSSSLQLVECDLVNLRNRQNMLRSLLRQLFFKTAYPLVPKTLETAGPNADYWGWPRRLGVTMGTPTNQIANCS-MYSLHNAIQDIGAN--------KGRLLATSAGGQLLPDNGANANYNKSGWDAWVLRWRQFLNDQLQ---CLNRAVQSRRDDGWAFVCPVCYDSC------GNAGLFLHDLKELEDHLGSNEHAENVAYWR 1578          
BLAST of ATP-dependent RNA helicase TDRD9 vs. TrEMBL
Match: A0A2R2MMS9 (ATP-dependent RNA helicase TDRD9 OS=Lingula unguis OX=7574 GN=LOC106162670 PE=4 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 497/1523 (32.63%), Postives = 759/1523 (49.84%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDT-RTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLG-ICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDT-KCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQ-LDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLW-------YQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFP--PNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLK---------AILEKES-IKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNL--VKSKIFEVNDFCLAPY---EGDFYRAEIISKSN-QNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRV---LMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTK---CNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITE-SCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQ----DAMDKYQSGIKKFIASLLLKHSRDLVNNNNVGEYRVKTDISVLENDSYSNVRQITKIFIPHI--VIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEENLKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNV 4873
            PI  + +D++  IE+N+  VIQGSTG GK+TQVPQ+ILD+     +  NIVVTQPRRIAA+S+A  V  ERGW +GS VGYQV LDR  S++T + +VTTGVLL++LI  + + ++TH++LDEVHERD D D  L VV+ LL  ++   K++LMSAT  +D F+ YF   +  K +EP P  +  +EG+ + V E++++DL  LG + +  P        P + +E   +  +L+      E+ D  K  N    + G+VLIFLPG+ +I +L ++L                                      R + E  +L        ++L LHSSI   EQ R F+  Q G RKIILSTNIAESSITV DIKYVID C+ K L  D ET++S L+ EWASK++  QR GRAGRV +G VYR++ +  Y + + E+  PE+   PL Q+IL++K  +  +P+A+L  AL  P+L+DI  T L LKE GALS          +  +G        V P D    GELTFIGR+++SLP+D+ +GKL  LG+ F +LE+ III + +++ +S F++PF +                 L+A++ +L  ++  +SD +  LN +K W       Y   K     SRE +  WC S ++  + + EV  L  E+  RL  KFNI +                 P        H +  +    +++L++ IAGAFYPNYF  I+    E DA+R+  G DP   V + NLP ++G LY+  I + F   C K    +P V    TK  I+F   PN       S+ +      V +++K+ Q   LKP      L + E+ +++         A L+ E  ++ N I     +  S     +  P      I + VT   +CG F+  Y +E        ++ +  + + ++L  +     +V   C+AP+     +FYRA + S  + Q   VFFVDYGN   ++ ++L      L+   P  A +  LS +KP     PD KW     +I   Y     N  V  K+YS+++NA+RV +   L    +    NE LI   +A+ AEE+Y SRQ++  R +   C++  HI     +    K N+++  +                       DY ++    R    +   L  P +PY M F+ +T     R   +   SVN+I+++ EPQ+   R+MVA  V+ +     G+ ++  +TTLMP+I G P LI L+F P AEL +D+ +TRY GA CGLG D E G P  P +D+E+  D + D +DI  +NG++  +N+A+GS   S     D ++  Q   +K + SLL +    +   N    YR      V E+D   N    T+   P +  +++G+A     +  P   +      K E + +++   E                K+ + +  E  +CE+C              V   +  D+  HIQ+  H+Q V
Sbjct:  146 PITHYHEDVVDTIESNRVTVIQGSTGSGKTTQVPQYILDHYAQAGKYCNIVVTQPRRIAAMSIARRVCQERGWRLGSVVGYQVALDRFGSDDTRLMYVTTGVLLQKLISAKNMREFTHVVLDEVHERDEDSDFCLLVVRKLLRSNSPHVKVVLMSATFDSDMFAGYFGTPVLGK-VEPAP--VVSVEGRAYTVSEYYVEDLKTLGELPELEP------NNPCIPSESMNLCKKLVQQFDNLEIQDQGKTVNGFAPKRGTVLIFLPGMGEIKDLEDHL--------------------------------------RELTESHRL--------WVLPLHSSITAEEQTRVFDLPQSGFRKIILSTNIAESSITVPDIKYVIDFCLTKVLVCDPETNYSRLQVEWASKANSNQRRGRAGRVSDGRVYRMVYRKFYEEHMQEYGRPEMQRSPLDQLILQVKLLDLGEPKAILGMALSPPNLDDIERTILMLKEVGALS----------SLSSG-------AVNPHD----GELTFIGRVLASLPVDIRIGKLFMLGHVFGLLEQCIIIGAAMSL-KSFFARPFNA----------------DLNAYKSRLGWADGSFSDSIAYLNAYKTWESNKQDPYSGFK--GLVSREQQ--WCKSQFIQIRRIAEVATLVKELTDRLA-KFNIRI-----------------PRGR-----HRLPPNPGQDLLILKVVIAGAFYPNYF--INGASDEQDAIRSMSGKDPCTTVMVKNLPANQGALYKHAIENLFM-CCGK----RPKVHFEETKAYIEFERDPN-------SSQTQLIEPPVYVALKLKQ---LKPVCLELNLIDPEQARIRMEQLQRIQDAKLQTEKRLRTNRIKAATDQASSVSVRQVPLPKASQTTITLCVTEVIDCGHFWAQYGDEDTRRTMAHIQTALNMHNGRDLQDLSPNQIKVGIQCVAPFMDVTEEFYRATVCSVVDIQLVQVFFVDYGNKALMRKDRLKQAHPQLVDH-PYQAFECFLSGIKPSAMKFPDGKWPI---DIIQKYGERIANKVVYAKVYSIINNALRVELVEKLPGSERFSSFNELLINHGVADVAEETYQSRQNHQQRLEEAICDS--HI--ASGSLGTPKDNWLELPID----------------------DYDLQRTAHRG---RKFRLHGPWNPYEMSFYNMTNIGTLRAANIDRMSVNTIVLNEEPQDTHARLMVAGFVRMNA---TGSAMIANDTTLMPNIHGLPALITLLFAPTAELRTDRLKTRYTGALCGLGWDEETGGPALPDHDIEITFDTKIDIADICKINGVKMAINLAIGSESSSSDWGPDLVNTIQHSARKKLMSLLERRRVSVEPKNFEWPYRWNM---VNEDDLLYNAVDDTEANCPTLLNLLKGIA-----ISQPDEEEDDDPETKQEKMRKHLDWLES---------------KAGKSIAEEKILCEVCN-------------VMCNSPRDVYIHIQTRAHRQEV 1459          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Cavefish
Match: tdrd9 (tudor domain containing 9 [Source:NCBI gene;Acc:553222])

HSP 1 Score: 455.292 bits (1170), Expect = 7.133e-136
Identity = 379/1259 (30.10%), Postives = 607/1259 (48.21%), Query Frame = 2
Query:  680 QVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPK-LGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSD----TKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYN-QLDEFCPPEILTGPLTQVILRIKEFNR-DPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE-KFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDV-FELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCN-------FIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEV----NDFCLAPYEG--------DFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYT-AYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLM-VDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVC-LRQTVPQT-VVLSAPCHPYIMKFH---GITESCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDS---EGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLN 4339
            +VGL++  +  T + ++TTGVLL++L+  ++LT++THI +DEVHER  ++D LL V++ LL  ++R  K+ILMSAT+   +F+ YF   +  +     P  +F +EG  + VEEF+LDD+   L +  D P+      +P ++A++  +   L+      E  D     +  + +  E GSVL+FLPGL++I    +Y+                                            E L K+ +    +  LHS++ + EQ   F     G RKIILSTNIAESS+TV D+KYVID C+ + L  D+ET++ SL   WASK++C QR GRAGRV  G  YRL+++  +N ++ ++  PE+L  PL  ++L++K  N  DPR LL  AL  P+L DI  T L LKE GALS+  +                          + G+LTF+GR++++LP+DLH+GKLI LG+ F  +EE +IIA+ L++ +S F+ P                 ++ L  +  KL  +    SD +  +N FK W+     G FR  +DE +W     +  + + EV  L +++ +R+ +   NIT   S LD     +  F                       +LQ+ IAGAFYPNYF  I     E+ A +   G DP   V + NLP     LY   +   F+              C   K I      +GS        ++   S ++          + R+ +  ++  AE+ + +A     S      + ++++ ++ H   +   SI+         FI I +T   E G F+G   +E        ME    +T A N ++ +   V    N  CLAP+          ++YRA+I+     N  VFF+DYGN+  +  + L +LP  LL + P  A +F+++ M P   +     +WS+Q +  F+  ++ ++   +   +YS++   +RV + + ++  D  + + L+    A Y EES+ S+Q            H  L G      +  F  +  S+   S            + + +D L+ +      + P+  V +  P  P+ + FH   GIT  C R V++  DS+NS++++  PQ+   RM+VA  V  S  G +   +LL+ TTLMP I G P LI ++FTP  EL +DK +T + GA CGLG  S   EG  L   +D+E+  DV+FD  DI  +N +R ++N
Sbjct:   90 EVGLEKMATEHTRLIYMTTGVLLQKLVSAKSLTEFTHIFIDEVHERTEELDFLLLVIRKLLHSNSRYVKVILMSATINCAEFAEYFGTPVRTRIN---PAYVFEVEGAPYTVEEFYLDDIQNTLCLKVDTPHP----DEPNISADMYNVAVSLIQSFDEIEAKDQSRSAQDVSASLPERGSVLVFLPGLAEI----QYM-------------------------------------------QEALSKLVRKRLQVYPLHSTVTLEEQNGVFLVPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLARHLVCDKETNYQSLCLTWASKTNCNQRRGRAGRVSKGFCYRLVTREFWNKEIPDYAVPEMLRSPLASIVLKVKILNMGDPRTLLSTALTPPNLTDIKRTILQLKEMGALSVSSSS-------------------------FDGDLTFLGRVLANLPVDLHLGKLIVLGHVFGCMEECLIIAASLSL-KSFFAMP----------------SLQQLAGYRSKLAFAHGVPSDSIAFVNAFKAWHTSRAKGEFRHPKDELEWGKENCIQIKRIREVAELREDLTKRVNQFNMNITESSSPLDYTSMHKQRF-----------------------ILQVVIAGAFYPNYF--IQGALDEELASKELSGNDPRTTVLVRNLP-PFAFLYYKQLQSLFRQ-------------CGQVKSIA----FDGSRAYVEFYRSSLRGSGVLPEVSLSLLLSQQRLPLQLQVHPAEEVEARAKGRALSYLKYARVNVDFQSQTVHPVGVLSSSIEPEKLPPKQVFI-INITEVVEVGHFWGFQADEAS------MEKQRQLTTAINQLRLRPVPVSLYPNLLCLAPFRDIHTDTEPENYYRAKILHILGTNVEVFFLDYGNTSRVPCDHLRELPADLL-TPPFQAQEFVVARMAPSAQSMILGDQWSSQARNRFITLVSGHS---LIVSLYSILHGVMRVDLYVSMETGDASVADLLVQEGHARYTEESFESQQS-----------HDVLVGLYQDLKEGTFTPSSTSSSWQS--------RKDEEKQLIDALLLSFSKSSHSAPKCRVPVHGPSSPHKVAFHCMSGIT-MC-RSVSIERDSINSVLVNDHPQDSHERMLVAAFVSLSSSGSR---ILLKETTLMPHIHGLPALITMLFTPIMELRTDKERTCFTGALCGLGAKSSSEEGVLLE--HDIELAFDVKFDVEDITEINALRGVMN 1172          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Cavefish
Match: dhx29 (DEAH (Asp-Glu-Ala-His) box polypeptide 29 [Source:ZFIN;Acc:ZDB-GENE-130530-606])

HSP 1 Score: 249.595 bits (636), Expect = 1.051e-66
Identity = 212/720 (29.44%), Postives = 336/720 (46.67%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDE---PVNIVVTQPRRIAAISVAMHVASERGWEIG-----SYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL-PKLGIC--QDAPYS-----------YDVCQQPRLTAELKEMIY----------QLLMFITYTEMSDTKCTNINQLEM--------------------GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            P+ +H   +L  +  ++ +V+ G TG GKSTQ+PQFIL++    ++   P NI VTQPRRI+A+S+A  V+ E G E G     S  GYQ+ ++ + S+ T + + TTGVLL +L  ++ L+  THII+DEVHER V  D LL++++D++   +  ++ILMSATV  DKFS YF++             +  I G+ FPVE F L+D+  + G    +D+ YS             V Q+   T + +EMI           +L  F + T  +  +  N N++ M                    G+VL+FLPGL+ I +L                   D  + + + +A                         +D + L+ALHS++   +Q  AF     G RKI+LSTNIAE+ +T+ D+ +VID    K  RY   +  SSL   + SK+S  QR GRAGRVR+G  +RL  ++ +N   ++  PEIL  PL ++ L I +     P   L RALD P  + +      L++ GA                    Q T  + P+  H           +++LP+++ +GK++  G     LE    +A+ ++  +S FS P    +  N     A + +   D             SD LT+ N +  W    +         E  +C   +L+  AL  +E +  E+ R +++
Sbjct:  461 PVFQHRGRVLETLRRHRVVVVAGETGSGKSTQIPQFILEDLLTGEKEARPCNIAVTQPRRISAMSLASRVSQELGSEDGPGGRDSLCGYQIRMENRSSDSTRLLYCTTGVLLRKLQQDRLLSSLTHIIVDEVHERSVQSDFLLTILRDVVHKRSDLQLILMSATVDCDKFSAYFNR-----------CPVVSIPGRTFPVEVFHLEDIVEETGYVLEEDSDYSQRFVEEEEEVSVSVTQKGGKTLQHQEMIMRDSAGWDLGPELDHFSSRTRRA-LQYMNPNKINMDLILDLLAYLDKSPQFAEVNGAVLVFLPGLAHIQQLY------------------DLLTTDKRFSA-------------------------RDRYKLIALHSTLSSQDQASAFTVPPAGVRKIVLSTNIAETGVTIPDVVFVIDTGRTKENRYHESSQMSSLVETFVSKASALQRQGRAGRVRSGFCFRLYPKFRFNSFIDYSKPEILRVPLEELCLHIMKCEYGSPEEFLSRALDAPQQQAVCNAVGLLRKIGACE------------------QETHTLTPLGHH-----------LAALPVNVKIGKMLIFGAILGCLEPIATVAAAMS-EKSPFSTPMSRKEEANL----ARDVLAVAD-------------SDHLTIYNAYLGW----RNARIEGTRTEMSYCRKHFLNRTALITIENVKQELIRMVEQ 1074          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Cavefish
Match: dhx36 (DEAH (Asp-Glu-Ala-His) box polypeptide 36 [Source:ZFIN;Acc:ZDB-GENE-050419-20])

HSP 1 Score: 241.506 bits (615), Expect = 2.534e-65
Identity = 212/684 (30.99%), Postives = 315/684 (46.05%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAND--EPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRL------------TAELKEMIYQLLMFITYTEMSDT-KCTNINQLEM-------------------------GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKW 2356
            P +   ++++  IE N+ +V+ G TGCGK+TQV QFILD+           +V TQPRRI+AISVA  VA+ER   +G     GYQ+ L  R    +  + + TTG++L+ L  +  L+  +H++LDE+HER +  D+LL +VKDLL      K++LMSAT+ ADKFS YF               +  I G  +PV+E+ L+D+ ++ +    P+  D   +PR               E KE  Y+         + D    + IN LEM                         G++L+FLPG  +I+ LN+ L+                                              Q    D F ++ LHS +    Q + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D + + S++ AEW S ++ KQR GRAGRV  G  Y L +    + LD +  PEI   PL ++ L+IK     P A  L++ALD PS   I      L +  AL   +NE                            ELT +G  ++ LP++ H+GK+I  G     L+  + IA+ L+     F  PFF    K     K  +Q + +        LS++  SD LT++N F  W +  + G +R  E EY W
Sbjct:  105 PSYSMREELVELIEANRVVVVSGETGCGKTTQVTQFILDDYIQRGVGSLCRVVCTQPRRISAISVAERVAAERAEAVGEGKSCGYQIRLQSRLPRKQGSVLYCTTGIILQWLRSDPCLSSVSHLVLDEIHERSLQSDVLLVIVKDLLKSRDDLKVVLMSATLNADKFSKYFGN-----------CPMIHIPGYTYPVQEYLLEDVIEM-VRFRPPHQQD--HRPRFRRGFMQGHNMWPEKEQKEAEYKESWPCYARTLRDRFSDSTINALEMMDEDDKINLDLIVALIRHIVLNEDDGAILVFLPGWDNISGLNDLLMAE--------------------------------------------QMFKSDKFIIIPLHSLMPTVSQTQVFKRPPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMTAEWVSLANAKQRKGRAGRVSPGKCYHLYNGLRVSLLDSYQLPEIQRTPLEELCLQIKILKLGPIASFLRKALDPPSDRAIELAITHLMDLNALD--QNE----------------------------ELTPLGFHLARLPVEPHIGKMILFGALLTCLDPVLTIAASLS-----FKDPFFIPLGKE----KIADQRRKI--------LSKNSKSDHLTIVNAFTGWEEAKRRG-YRC-EREYCW 681          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Cavefish
Match: dhx34 (DExH-box helicase 34 [Source:NCBI gene;Acc:103023766])

HSP 1 Score: 214.157 bits (544), Expect = 9.217e-56
Identity = 187/671 (27.87%), Postives = 298/671 (44.41%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQL----EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLK 2434
            PI ++ + ++  +  N  +V+ G TGCGKSTQ PQ++L + F+N     I  TQPRRIA IS+A  V+ E   + GS VGYQ+  +   +  T + F+T G+LL Q+  +  L+ Y  +I+DEVHER +  D LL V++ L+      +++LMSAT+    FS YF+              + ++ G++FP++  +          Q  P    V +  +L       + Q                 I+Q     E G +L+FL G+++I+                                              ++E  +    + + + +L LHS++ +++Q + F+    G RK I+STNIAE+S+T+  +++V+D   +K + +D +     L+  W S++S +QR GRAGR   GV YRL ++  Y     +  PEI    L  ++L++K     DP +     +D P    I      LKE GAL  +                              GELT IG L+S LP+D+ +GK++ LG  F ++E  + IA+ L+V       PF      N   S A   +              S   D  T+LN F  W Q        SR    KWC    L+ Q L+E+  L  + K  L+
Sbjct:  165 PIFQYRERLVELVRRNPVVVVAGDTGCGKSTQAPQYLLGSGFSN-----IACTQPRRIACISLAKRVSFETLNQFGSKVGYQIRFETSRTPSTKLLFLTEGLLLRQIQQDAALSQYQVLIVDEVHERHLHCDFLLGVLRSLIARRPDLRLVLMSATINIKLFSGYFNH-----------APVLQVPGRLFPIQVIY----------QPIPPEEQVSKSEKLDPRPYLRVLQ----------------GIDQRYPAEERGDLLLFLSGVAEIST---------------------------------------------IMEACQTYATHTNRWIVLPLHSTLSLTQQDKVFDIAPPGVRKCIISTNIAETSVTIDGVRFVVDSGKVKEMSFDPKAKMQRLQEFWISRASSEQRKGRAGRTGPGVCYRLYAESDYEAFAPYPVPEIHRVALDSLVLQMKSMGLGDPLSFA--FIDPPPTSSIQTAVTYLKEQGALEAR------------------------------GELTPIGTLLSQLPVDVVIGKMLVLGSLFSLVEPVLTIAAALSV-----QSPFLRSAQHNPDCSTARQPLN-------------SDLGDPFTLLNTFNAWVQVKGERGGGSR----KWCKRRGLEEQRLYEMANLRRQFKELLR 694          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Cavefish
Match: dhx30 (DExH-box helicase 30 [Source:NCBI gene;Acc:103047400])

HSP 1 Score: 213.386 bits (542), Expect = 1.780e-55
Identity = 190/678 (28.02%), Postives = 310/678 (45.72%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNET--VISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDD-LPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQL----EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRAL--LQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            P+  H++ +L+ + +++ LV+ G TGCGK+T++P+F+L+    + E    N++VTQPRRI+A+SVA  VA E G  + + VGYQV L+ +    +   + F+T GVLL +L  N TL   +H+++DEVHERDV+ DLLL++++  L  +   +++LMSAT    + + YF               + R+ G M+PV++ +L D + ++G+  +        ++ R   E  +    L          D     I+ +    E G+VL FLPG  +I  + E L                                            E+ Q     +  +L LHSS+ +++Q+  F+S   G+RKI+L+TNIAE+SIT+ DI +V+DL   K   YD  T  S L   W S+S+  QR GRAGR + G  Y L  +     +  F  PEIL  PL  ++++ K  + D +A+  L + LD P    +     TL++ G L                + ++               LT +G  ++ +  D  +GK + L   F  ++  + IA+CLT        PF++        +KA            K  LS S  SD +      + W +         RE   ++  +  L   +L  +  LT +    L E
Sbjct:  414 PVDSHKERLLKAVADSRVLVVAGETGCGKTTRIPRFLLEGRVRDGEGAHCNVLVTQPRRISAVSVAQRVAHEMGPALQNSVGYQVRLESRPPERSGGALLFLTVGVLLRKLQSNPTLKGISHVVVDEVHERDVNTDLLLALLRSALRENPDLRVVLMSATGDTQRLAQYFGG-----------CPVVRVPGFMYPVKQRYLQDIMEEMGLKPEQKSR----EERRTQKEEDDATPDL----------DFTANVIDHIHRHGEPGAVLCFLPGWQEIKAVQEKL--------------------------------------------EEKQAFRSGSQMILPLHSSMSVADQQSVFQSPPQGQRKIVLATNIAETSITINDIVHVVDLGSAKEQGYDPRTKVSCLDTVWISQSNVTQRRGRAGRCQPGHSYHLFPREQLETMMPFPIPEILRTPLENLVVQAKIHSPDSKAVEFLSQVLDSPEPGAVRDAVKTLQDIGVL----------------DSLEC--------------LTPLGERVACMSCDPRLGKALVLSAVFRCVQPMLSIAACLT------RDPFYNSLQNRALVTKA------------KETLSGSSCSDYMAFSRALQGWRETW------DRESRQEYLETYTLSGTSLRFIHGLTQQFSDNLME 968          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004476.1 (pep scaffold:Pmarinus_7.0:GL481383:3055:22197:-1 gene:ENSPMAG00000004056.1 transcript:ENSPMAT00000004476.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 8.755e-58
Identity = 202/672 (30.06%), Postives = 296/672 (44.05%), Query Frame = 2
Query:  494 VIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLG--ICQDAPYS------YDVCQQPR---------LTAELKEMIYQL-----LMFITYTEMSDTKCTNIN-----------QLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXX-XXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDP-RALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQAL 2389
            VI G TGCGK+TQVPQFILD+           IV TQPRRI+AISVA  VA ER    G+    GYQ+ L  R    +  + + TTG++L+ L  ++ L   +H++LDEVHER +  D LL++V+D+L H     II+MSAT+ A  FS YF               I  I G  FPV+E+ L+D+ ++    C   P        +   +Q R               E +  L     +  +   EM D +  + +             E G++L+FLPG +DI++L+  L                                               Q    + F ++ LHS +    Q + FE    G RKI+++TNIAE+SIT+ D+ +VID   IK   +D + + S++K EW S ++ KQR GRAG V      Y L +    N L ++  PE+L  PL ++ L+IK          ++R +  P+ + +      L    ALS  R E                            ELT +G  ++ LP++ H+GKLI  G  F  L+  + IA+CL      F  PF     K           K  DA  K+  LS++  SD LT++   + W Q  + G  RS  D   +C   +L    L
Sbjct:    1 VISGETGCGKTTQVPQFILDDQIERGKGSACRIVCTQPRRISAISVAERVAVERAESCGNGNSTGYQIRLQSRFPRKQGSVLYATTGIVLQWLQTDRLLRGTSHLVLDEVHERSLQSDFLLTIVRDVLPHRPDLSIIVMSATLNAQMFSRYFGG-----------CPIIHIPGFTFPVQEYLLEDVLEMTRYPCHSRPQQRSRRNLFMHGRQRRQAEQEMQQEYEQRWPEYLDSLHGKYSMSTVQALEMIDDELIDADLIAALIRHIVLHAEDGAILVFLPGWADISKLHTTLTAD--------------------------------------------QMFSAEHFIIIPLHSLMPTISQTKVFERPPPGVRKIVIATNIAETSITIDDVVHVIDCGKIKETHFDVDNNISTMKPEWVSLANAKQRRGRAGGVVQAGFCYHLYNGLRANMLSDYQLPEMLRTPLEELCLQIKILKLGRIEDFIKRTMQPPTEQAVLLAITNLIGLNALS--RAE----------------------------ELTALGFHLARLPVEPHIGKLILFGAMFSCLDPVLGIAACLG-----FKDPFVIPLGKE----------KLADA--KRRELSQNCKSDHLTIVYALQRWEQG-RRGHGRSVND---FCWEYFLSQNTL 566          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 215.312 bits (547), Expect = 5.201e-57
Identity = 186/663 (28.05%), Postives = 301/663 (45.40%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIK 2422
            PIH +   ++  +  +Q +V+ G TGCGKSTQVPQ++L    +      +  TQPRRIA +S+A  V+ E   E GS +GYQ+  +   +  T + F+T G+LL Q+     ++ Y  +ILDEVHER +  DLLL V+++LL      +++LMSAT+    FS Y                + ++ G+++P++  +          +  P      +  R+         +++  I +   +D         E G +L+FL G++DI                                              RV E  +   V    + +L LHS++   +Q + F+    G RK I+STNIAE+S+T+  +++++D   +K + YD +     L+  W S++S +QR GRAGR   GV +RL ++  Y+ L+ +  PE+   PL  V+L++K     DPR  L   L+ P    +  +   L+E GAL                            D+  Q ELT IGR++++LP+D+  GK++ +G     +E  + IA+ ++V       PF      N   S+A   +             ES + D LT+LN F  W Q    G   SR    KWC    L+ Q L+E+  L  + K
Sbjct:  106 PIHEYRDQLVELVRAHQVVVVAGDTGCGKSTQVPQYLLSAGMSR-----VACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRLVLMSATINIQLFSRYLGD-----------APVLQVPGRLYPIQVIY----------RPVPEEEKTGKSERIDP---RPYLRIMQSIDHKYPAD---------ERGDLLVFLSGMADIA---------------------------------------------RVAEAAQSYAVETKRWIVLQLHSTLSAEQQDKVFDLAPEGVRKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEYDALEPYAVPEVQRVPLDSVVLQMKSMGLGDPR--LFGFLEPPPASSLETSMQFLQEQGAL----------------------------DE--QEELTPIGRVLATLPLDVLTGKMLLVGCVLGAVEPVLTIAAAMSV-----QSPFHRNAHTNPDCSRARRSL-------------ESDHGDPLTLLNVFNEWVQVKSGGQVPSR----KWCKRHGLEEQRLYEIANLQRQFK 631          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Sea Lamprey
Match: dhx30 (DEAH (Asp-Glu-Ala-His) box helicase 30 [Source:ZFIN;Acc:ZDB-GENE-130530-833])

HSP 1 Score: 191.43 bits (485), Expect = 2.322e-49
Identity = 188/667 (28.19%), Postives = 293/667 (43.93%), Query Frame = 2
Query:  437 PIHRHEKDILR--EIENNQTLVIQGSTGCGKSTQVPQFILDNAFA---NDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNET-VISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQ--DTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRD-PRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVL 2407
            PI  +  +IL   E E+ + L++ G TGCGK+T++PQ IL++  +   N    N+VVTQPRRI+A+SV   V  E G  +   +GYQV ++         + F T G+LL +L  N  L   +H++LDEVHERDV  D LL +++D+L  + R +++L SAT    + + YF              ++ R+ GK++PV  + L                +VCQ  +     K+           TE+ +  C+       G VL FLPG  +I                                              R + D   Q++    D   +L +HSS+ + +Q+  F+    G RK++L+TNIAE++IT+ DI +V+D    K  +YD  T  S L   W SK++  QR GRAGR + G  Y L S+  +  + EF  PEIL  PL  ++L++K      P A  L +ALD P+   +      L+E G L +  +                              LT +G  ++ + ++  + K + L   F  L   ++I S L+        PF SG  +    +KA           ++L   E++ SD L  +N  + W       A+  R DE    S   L P A+  V+ L
Sbjct:  383 PILDYRDEILAALEAEDRRVLIVAGETGCGKTTKIPQLILESMVSRAGNGAHCNVVVTQPRRISAVSVCQRVRQELGPHLRRNIGYQVRMESSPPTPGGAVLFCTVGILLRKLQSNPDLLGVSHVLLDEVHERDVGTDFLLVLLRDVLRRNPRLRLLLASATPDTQRLAQYFGG-----------ATVLRVPGKLYPVTPYHL---------------RNVCQLMQRHPPSKDSDDPSPDLDFVTEVVEFICSRGTP---GGVLCFLPGWQEI----------------------------------------------RGVMDRLSQRLNNRLDKHLILPVHSSLSVVDQQAIFQRPPEGVRKVVLATNIAETAITIDDIVHVVDTGCHKLQQYDMRTQVSCLDTVWVSKTNVVQRRGRAGRCQPGFSYHLFSEEQFAAMPEFETPEILRTPLESLVLQVKLHTPHIPAAQFLDQALDRPNKYAVEEAVSILQEIGVLMMDES------------------------------LTPLGARLAHMAVEPRLAKALVLATLFRCLYPVLVIISSLS------RDPFQSGLQQRAAVNKA-----------RRLLAGETR-SDHLAFVNALEEWRH-----AYGDRADEQHCASENMLHPPAVRYVQGL 921          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 164.466 bits (415), Expect = 1.243e-41
Identity = 168/662 (25.38%), Postives = 283/662 (42.75%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEM----GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCP---PEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVE 2401
            PI++ ++ +++ + +NQ L++ G TG GK+TQ+ Q++ +  +       I  TQPRR+AA+SVA  V+ E G  +G  VGY +  +   S ET I ++T G+LL + + +  L  Y+ ++LDE HER +  D+L  ++K  +      K+I+ SAT+ A KFS YF +             IF I G+ +PVE  +                    ++P                   T+  D     + Q+ +    G +L+FL G  +I    E L   Y+R   + P   +                                        +L ++S++    Q R F+    G RK++++TNIAE+S+T+  I YV+D   +K+  Y+ +T    L     S++  KQRAGRAGR   G  YRL ++  Y   DE      PEI    L   +L +K    +   L    +D P +E +      L + GAL                            DD  +G LT +GR ++  P++  + K++ +       EE + I S L+V +++F +P                + K   A +KK + ++++  D LT+L  +  W    K   F +      WC   ++  + L   +
Sbjct:  103 PIYKLKEQLVQAVNDNQILIVIGETGSGKTTQITQYLAEAGYTTRG--KIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLDMKLIVTSATLDAVKFSQYFYE-----------APIFTIPGRTYPVEILY-------------------TKEPE------------------TDYLDASLITVMQIHLTEPPGDILLFLTGQEEIDTACEIL---YERMKSLGPEVPELI--------------------------------------ILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYR--DEMLTTNVPEIQRTNLASTVLSLKAMGIN-DLLSFDFMDAPPMETLITAMEQLYQLGAL----------------------------DD--EGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSV-QNVFYRP----------------KDKQALADQKKAKFNQAE-GDHLTLLAVYNSW----KNNKFSN-----AWCYENFVQARTLRRAQ 613          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Sea Lamprey
Match: dhx57 (DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 [Source:ZFIN;Acc:ZDB-GENE-030131-4078])

HSP 1 Score: 152.91 bits (385), Expect = 1.079e-37
Identity = 83/187 (44.39%), Postives = 116/187 (62.03%), Query Frame = 2
Query:  482 NQTLVIQGSTGCGKSTQVPQFILDNAFANDEP--VNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL 1036
            +Q LV+ G TGCGK+TQVPQF+LD +         N+V TQPRRI+AISVA  VA ER   +G+ VGYQ+ L+   S+ T + + TTGVLL +L  +  L   TH+++DEVHER  + D LL V+KDL+   +  +++LMSAT+ A  FS Y         L   P       G+ FPV+++FL+D+
Sbjct:  531 HQVLVVSGMTGCGKTTQVPQFVLDASLQGSPANVCNLVCTQPRRISAISVAERVARERAERLGASVGYQIRLESVQSSATRLLYCTTGVLLRRLEGDPMLQGVTHVLVDEVHERTEESDFLLMVLKDLIAQRSDLRVVLMSATLNAQLFSEY---------LYGCPVVHIPDSGRTFPVDQYFLEDI 708          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Yeast
Match: YLR419W_mRNA (Putative helicase with limited sequence similarity to human Rb protein; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; YLR419W is not an essential gene [Source:SGD;Acc:S000004411])

HSP 1 Score: 209.149 bits (531), Expect = 9.133e-55
Identity = 189/604 (31.29%), Postives = 280/604 (46.36%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEP-----VNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPG-SIFRIEGKMFPVEEFFLDDLPK---LGICQDAPYSYDVCQ-----------QPRLTAEL---KEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLP-MDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSG 2170
            P  + +K I+  I  N+ ++I G TG GKSTQV QFILD  F   E        IV TQPRRI+AI +A  V+ ER    G  VGY +    K    T I F+TTGVL+  L + +T+ + T +++DEVHER +D DL+++++K+LL      KI+LMSATV  D F  +F            PG +   IEG+ FP+ ++FL+D+       I ++   SYD              +PR  ++     ++ Y LL  +        K  N N    GS+++FLPG+ +I +             C N       +N    A                             F +L LHS++   +QKR F+    G+RK+++STNIAE+SIT+ D    ID    K + Y+ + + + L   + SK+  KQR GRAGRVR G+ Y+L S+ +Y N +     PEI   PL  + L +K    +D +A L  ALD P L  +                             +K +     + + D     LT +G+ IS +P MD   GKL+  G  F   + ++++ S L     I   PF  G
Sbjct:  605 PAWKKQKVIIDIINKNEVVLITGETGSGKSTQVVQFILD--FLQKEKGDFGKTKIVCTQPRRISAIGLAERVSDERCVTCGEEVGYVIRGVNKTKASTRIKFMTTGVLVRLLQNARTMLENTIVVIDEVHERSIDTDLIVTLMKNLLHRVRGMKIVLMSATVNVDLFKKFF------------PGLATCHIEGRTFPITDYFLEDILSDLDFKIKREKALSYDDDSVDERNNDDQYLKPRADSKFFTSGQINYDLLCQVVEYVHKRLKAANDN----GSIIVFLPGVGEINK-------------CCN-----LLANKSNEA----------------------------DFMVLPLHSALTPEDQKRVFKKYH-GKRKVVVSTNIAETSITIDDCVATIDTGRAKSMFYNPKDNTTKLIESFISKAEVKQRRGRAGRVREGLSYKLFSKNLYENDMISMPIPEIKRIPLESLYLSVKAMGIKDVKAFLSTALDAPPLPAL-----------------------------QKAERILTTIGLVDESDKSLTQLGQFISLMPVMDSKHGKLLIYGILFGCTDISVLLVSIL----GIGVLPFIGG 1110          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 197.208 bits (500), Expect = 1.287e-52
Identity = 180/689 (26.12%), Postives = 307/689 (44.56%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDT-RTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQL-EMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSES--KYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEE 2491
            P+++H+++I+  IE+N   V+ G TG GKSTQ+PQF+L+  +   +  +I VTQPRR+AAI++A  VA E G ++G  VGY V  D   +  T + ++T G+LL +L+ N  L +Y+ I++DE HER V  DL+L  +K L+       +II+MSAT+ A+KFS +F+              I  +EG+ F V++++L           AP           T ++ + + +              C  INQ  E+G +L FLPG  +I            +   +  +   + S+      I P                              L++++   +Q   F  I+  +RK++ STNIAE+S+T+  +K+V+D  + K   +  +   ++L     S++S  QR+GRAGR   G  +RL  +  Y +L +   PEI    +T  +L +K +  D   L     + P  E I      L E GAL  +                              G++T  G+ ++ LP+  H+  ++        L + I I SCL+              V+N   + +P +   ++  E++L L  +  +Y DL+ +   F +++  L      S E    WC  L +  +    V  + D+++   K  F+   +     KK  E+
Sbjct:   82 PVYQHKREIMSYIESNPVTVLIGETGSGKSTQIPQFVLEKLYDTKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNN-----------APILFVEGRKFDVKQYYL----------KAP-----------TDDIVDAVIRC-------------CIQINQGEELGDILCFLPGQEEI-----------DKAVTIMEKIAKYVSDEAPVPLIVP----------------------------YPLYAALPAVQQSLVFAPIKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDYVKLPKQSEPEIARSDVTSPVLMLKRYGVDD-LLNWTWFENPGKEAIVMGLQELYELGALDTR------------------------------GKITKRGQQMALLPLQPHLSSVLIKASEVGCLSQVIDIVSCLS--------------VENLLLNPSPEERDEVN--ERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDASSERN-DWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEESKKIGED 638          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 191.045 bits (484), Expect = 2.194e-50
Identity = 186/664 (28.01%), Postives = 299/664 (45.03%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITE-LNEYLLLGYK--RENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESI---QLGR--RKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYN-QLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSRED-EY---KWCSSLYLDPQAL 2389
            P+H    + L+  +NNQ +V  G TG GK+TQ+PQF+L +   + E   +  TQPRR+AA+SVA  VA E   ++G  VGY +  + K SN+T++ ++T G+LL + + +  L+ Y+ IILDE HER +  D+L+ ++K ++      KII+MSAT+ A+KF  YF+              +  + G+ +PVE ++                      P    +  +   + ++ I  TE            E G +L+FL G  +I + + +  L G +  RE    P             +++PL                              + S+   +Q+R FE       GR  RK+++STNIAE+S+T+  I YV+D    K+  Y+      SL     SK+S +QRAGRAGR R G  +RL ++  +  +L E   PEIL   L+  +L +K+   D        +D P+ E +      L+E   L+                          +DD  +G LT +GRL S  P+D  +  ++   + F   +E + I + L+V  ++F +P        TK  K  +  K + A             D +T+LN +          AF+S E  EY   KWC   YL+ ++L
Sbjct:   94 PVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFND-----------APLLAVPGRTYPVELYY---------------------TPEFQRDYLDSAIRTVLQIHATE------------EAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGP------------LSVYPL------------------------------YGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFD-FMDPPAPETM---MRALEELNYLAC-------------------------LDD--EGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVP-NVFIRP--------TKDKKRADDAKNIFAHPD---------GDHITLLNVYH---------AFKSDEAYEYGIHKWCRDHYLNYRSL 613          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Yeast
Match: ECM16 (Essential DEAH-box ATP-dependent RNA helicase specific to U3 snoRNP; predominantly nucleolar in distribution; required for 18S rRNA synthesis [Source:SGD;Acc:S000004735])

HSP 1 Score: 191.815 bits (486), Expect = 1.588e-49
Identity = 176/650 (27.08%), Postives = 294/650 (45.23%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAN----DEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVV-----------KDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQ-LEMGSVLIFLPGLSDITELNEYLL--LGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQ---------------------------------KVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVY-NQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLED-IGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSG-KVKNTKYSKAPNQMKTLD 2224
            P+   E  I+  I +N  ++I G TG GK+TQVPQF+ +  F      D P  + +TQPRR+AA+S+A  VA+E G + G  VGYQ+  D     +T + F+T GVLL +++H+  LT Y+ II+DE HER+++ D+L+ ++           K+  +   + K+I+MSAT+    FS       + KTL P+   + +++ + FPV   F                       R TA              YT+ +  K   I+Q L  G++L+FL G  +IT + + L     +K+ +  N       S  G ++    L  +      +V++ +K +                                 +   D  Y+L L+S +   EQ R F+    G R  I++TN+AE+S+T+  ++YV+D    K  +Y+      S +  W SK+S  QR+GRAGR   G  YRL S  V+ +  ++F  PEIL  P+  ++L++K                 ++ + I + F T  +  ALS               + +QL Q +  +D+     +T  G+ +S  P+     K++ +      L   + I S L+V       PF +  ++   + S+ PN  + LD
Sbjct:  392 PVFGEEHKIMEAIHHNDVVIICGETGSGKTTQVPQFLYEAGFGAEDSPDYPGMVGITQPRRVAAVSMAERVANELG-DHGHKVGYQIRFDSTAKEDTKVKFMTDGVLLREMMHDFKLTKYSSIIIDEAHERNINTDILIGMLSRCVRLRAKLHKENPIEHKKLKLIIMSATLRVSDFS-------ENKTLFPIAPPVLQVDARQFPVSIHF----------------------NRRTA------------FNYTDEAFRKTCKIHQKLPPGAILVFLTGQQEITHMVKRLRKEFPFKKNSKYNKDLETPVSKMGINSKTTDLEAEDIDFSVQVIDQDKFKSAIRYEEDEGNSGNGEDEEDEEEEGFEEVLTEGQTANDPLYVLPLYSLLPTKEQMRVFQKPPQGSRLCIVATNVAETSLTIPGVRYVVDSGRSKERKYNESNGVQSFEVGWVSKASANQRSGRAGRTGPGHCYRLYSSAVFEHDFEQFSKPEILRMPVESIVLQMKSM---------------AIHNIINFPFPTPPDRVALS---------------KAIQLLQYLGALDNKEM--ITEDGKKMSLFPLSPRFSKMLLVSDEKACLPYIVAIVSALSV-----GDPFINEFELGINEISRKPNPDENLD 962          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 165.236 bits (417), Expect = 1.644e-41
Identity = 124/412 (30.10%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNE-TVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNI---NQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQ 1660
            P+ R    +L  I  NQ +VI G TG GK+TQ+ Q++ +  +AND   +IVVTQPRR+AAISVA  VA E    +G  VGY +  +    +E T + FVT G+LL + + + TL  Y+ +I+DE HER ++ D+LL   K LL      K+I+ SAT+ A KFS +F                F I G+ FPV+  +  +       QD                             Y E + ++   I   N    G +LIF+ G  DI    + L     +E  +    + F + N +                             +   +L ++S++    Q + F+ +   +RKII++TNIAE+S+T+K I+YVID    K   Y+ +    SL     SK++  Q
Sbjct:  351 PVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGN-----------APQFTIPGRTFPVQTIYTSN-----PVQD-----------------------------YVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTL-----QEKFLQVYSKKFGTANFEEI---------------------------NDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQ 685          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Nematostella
Match: EDO44059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ4])

HSP 1 Score: 494.582 bits (1272), Expect = 1.815e-144
Identity = 419/1331 (31.48%), Postives = 655/1331 (49.21%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTR-TKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITY--TEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQ-LDEFCPPEILTGPLTQVILRIKEFNRD-PRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQ-RLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHK-NFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEIS-------DFVTHAKNLVKSKIFEVNDFCLAPYEGD--FYRAEIISK-SNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPD---HKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVD-HQDKILNEELILMRIAEYAEESYASR----QDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCK-RPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSE-GRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIAL 4348
            PI  +  +I+  IENN   VI G TG GK+TQVPQ+ILD+        NI+VTQPRRIAA+S+A  V  ER   +GS +GYQ+G D+  S +T +++VTTGVLL++LI  + +  +TH+I+DEVHERD D D  L VV+ LL  ++R  K++LMSAT+ +D FS YF+  I  + LE  P  +F +EG +FPV+E++L+DL  +G   D      + ++P +  E  ++  Q+++++ Y   + +DTK      +E GSVLIFLP   D+T    +L L                    QS     L + P                       +ALHS +      + F  +  GRRK+ILSTNIAESSITV D+KYVID C+ K L  D ET++ SL+ +WASKSS  QR GRAGRV  G  YR++S+  Y + + ++  PE+   PL QV+L++K  +   P+A+L  AL  P +EDI  T L LK+ GALS     I K      G ++          D + GELTFIG+++ +LP+D+ +GKL+ LGY F  LEE I+I +CL++ +S+FS+ F                 + L  +  K+  +    SD L  +  ++ W + + +   F     E  WC    +    + EV+ L  ++  RLK+  N+        K   + D                       +++L++ IAGAFYPNYF        E +A +   G DP++ V I  +P + G +Y+ +IA  F++ C K       +    ++  I+F   +   T     S T   +V +++KM     L   I +   T+   +            N     L+     GH+   I  P     +I+I  T   E G F+    +++   +  F++ S       DF    +++  S++++    C+A ++ D  FYRA+++SK  N    V F+D+GN   ++   L  +   LL+  P  A + +L E++P  A  PD     WS Q  + F   +    N  +  K+YS + + +RV +   + +QD  +N+ LI   +A++ EES+AS+    Q + +R+          +  +++E   N                       S N                   V L  P  P  + F+ IT   + R   +  DSVNSI +  +PQ+   R++V+  +   G    G  ++ R TTLMP+I G   ++AL F P AEL +D  + +Y GA  GLG D    RP+ P +D+E+  DV  + +D+  VN +R  +N+A 
Sbjct:  126 PITSYHHEIVNTIENNSACVIFGPTGSGKTTQVPQYILDHYAKQRRYCNILVTQPRRIAAVSIAKRVCQERDCPLGSLIGYQIGRDKCVSEDTRLAYVTTGVLLQKLISAKNMNQFTHVIIDEVHERDKDTDFCLLVVRKLLRSNSRHVKVVLMSATLESDLFSRYFAMPIRGQ-LEGAP--VFAVEGNIFPVQEYYLEDLASVGPLPDI-----LLEEPEIAPEGYDLAAQIIVYLDYWGGQGADTK------VERGSVLIFLP---DVTVPPHFLSL--------------------QSI----LSLCP-----------------------IALHSDLKDDSHDKIFYKLTDGRRKVILSTNIAESSITVPDVKYVIDFCLTKCLISDPETNYQSLRLQWASKSSSTQRKGRAGRVSAGCCYRMVSRRFYEECMSDYGVPELQRCPLEQVVLQVKLLDLGAPKAILSLALQPPDIEDIERTVLLLKQVGALS----TIMK------GRRI----------DPYDGELTFIGKVLGTLPVDVRIGKLMVLGYVFGCLEECIVIGACLSL-KSVFSKGF----------------KQELTTYRHKMSWANGSSSDCLASMLAYRSWSEMKERNYGFEGEGGENTWCRKKGIVVPRIREVDALVKDLTERLKD-LNVRTVCPLYRKNSGKPD----------------------DLLILKLVIAGAFYPNYF--TSGDVDEVEANKIMSGHDPYKTVMIRGMPPN-GAMYKSSIARLFRD-CGK----GKALYFEESRAYIEF---DRPSTVHGATSATILPAVYLALKMRHLR-LPLNIYISRRTSQSASDPTFTNSNRLRTNRRAASLSANRMYGHQPRQISLPYK--GYIEIASTQVVEAGHFWAQVSDQESASRVQFLQSSLNRNAGRDF----QDVDASEVYQ-GYLCIALWDEDEQFYRAKVLSKHPNNEFEVMFLDFGNVSRVKLTSLKKITPQLLQ-LPFQAFEVMLCEIQP--ANMPDCPTGMWSHQANQRFTELVQ---NRNLVAKVYSQLHDVLRVDLYDTNTNQDIHINQILINEGLAQFMEESFASKVAHQQADTMRSDEPQVEDNTAWVESNAEEMHN----------------------PSDNV----------------HRVSLRGPFSPLELSFYSITCIGRLRAAKIEMDSVNSIALSDQPQDTHARLLVSANI---GINASGQSVIARETTLMPNIHGLLPIVALTFAPCAELRTDPDKHQYTGALIGLGYDPRTNRPMLPDHDIELTFDVEINQNDVIIVNSLRQGINLAF 1266          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Nematostella
Match: EDO35812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKC5])

HSP 1 Score: 236.498 bits (602), Expect = 1.073e-64
Identity = 195/638 (30.56%), Postives = 309/638 (48.43%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCS-NETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPK-LGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFY-LLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVS----------RSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLW 2302
            P+  ++  IL+ +  N+ ++I+G+TGCGK+TQVPQF+LD    N +    NIVVTQPRRI+A+SVA  VA+ER   +G+ VGY V  D     +   + F T GVLL +L     L   +H+I+DE+HERD++ D +L V++ +++     +I+LMSAT+    F+ YF               I  IEG+ FPV+E++L+D+ + LG     P       + +   E  +   + +  + + E  +  C+     +  + +  L       EL E LL              ++ S  G   A+  + +   + I  + +  K+   +    Y LL LHS I   +Q+R FE +  G  KIILSTNIAE+SIT+ D+ +VID    K   +    + ++    WAS+++ +QR GRAGRVR G  + L S+   ++L E   PEIL  PL ++ L IK     D  A L  A++ P L+ +  +   LK+  AL    N                              LT +G +++ LP++  +GK++ LG  F     T+   SCL  S           + F +PF           + P+  + L    KK   S +++SD + ML+ F+ W
Sbjct:  243 PVFNYKHAILQAVHENRVIIIKGATGCGKTTQVPQFVLDAFLENGQGAECNIVVTQPRRISAVSVAERVAAERSEALGNSVGYSVRFDTILPRSHAAMLFCTVGVLLRKL--ENGLHGVSHVIVDEIHERDINTDFILVVLQQMILTYPDLRIVLMSATIDTHMFAEYFGN-----------CPIVEIEGRSFPVQEYYLEDVIQMLGFVPPLP-------EKKKKREENDEDDEHVSCVLFQENCNAICSGDYSFQTKNAMAQLSEREMSFELIEALL--------------NYISGLGIPGAVL-IFLPGWNLIFALHKHLKMHPQFGTPNYRLLPLHSQIPREDQRRVFEPVPEGVTKIILSTNIAETSITIDDVVFVIDSVKAKVKLFTSHNNMTNYATVWASQTNMEQRRGRAGRVRPGFAFHLCSRARADRLAEHATPEILRTPLHELALTIKLLKLGDITAFLNNAIEPPPLDAVVESVAMLKDMEALDTNEN------------------------------LTPLGYMLAKLPIEPRLGKMVILGCIFQNASYTV---SCLPFSCGDAMATIAASTSFPEPF-----------ETPSDRRRLGWVHKK--FSGTRHSDHIAMLSAFQAW 799          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Nematostella
Match: EDO37669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF08])

HSP 1 Score: 235.728 bits (600), Expect = 1.851e-64
Identity = 222/762 (29.13%), Postives = 334/762 (43.83%), Query Frame = 2
Query:  452 EKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGS-YVGYQVGLD-RKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL--------PKLG--ICQDAPYSYDVCQQPRL---------------------------TAELKE-MIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRD-PRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPN 2608
            +K+IL  I  NQ +VI G TGCGK+TQV QFILD+A    N     I  TQPRRI+AISVA  VA ERG + G   VGYQ+ L+ R   +   I + TTGVL   L+ +  L   +H+I+DE+HERD+  D LL +++DLL      K++LMSAT+ A+ FS YF K             +  I G  +PV+EF+++++        PK      + +PY     Q+  +                           T E  E M    + F    ++    C N   +E G++L+F+PG  DI++L+E L                                      +R L  +K          L+ LHS +  + Q++ F+   LG RKI+++TNIAE+SIT+ D+ +V+D   +K   YD     S L   W S +S +QR GRAGRV+ G  + L +Q       ++  PE+L  PL ++ L+IK       R  L +AL  P    +      L +  AL  K N                              LT +G  ++SLP+D  +GK+I  G     L+  + +AS L      F +PF    V      K  ++++T        RL+   +SD + +LN ++ W    + G      +   +C   +L  Q L  +  +  +  R L        D   L   D +     EPSANH ++           I L++  +    YPN
Sbjct:    2 KKEILGLISTNQVVVISGETGCGKTTQVAQFILDDAIQCGNGSLCRIACTQPRRISAISVAERVAIERGEQCGGGSVGYQIRLESRLPRSRGSIIYCTTGVLQRWLVSDPFLKSTSHVIIDEIHERDLMSDFLLIIIRDLLPRRPDLKLVLMSATLNAEIFSTYFGK-----------CPMLHIPGFTYPVKEFYIEEIIEMTRWHGPKWQKYTRRKSPYKDRRAQKIGIGDEAEEEEEEVKWRNYIGSIRNRFHGSTIETMENMDLDQIDFDLAVKLIQHICLN---MEAGAILVFMPGWEDISKLHENL--------------------------------------KRTLPSDKC--------LLIPLHSLMPTANQRQVFDRPPLGVRKIVIATNIAETSITIDDVVFVVDCGKVKEKSYDASRKISCLMPVWISTASSRQRRGRAGRVQPGYCFHLFTQLQAQSFIDYQLPEMLRTPLEELCLQIKILKLGMVREFLSKALQPPEPLAVQNALDVLAQLNALDTKEN------------------------------LTPLGYHLASLPVDPRIGKMILFGAILSCLDPVLTVASTLG-----FREPF----VYPLDKKKLADKVRT--------RLAGDSHSDHIAVLNAYRGWEAASRHG------NASTYCWENFLSTQTLKMLSNMKCQFARLL-------YDSGFLKSSDPK-----EPSANHNAD----------NIKLVKAILCAGLYPN 628          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Nematostella
Match: EDO43167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM0])

HSP 1 Score: 191.815 bits (486), Expect = 4.155e-49
Identity = 189/714 (26.47%), Postives = 303/714 (42.44%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFF-----------------LDDLPKLGICQDAPYS-----YDVCQQPRLTAELKEMI-------------YQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLI---------------------SQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVL 2407
            PI +  + I+  ++N+Q ++I G TGCGKSTQVPQ++L   F       I  TQPRRIA IS+A  V  E   E GS V YQ+  +   ++ T I F+T           + L+ Y  +++DEVHER +  D LL +++ ++      K++LMSAT+  D F+ YF               + ++ G+++P++  +                 LD  P L I Q   Y      Y +  Q +  A  K+                +++  I Y   +  K       E G +LIFL G+S+I+      ++   RE     R+                                        + +L LHSS+ + EQ + F+    G RK I+STNIAE+SIT+  I+++ D   +K + +D +     L+  W S++S +QR GRAGR    V   LI                     +Q  Y+   E+  PEI   PL   +L++      D RA     ++ P    I  +   L++ GAL+                           +D     +T +G+++S LP+D+ +GK++ +G  F V +  +IIA+ L+V       P+        +    P+ M    A  K+L   ES + D  T+LN +  W Q +K+   R      KWC    L+ Q  +E+  L
Sbjct:  171 PISQFRQQIVDAVKNHQVVIIAGDTGCGKSTQVPQYLLHAGF-----TEIACTQPRRIACISLAKRVGFETLNEYGSEVAYQIRFEGSKTSATRILFLT-----------EDLSRYNVVVVDEVHERHLHGDFLLGMLRCIIEGRANLKLVLMSATINIDLFAGYFEG-----------APVIQVPGRLYPIQVQYQAPAAEKQKAPTSRTERLDPSPYLKIMQLIDYKVPGRLYPIQVQYQAPAAEKQKAPTSRTERLDPSPYLKIMQLIDYK--NSCKRVRYPPTERGDLLIFLSGMSEISA-----VVDAAREYAQRTRR----------------------------------------WIVLPLHSSLSVDEQDKVFDVAPDGVRKCIVSTNIAETSITIDGIRFIADSGKVKEMSFDNKAKMQRLQEFWISQASAEQRKGRAGRTDPCVCLNLIIMKDHVPLEGRTGPGVCYRLYTQSDYHAFSEYATPEIQRAPLDSTVLQMVAMGINDVRAFP--FIEPPPRSSIENSVHFLQQQGALT---------------------------EDE---AITPVGQMLSRLPVDVVIGKMLLMGSVFHVTDPVMIIAAGLSV-----QSPW------TRRLDHDPDVM----ALRKEL---ESDHGDPFTLLNAYDEWIQ-VKS---RQGSGSKKWCRRRGLEEQRFYEMSKL 756          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Nematostella
Match: EDO40330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H4])

HSP 1 Score: 159.073 bits (401), Expect = 5.682e-39
Identity = 83/201 (41.29%), Postives = 125/201 (62.19%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIH-NQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL 1036
            PI    +DI++ I++NQ +++ G TG GK+TQVPQFIL+ +     P  I+ TQPRRI+A+SVA  VA+ERG  IG   GYQ+ L+ + S +T++++ T GVLL  L+  + +L+  THII+DE+HERD   D LL  +++LL  +   K++LMSA +  D F  YF K             +  + G+ F V+  FL+D+
Sbjct:  167 PIWEQRQDIIKCIKDNQVILVSGETGSGKTTQVPQFILEYSAQVSSPCRIICTQPRRISAMSVAERVAAERGERIGQTAGYQIRLESRVSGKTLLTYCTNGVLLRTLMQGDNSLSFITHIIVDEIHERDRFSDFLLISLRELLSFNKNIKLVLMSAALDIDLFVEYFGK-----------CPVINVPGRCFDVDVLFLEDV 356          

HSP 2 Score: 77.411 bits (189), Expect = 4.620e-14
Identity = 104/384 (27.08%), Postives = 156/384 (40.62%), Query Frame = 2
Query: 1061 APYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNI---------NQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDT--FYLLALHSSIGISEQKRA--FESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGA---LSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFF 2164
            APYS DV  + + T EL E   +LL     T   D    ++         N  + G+VL+FLPG  DI  L                  RD  +++                           K Y +T  + L  LHSS+   EQ++A  F  +    RKI+LSTNIAE+S+T+ D+ +VID   +K   +D  T  S+L+  W SK+S  QR GR+GR          SQ         C P     PL  V   I                 P L   G   + L  +     + I+ +  +   NK++  K+  T   +   + W+ +LT +GR ++ LP++  +GK+I        L+  I +A C    R  F  P +
Sbjct:  552 APYSDDVTLEKQST-ELSEETKELLAVYHKTFDDDRVDLDLIYCLIDHICNSGQQGAVLVFLPGYDDIITL------------------RDILASS---------------------------KEYGNTKRYQLFTLHSSMQPGEQRKASVFRKLPPTVRKIVLSTNIAETSVTIDDVVFVIDSGKVKEKSFDALTSVSTLQVAWVSKASAVQRRGRSGR---------CSQ---------CFPLFQIWPLFSVFPFI-----------------PDLVKPGAKVVILISSSTRCNMLIELHSTSIYPNKKHSIKIYWTIDAL---NKWE-DLTDLGRHLADLPVEPRLGKMILYSVVLKCLDPVITVA-CALAYRDPFVLPMY 849          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Medaka
Match: dhx36 (DEAH-box helicase 36 [Source:NCBI gene;Acc:101175497])

HSP 1 Score: 244.588 bits (623), Expect = 1.386e-66
Identity = 218/719 (30.32%), Postives = 326/719 (45.34%), Query Frame = 2
Query:  458 DILREIENNQTLVIQGSTGCGKSTQVPQFILDNAF--ANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKL----------------GICQ-----------DAPYSYDV-CQQPRLTAELKEMIYQLLMFITYTEMSDTK------CTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEED 2494
            D++  I +N+ LV+ G TGCGK+TQV QFILD+           +V TQPRRI+AISVA  VA+ERG  +G+    GYQ+ L  R    +  I + TTG++L+ L  + TL+  +H++LDE+HER++  D+LL +VKDLL      K+ILMSAT+ A+KFS YF               +  I G  FPVEEF L+D+ ++                G  Q           +A Y     C    L     +   Q L  +   +  D +      C  +   E G++L+FLPG  +I+ LN+ L+                      +  +F                        D F ++ LHS +    Q + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D   + S++ AEW S ++ KQR GRAGR+  G  Y L +    + LD +  PEI+  PL ++ L+IK          L++ALD P+ E +      L++  AL                             DH +  LT +G  ++ LP++ H+GKLI  G     L+  + IA+ L+     F  PFF   +   K   A  + +T         LS +  SD LT++  F+ W    + G    RE    +C   +L    L  +  +  +    LK     T   S+ D KD E +
Sbjct:   52 DLVELINSNRVLVVSGETGCGKTTQVTQFILDDYINRGVGSLCRVVCTQPRRISAISVAERVAAERGESVGNGNSCGYQIRLQSRLPRRQGSILYCTTGIILQWLRSDPTLSSISHLVLDEIHERNLQSDVLLIIVKDLLRMRDDLKVILMSATLNAEKFSKYFDN-----------CPMIHIPGLTFPVEEFLLEDVVEMIRYRPQNQDRRPAWKRGFWQGRQLRSEKEAKEAEYKESWPCYARTLQGRYSDSTIQTLEVLDSDDKIDLELILALICHIVRSEEEGAILVFLPGWDNISGLNDLLM----------------------AQTMF----------------------RSDRFVIIPLHSLMPTVNQTQVFKRPPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETNFDTNNNISTMTAEWVSLANAKQRKGRAGRLCPGKCYHLYNGLRASLLDAYQLPEIMRTPLEELCLQIKILKLGSIGRFLEKALDRPTEEAVNLAIKNLRDLNAL-----------------------------DHTEN-LTPLGFHLARLPVEPHIGKLILFGALLGCLDPVLTIAASLS-----FKDPFF---IPLGKEKMADMRRRT---------LSRNSKSDHLTIVYAFQGWEDAKRRGGRYERE----YCWDNFLSANTLQMIHNMKSQFAEHLKH----TGFVSSKDPKDPESN 660          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Medaka
Match: dhx36 (DEAH-box helicase 36 [Source:NCBI gene;Acc:101175497])

HSP 1 Score: 246.899 bits (629), Expect = 1.790e-66
Identity = 220/726 (30.30%), Postives = 330/726 (45.45%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAND--EPVNIVVTQPRRIAAISVAMHVASERGWEIGS--YVGYQVGL-DRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKL----------------GICQ-----------DAPYSYDV-CQQPRLTAELKEMIYQLLMFITYTEMSDTK------CTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEED 2494
            P +  ++D++  I +N+ LV+ G TGCGK+TQV QFILD+           +V TQPRRI+AISVA  VA+ERG  +G+    GYQ+ L  R    +  I + TTG++L+ L  + TL+  +H++LDE+HER++  D+LL +VKDLL      K+ILMSAT+ A+KFS YF               +  I G  FPVEEF L+D+ ++                G  Q           +A Y     C    L     +   Q L  +   +  D +      C  +   E G++L+FLPG  +I+ LN+ L+                      +  +F                        D F ++ LHS +    Q + F+    G RKI+++TNIAE+SIT+ D+ YVID   IK   +D   + S++ AEW S ++ KQR GRAGRV  G  Y L +    + LD +  PEI+  PL ++ L+IK          L++ALD P+ E +      L++  AL                             DH +  LT +G  ++ LP++ H+GKLI  G     L+  + IA+ L+     F  PFF   +   K   A  + +T         LS +  SD LT++  F+ W    + G    RE    +C   +L    L  +  +  +    LK     T   S+ D KD E +
Sbjct:  237 PSYSKKEDLVELINSNRVLVVSGETGCGKTTQVTQFILDDYINRGVGSLCRVVCTQPRRISAISVAERVAAERGESVGNGNSCGYQIRLQSRLPRRQGSILYCTTGIILQWLRSDPTLSSISHLVLDEIHERNLQSDVLLIIVKDLLRMRDDLKVILMSATLNAEKFSKYFDN-----------CPMIHIPGLTFPVEEFLLEDVVEMIRYRPQNQDRRPAWKRGFWQGRQLRSEKEAKEAEYKESWPCYARTLQGRYSDSTIQTLEVLDSDDKIDLELILALICHIVRSEEEGAILVFLPGWDNISGLNDLLM----------------------AQTMF----------------------RSDRFVIIPLHSLMPTVNQTQVFKRPPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETNFDTNNNISTMTAEWVSLANAKQRKGRAGRVCPGKCYHLYNGLRASLLDAYQLPEIMRTPLEELCLQIKILKLGSIGRFLEKALDRPTEEAVNLAIKNLRDLNAL-----------------------------DHTEN-LTPLGFHLARLPVEPHIGKLILFGALLGCLDPVLTIAASLS-----FKDPFF---IPLGKEKMADMRRRT---------LSRNSKSDHLTIVYAFQGWEDAKRRGGRYERE----YCWDNFLSANTLQMIHNMKSQFAEHLKH----TGFVSSKDPKDPESN 852          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Medaka
Match: dhx29 (DExH-box helicase 29 [Source:NCBI gene;Acc:101172256])

HSP 1 Score: 244.202 bits (622), Expect = 8.947e-65
Identity = 213/722 (29.50%), Postives = 336/722 (46.54%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFAND---EPVNIVVTQPRRIAAISVAMHVASERGWEIG-----SYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDL-PKLGIC--------------QDAPYSYDVCQQPRLTAELKEMIYQ-----------LLMFITYTEMSDTKCTNINQLEM--------------------GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            P+ +H   IL  ++ +  +V+ G TG GKSTQ+PQF+L          +P NIVVTQPRRI+A+S+A  V+ E G E G     S  GYQ+ ++ +  + T + + TTGVLL +L H++ L+  THII+DEVHER V  D LL+++KD++M  +   +ILMSATV   KFS YF++             +  I G+ FPVE + L+D+  + G                ++A  S  V Q+   T + +E+I +           L  F + T     +  N N++ M                    G++L+FLPGL+ I +L                   D  S+N                 +R  E  +        + ++ALHS++   +Q  AF     G RKI+LSTNIAE+ +T+ D+ +VID    K  +Y   +  SSL   + SK+S  QR GRAGRVR+G  +RL  +Y ++   ++  PEIL  PL ++ L I +     P   L RALD P  + +      L++ GA                             +DH    LT +G  ++SLP+++ +GK++  G     LE    IA+ +T  +S FS P               N+ +  +  +  L ++    SD LT+ N +  W    KT      + E  +C   +L+  AL  +E +  ++ + +++
Sbjct:  582 PVFQHRHQILEALQRHPVVVVAGETGSGKSTQIPQFLLGELLTGGKTAQPCNIVVTQPRRISAMSLACRVSQELGCEDGPGSKSSLCGYQIRMENQSGDWTRLLYCTTGVLLRKLQHDRQLSSLTHIIVDEVHERSVQSDFLLTILKDVVMRRSDLHLILMSATVDCHKFSSYFNR-----------CPVINIPGRTFPVEVYHLEDIVEQTGYVLEKDSEYSQRILEEEEAVVSVAVSQKGGKTLQHQEVILRDSPTGWELGRDLDHFSSRTRQV-LQYMNPNKINMDLLVELLDYLDKSPQFADVDGAILVFLPGLAHIQQLY------------------DLLSSN-----------------KRFREKSR--------YRIVALHSTLSSKDQAAAFTVPPAGVRKIVLSTNIAETGVTIPDVVFVIDTGKTKENKYHESSQMSSLVETFVSKASALQRQGRAGRVRSGFCFRLYPKYRFDAFMDYSIPEILRVPLEELCLHIMKCQYGSPEDFLSRALDPPQPQSVSNAVNLLRKIGACH--------------------------PNDH---TLTPLGHHLASLPVNVKIGKMLIYGAILGCLEPIATIAAAMT-EKSPFSTPM--------------NRKEEANLAKAALAVAN---SDHLTIYNAYLGW----KTVQTEGLKAEMSYCRKHFLNRTALITMEDVKHDLTKMMEQ 1197          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Medaka
Match: dhx9 (DExH-box helicase 9 [Source:NCBI gene;Acc:101156199])

HSP 1 Score: 233.417 bits (594), Expect = 1.221e-61
Identity = 211/722 (29.22%), Postives = 327/722 (45.29%), Query Frame = 2
Query:  344 ETIKENSRYKLTHEXXXXXXXXXXXXXXXXXPIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDN----AFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSN-ETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYD-----------------VCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEM-GSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRA-LLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKE 2437
            E I E+ R +L ++                LP+ + E +I+  +E+N  ++I+G+TGCGK+TQVPQ+ILD+      A+D   NIVVTQPRRI+A+SVA  VA ER  ++G   GY V  +         I F T GVLL +L     +   +H+I+DE+HERD++ D L+ V++D++      +I+LMSAT+    F  YF               I  + G+ FPV+E+FL+D  ++      P                     +C  P  T + K  + Q+    T  E+ +     I  L++ G+VL+FLPG +        L+   +R    NP    F SN                                  + +L LHS +   EQ+R F+ +     K+ILSTNIAE+SIT+ D+ YVID C  K   +    + ++    WASK++ +QR GRAGRVR G  + + S+  +++L+    PEI   PL +V L IK          L +A++ P L+ +     TL+E  AL                                  ELT +GR+++ LP++  +GK++ +G  F V +     A C   + S F +PF S               K L    +    S S++SD + +L  F+ W      G     + E ++C    L+   L     +T E K +LK+
Sbjct:  370 EQISEDLRNELMYQLEHDDSLQKILAERDQLPVKQFEDEIMGALESNPVVIIRGATGCGKTTQVPQYILDHFIKGGRASD--CNIVVTQPRRISAVSVAERVAYERAEDLGKSCGYSVRFESVLPRPHASIMFCTVGVLLRKL--EAGIRGISHVIVDEIHERDINTDFLMVVLRDVVQTFPDVRILLMSATIDTSMFREYF-----------FNCPIIEVFGRTFPVQEYFLEDCIQMTNFVPPPMDRKKKAKDEEGGEEDTNCNLIC-GPEYTPQTKNTMGQMTEKETSFELVEALLKYIETLKVSGAVLVFLPGWN--------LIFSMQRHLETNPH---FGSNR---------------------------------YRILPLHSQVPREEQRRVFDPVPDDVTKVILSTNIAETSITINDVVYVIDSCKQKVKLFTSHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHMCSRARFDKLETHMTPEIFRTPLHEVALSIKLLRLGSIGHFLSKAIEPPPLDAVIEAEHTLRELDALDS------------------------------NDELTPLGRILARLPIEPRLGKMMIMGCIFHVGD-----AVCTISAASCFPEPFISDG-------------KRLGFVHRN--FSGSRFSDHVALLAVFQAWDDVRVNG----EDAEIRFCEHKRLNMSTLR----MTWEAKVQLKD 973          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Medaka
Match: dhx30 (DExH-box helicase 30 [Source:NCBI gene;Acc:101172025])

HSP 1 Score: 222.246 bits (565), Expect = 2.637e-58
Identity = 189/645 (29.30%), Postives = 305/645 (47.29%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNET--VISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGS-IFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRAL--LQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEY 2350
            P+  H + ++  + +++ +VI G TGCGK+T++P+F+L++  +       NI+VTQPRRI+A+SVA  VA E G  +  +VGYQV L+ +   ++   + F+T GVLL++L  N TL   +H+++DEVHERD++ DLLL++++  L  +   +++LMSAT    + + YF             GS I ++ G M PV++ FL+D+  L   +  P + +  +  +    + E    L +     E  D         + G+VL FLPG  DI  + + L              R  FS+                                 +  +L LHSS+ + +Q+R F+    GRRKI+L+TNIAE+SIT+ DI +V+D    K   YD  T  S L   W S+S+  QR GRAGR + G  Y L  +     +  F  PEIL  PL  ++L+ K  + + +A+  L + LD P  + +     TL++ G L                +K +               LT +G  ++ +  D  +GK++ L   F  +   + +A+CLT        PF      N+  ++AP +       + K  LS S YSD L        W ++++    R   D Y
Sbjct:  402 PVDTHRQRVISAVRSSRVVVIAGETGCGKTTRIPRFLLEDGVSEGAGADCNILVTQPRRISAVSVAHRVAQEMGPALKHHVGYQVRLESRPPEQSGGAMLFLTVGVLLKKLQSNPTLRGISHVVVDEVHERDINTDLLLALLRSALKENHDLRVVLMSATGDNQRLAEYFG------------GSPIVKVPGFMHPVKDRFLEDV--LKEMRHPPVNQNASKMNK-EGGVHEATPDLDLVADVIEHIDRNG------DAGAVLCFLPGWQDIRAVQDKL------------EARPHFSSG--------------------------------SHMILPLHSSLSVPDQQRVFQRPPEGRRKIVLATNIAETSITIDDIVHVVDAGTHKEQNYDARTKVSCLDTVWISRSNVTQRKGRAGRCQPGQSYHLFPRKQLESMSPFPVPEILRTPLESLVLQAKIHSPNCKAVDFLSQVLDSPDKDAVRDAVQTLQDIGVL----------------DKTE--------------SLTPLGERVACMSCDPRLGKVLVLSAMFRCVLPMLCVAACLT------RDPFH-----NSMQNRAPVR-------QAKEALSRSSYSDYLVFSRAVLGW-RKVQLEGDREDRDSY 932          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Planmine SMEST
Match: SMESG000016118.1 (SMESG000016118.1)

HSP 1 Score: 3242.21 bits (8405), Expect = 0.000e+0
Identity = 1615/1615 (100.00%), Postives = 1615/1615 (100.00%), Query Frame = 2
Query:   56 AVRKNIEKVFIERKKNMSENPIQSTFSKEIAQPAFKFHLNQYNPNLPLGDGTKNVMNMRGNDFIKQKNMDDLESVTTRQNGSVITGHGFDVNVNSLETIKENSRYKLTHEXXXXXXXXXXXXXXXXXPIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKXXXXXXXXXXXXXXXXRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQDAMDKYQSGIKKFIASLLLKHSRDLVNNNNVGEYRVKTDISVLENDSYSNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEENLKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNVLQMRNILNV 4900
            AVRKNIEKVFIERKKNMSENPIQSTFSKEIAQPAFKFHLNQYNPNLPLGDGTKNVMNMRGNDFIKQKNMDDLESVTTRQNGSVITGHGFDVNVNSLETIKENSRYKLTHENLSKIKSNNKSKRSIILPIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQRAGRAGRVRNGVVYRLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKNLLSNDSGSDQNSDSGRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQDAMDKYQSGIKKFIASLLLKHSRDLVNNNNVGEYRVKTDISVLENDSYSNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEENLKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNVLQMRNILNV
Sbjct:   15 AVRKNIEKVFIERKKNMSENPIQSTFSKEIAQPAFKFHLNQYNPNLPLGDGTKNVMNMRGNDFIKQKNMDDLESVTTRQNGSVITGHGFDVNVNSLETIKENSRYKLTHENLSKIKSNNKSKRSIILPIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQRAGRAGRVRNGVVYRLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFRIMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMDEGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNESTDSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNNHILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDNEQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQNCTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHPDHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKILNEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFMKNLLSNDSGSDQNSDSGRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPCHPYIMKFHGITESCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSSGGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAKCGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMHSQDAMDKYQSGIKKFIASLLLKHSRDLVNNNNVGEYRVKTDISVLENDSYSNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAAAEENLKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVPIFTESDLEDHIQSNQHKQNVLQMRNILNV 1629          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Planmine SMEST
Match: SMESG000079975.1 (SMESG000079975.1)

HSP 1 Score: 217.238 bits (552), Expect = 1.294e-56
Identity = 215/747 (28.78%), Postives = 338/747 (45.25%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETV-------ISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSK----QIDPKTLEPLPGSIFRIEG-----KMFPVEEFFLDDLPK-LGICQDAPYSY---------------DVCQQPRLTAEL-----KEMIYQLL-MFITYTEMSDTKCTNINQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFF--EPSANHISNIHSVVI 2548
            P   +E+ I+  +  NQ ++I+G TG GK+TQVPQFI+D    +++    N++VTQPRRI+AI++A  VA ERG ++G   GY V        ETV       + + T G LL ++     L   +HII+DE+HERD++ D L+ ++KD+     + KIILMSAT+  + F  +F      +I+ +T    P + F +E         P ++F  D+  + + + +D+P                  D   +P+    +     KE+ ++L+   + Y E              G+VLIFLPG + I  L + L                                             K  K   D + +L LHS +   +QKR F   + G RKIIL+TNIAESSIT+ D+ +VID C  K   +    + +S    WASK++ +QR GRAGRV  G  + L S+  + +L+    PEIL   L  V L IK     D +  L RA++ P ++ I      LKE  A    +N+                            ELT +G++++ LP++  MGK+I  G  F V +    +A+C ++       PF             P   K L   +  + LS ++ SD + +LN F+ W    K G       E ++C S  L+P  L   +    ++K       NI ++  T   ++C E  FF  + S   I+N+ S+++
Sbjct:  365 PAAAYEESIINAVLENQIVLIRGETGSGKTTQVPQFIMDYYIRSNKGAECNVIVTQPRRISAITLAERVAQERGEQLGQTCGYSVRF------ETVHPQYYGGLLYCTVGTLLRKM--ESGLRGISHIIVDEIHERDLNTDFLMILLKDMAASYQQIKIILMSATIDVNLFKKFFPSVFVLEIEGRTF---PVNYFFLEDCIETLNFQPDQQFKKDNKSRSIDVNEDSPTKNNGKPDESDTNCNMICDASYKPQTKIAMGKLSEKEISFELIEALLQYIETIHP---------TGAVLIFLPGWNIIQLLLKNLT--------------------------------------------KHPKFGTDKYLILPLHSQVPRVDQKRVFLPTRQGVRKIILATNIAESSITINDVMFVIDSCRAKVKMFTSRNNLTSYNTVWASKTNLEQRRGRAGRVSEGYAFHLCSRARFERLETHQTPEILRTALHDVALMIKLLKLGDTKDFLSRAIEQPPIDAIIEAEHLLKEMKAFD--KND----------------------------ELTPLGKILARLPIEPRMGKMIIFGCLFGVGDACATVAACTSL-----GDPFI-----------IPPDRKRLTRVQ--VDLSANRCSDHVAILNAFQKWSYVQKRGF-----SEEEFCLSKGLNPSILKMSKDAASQMK-------NILIN--TGFPQECLESQFFDYDNSCPTINNVLSLLV 985          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Planmine SMEST
Match: SMESG000079969.1 (SMESG000079969.1)

HSP 1 Score: 214.927 bits (546), Expect = 2.358e-56
Identity = 212/722 (29.36%), Postives = 335/722 (46.40%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETV-------ISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLM----FITYTEMSDTKCTNI----NQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVI 2548
            P   +E+ I+  +  NQ ++I+G TG GK+TQVPQFI+D    +++    N++VTQPRRI+AI++A  VA ERG ++G   GY V        ETV       + + T G LL ++     L   +HII+DE+HERD++ D L+ ++KD+     + KIILMSA +  + F+ YF     P           +IE + FPV  FFL+D      C +A  ++   QQ +   + + M     +     I   + SD  C  I     + E  +V+  L       +L E LL           +  +     G +  IF  + +    + ++L   K  K   + + ++ LHS +   + KR FE  Q G RKIIL+TNIAESSIT+ D+ +VID C      ++R  H +S    WASK + + R   AGR+  G  + L S+  + +L+    PEIL   L  V L IK     D +  L RA++ P ++ I      LKE  A    +N+                            ELT +G++++ LP++  MGK+I  G  F V +    +A+C ++       PF             P   K L+  +  + LS ++ SD + +LN F+ W    K G       E ++C S  L+P  L   +    ++K  L    N       L+ KD +    ++ S   I+N+ S+++
Sbjct:  365 PAAAYEESIINAVLENQIVLIRGETGSGKTTQVPQFIMDYYIRSNKGAECNVIVTQPRRISAITLAERVAQERGEQLGQTCGYSVRF------ETVHPQYYGGLLYCTVGTLLRKM--ESGLRGISHIIVDEIHERDLNTDFLMILLKDMAACYPQMKIILMSANIDVNVFTNYF-----PNVF------TVKIEVRKFPVNYFFLED------CIEA-LNFQPSQQSQKENKFRSMDVNEDLPPPKIIGKPDESDVNCNMICDDSYKPETKTVMGKLSENEICFKLIESLL-----------QHIETIHQTG-TVLIFLPQWNIVELLTKIL--TKNSKFGSEKYLIVPLHSKVAKVDLKRIFEPAQ-GVRKIILATNIAESSITINDVMFVIDTCHANVKMFNRNNH-TSYNTLWASKENLEHRRDCAGRLSEGYAFHLCSRARFERLETHQTPEILRTALHDVALMIKLLKLGDTKDFLSRAIEQPPIDAIIEAEHLLKEMKAFD--KND----------------------------ELTPLGKILARLPIEPRMGKMIIFGCLFGVGDACATVAACTSL-----GDPFI-----------IPPDRKRLNKVQ--VDLSANRCSDHVAILNAFQKWSYVQKRGF-----SEEEFCLSNGLNPSILKMSKDAASQMKNIL---INTGFPKECLEPKDLD----YDNSCPTINNVLSLLV 984          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Planmine SMEST
Match: SMESG000079969.1 (SMESG000079969.1)

HSP 1 Score: 216.468 bits (550), Expect = 3.036e-56
Identity = 213/722 (29.50%), Postives = 334/722 (46.26%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETV-------ISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLM----FITYTEMSDTKCTNI----NQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVI 2548
            P   +E+ I+  +  NQ ++I+G TG GK+TQVPQFI+D    +++    N++VTQPRRI+AI++A  VA ERG ++G   GY V        ETV       + + T G LL ++     L   +HII+DE+HERD++ D L+ ++KD+     + KIILMSA +  + F+ YF     P           +IE + FPV  FFL+D      C +A  ++   QQ +   + + M     +     I   + SD  C  I     + E  +V+  L       +L E LL           +  +     G +  IF  + +    + ++L   K  K   + + ++ LHS +   + KR FE  Q G RKIIL+TNIAESSIT+ D+ +VID C      ++R  H +S    WASK + + R   AGR+  G  + L S+  + +L+    PEIL   L  V L IK     D +  L RA++ P ++ I      LKE  A    +N+                            ELT +G++++ LP++  MGK+I  G  F V +    +A+C ++       PF             P   K L+  +  + LS ++ SD + +LN F+ W    K G       E ++C S  L+P  L   +    ++K  L    N       L+ KD + D     S   I+N+ S+++
Sbjct:  365 PAAAYEESIINAVLENQIVLIRGETGSGKTTQVPQFIMDYYIRSNKGAECNVIVTQPRRISAITLAERVAQERGEQLGQTCGYSVRF------ETVHPQYYGGLLYCTVGTLLRKM--ESGLRGISHIIVDEIHERDLNTDFLMILLKDMAACYPQMKIILMSANIDVNVFTNYF-----PNVF------TVKIEVRKFPVNYFFLED------CIEA-LNFQPSQQSQKENKFRSMDVNEDLPPPKIIGKPDESDVNCNMICDDSYKPETKTVMGKLSENEICFKLIESLL-----------QHIETIHQTG-TVLIFLPQWNIVELLTKIL--TKNSKFGSEKYLIVPLHSKVAKVDLKRIFEPAQ-GVRKIILATNIAESSITINDVMFVIDTCHANVKMFNRNNH-TSYNTLWASKENLEHRRDCAGRLSEGYAFHLCSRARFERLETHQTPEILRTALHDVALMIKLLKLGDTKDFLSRAIEQPPIDAIIEAEHLLKEMKAFD--KND----------------------------ELTPLGKILARLPIEPRMGKMIIFGCLFGVGDACATVAACTSL-----GDPFI-----------IPPDRKRLNKVQ--VDLSANRCSDHVAILNAFQKWSYVQKRGF-----SEEEFCLSNGLNPSILKMSKDAASQMKNIL---INTGFPKECLEPKDLDYDN----SCPTINNVLSLLV 984          
BLAST of ATP-dependent RNA helicase TDRD9 vs. Planmine SMEST
Match: SMESG000079969.1 (SMESG000079969.1)

HSP 1 Score: 214.542 bits (545), Expect = 3.401e-56
Identity = 213/722 (29.50%), Postives = 334/722 (46.26%), Query Frame = 2
Query:  437 PIHRHEKDILREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPV--NIVVTQPRRIAAISVAMHVASERGWEIGSYVGYQVGLDRKCSNETV-------ISFVTTGVLLEQLIHNQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAADKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDAPYSYDVCQQPRLTAELKEMIYQLLM----FITYTEMSDTKCTNI----NQLEMGSVLIFLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPKSCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIILSTNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQXXXXXXXXXXXXXXXLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFN-RDPRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQLTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETIIIASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKYSDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTDEIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVI 2548
            P   +E+ I+  +  NQ ++I+G TG GK+TQVPQFI+D    +++    N++VTQPRRI+AI++A  VA ERG ++G   GY V        ETV       + + T G LL ++     L   +HII+DE+HERD++ D L+ ++KD+     + KIILMSA +  + F+ YF     P           +IE + FPV  FFL+D      C +A  ++   QQ +   + + M     +     I   + SD  C  I     + E  +V+  L       +L E LL           +  +     G +  IF  + +    + ++L   K  K   + + ++ LHS +   + KR FE  Q G RKIIL+TNIAESSIT+ D+ +VID C      ++R  H +S    WASK + + R   AGR+  G  + L S+  + +L+    PEIL   L  V L IK     D +  L RA++ P ++ I      LKE  A    +N+                            ELT +G++++ LP++  MGK+I  G  F V +    +A+C ++       PF             P   K L+  +  + LS ++ SD + +LN F+ W    K G       E ++C S  L+P  L   +    ++K  L    N       L+ KD + D     S   I+N+ S+++
Sbjct:  365 PAAAYEESIINAVLENQIVLIRGETGSGKTTQVPQFIMDYYIRSNKGAECNVIVTQPRRISAITLAERVAQERGEQLGQTCGYSVRF------ETVHPQYYGGLLYCTVGTLLRKM--ESGLRGISHIIVDEIHERDLNTDFLMILLKDMAACYPQMKIILMSANIDVNVFTNYF-----PNVF------TVKIEVRKFPVNYFFLED------CIEA-LNFQPSQQSQKENKFRSMDVNEDLPPPKIIGKPDESDVNCNMICDDSYKPETKTVMGKLSENEICFKLIESLL-----------QHIETIHQTG-TVLIFLPQWNIVELLTKIL--TKNSKFGSEKYLIVPLHSKVAKVDLKRIFEPAQ-GVRKIILATNIAESSITINDVMFVIDTCHANVKMFNRNNH-TSYNTLWASKENLEHRRDCAGRLSEGYAFHLCSRARFERLETHQTPEILRTALHDVALMIKLLKLGDTKDFLSRAIEQPPIDAIIEAEHLLKEMKAFD--KND----------------------------ELTPLGKILARLPIEPRMGKMIIFGCLFGVGDACATVAACTSL-----GDPFI-----------IPPDRKRLNKVQ--VDLSANRCSDHVAILNAFQKWSYVQKRGF-----SEEEFCLSNGLNPSILKMSKDAASQMKNIL---INTGFPKECLEPKDLDYDN----SCPTINNVLSLLV 984          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TDRD94.002e-15931.81tudor domain containing 9 [Source:HGNC Symbol;Acc:... [more]
TDRD98.770e-9030.12tudor domain containing 9 [Source:HGNC Symbol;Acc:... [more]
TDRD91.780e-8729.90tudor domain containing 9 [Source:HGNC Symbol;Acc:... [more]
DHX366.590e-6831.75DEAH-box helicase 36 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX361.170e-6631.75DEAH-box helicase 36 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rha-12.697e-5727.60ATP-dependent RNA helicase A [Source:UniProtKB/Sw... [more]
smgl-26.712e-5028.21pep chromosome:WBcel235:IV:3726112:3735495:1 gene:... [more]
mog-45.309e-4725.83Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
let-3551.712e-4529.35pep chromosome:WBcel235:I:5472321:5479438:-1 gene:... [more]
mog-11.688e-4326.10Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spn-E1.777e-12128.83gene:FBgn0003483 transcript:FBtr0083183[more]
Rhau1.309e-6630.37gene:FBgn0032883 transcript:FBtr0081459[more]
Rhau1.309e-6630.37gene:FBgn0032883 transcript:FBtr0335147[more]
CG15821.072e-6530.86gene:FBgn0030246 transcript:FBtr0073403[more]
CG15821.072e-6530.86gene:FBgn0030246 transcript:FBtr0339768[more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd97.322e-15129.39tudor domain containing 9 [Source:NCBI gene;Acc:55... [more]
dhx99.587e-6229.73DEAH (Asp-Glu-Ala-His) box helicase 9 [Source:ZFIN... [more]
dhx292.028e-6129.68DEAH (Asp-Glu-Ala-His) box polypeptide 29 [Source:... [more]
dhx366.223e-6029.57DEAH (Asp-Glu-Ala-His) box polypeptide 36 [Source:... [more]
dhx348.771e-5728.49DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp4r12.336e-16530.97protein phosphatase 4 regulatory subunit 1 [Source... [more]
ppp4r19.702e-13829.39protein phosphatase 4 regulatory subunit 1 [Source... [more]
ppp4r13.455e-11428.69protein phosphatase 4 regulatory subunit 1 [Source... [more]
ppp4r12.233e-9028.74protein phosphatase 4 regulatory subunit 1 [Source... [more]
dhx576.910e-6729.71DEAH-box helicase 57 [Source:NCBI gene;Acc:1001247... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tdrd94.726e-15431.36tudor domain containing 9 [Source:MGI Symbol;Acc:M... [more]
Tdrd97.459e-9637.13tudor domain containing 9 [Source:MGI Symbol;Acc:M... [more]
Dhx364.859e-6731.84DEAH (Asp-Glu-Ala-His) box polypeptide 36 [Source:... [more]
Dhx571.979e-6632.31DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 [Sou... [more]
Dhx572.763e-6632.31DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 [Sou... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NDG6|TDRD9_HUMAN1.922e-15831.81ATP-dependent RNA helicase TDRD9 OS=Homo sapiens O... [more]
sp|B0XDC4|SPNE_CULQU2.245e-15330.74Probable ATP-dependent RNA helicase spindle-E OS=C... [more]
sp|Q14BI7|TDRD9_MOUSE3.306e-15331.36ATP-dependent RNA helicase TDRD9 OS=Mus musculus O... [more]
sp|Q3MHU3|TDRD9_RAT1.047e-15131.48ATP-dependent RNA helicase TDRD9 OS=Rattus norvegi... [more]
sp|B8A4F4|TDRD9_DANRE5.527e-15029.39ATP-dependent RNA helicase TDRD9 OS=Danio rerio OX... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M4H5T10.000e+031.27Tudor domain-containing 9 OS=Macrostomum lignano O... [more]
A0A0L8I0F80.000e+033.68Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1I8HLR00.000e+031.21Tudor domain-containing 9 OS=Macrostomum lignano O... [more]
A0A1I8HGZ00.000e+031.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2R2MMS90.000e+032.63ATP-dependent RNA helicase TDRD9 OS=Lingula unguis... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd97.133e-13630.10tudor domain containing 9 [Source:NCBI gene;Acc:55... [more]
dhx291.051e-6629.44DEAH (Asp-Glu-Ala-His) box polypeptide 29 [Source:... [more]
dhx362.534e-6530.99DEAH (Asp-Glu-Ala-His) box polypeptide 36 [Source:... [more]
dhx349.217e-5627.87DExH-box helicase 34 [Source:NCBI gene;Acc:1030237... [more]
dhx301.780e-5528.02DExH-box helicase 30 [Source:NCBI gene;Acc:1030474... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004476.18.755e-5830.06pep scaffold:Pmarinus_7.0:GL481383:3055:22197:-1 g... [more]
dhx345.201e-5728.05DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
dhx302.322e-4928.19DEAH (Asp-Glu-Ala-His) box helicase 30 [Source:ZFI... [more]
dhx81.243e-4125.38DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx571.079e-3744.39DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 [Sou... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YLR419W_mRNA9.133e-5531.29Putative helicase with limited sequence similarity... [more]
DHR21.287e-5226.12Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
PRP432.194e-5028.01RNA helicase in the DEAH-box family; functions in ... [more]
ECM161.588e-4927.08Essential DEAH-box ATP-dependent RNA helicase spec... [more]
PRP161.644e-4130.10DEAH-box RNA helicase involved in second catalytic... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440591.815e-14431.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358121.073e-6430.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376691.851e-6429.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431674.155e-4926.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403305.682e-3941.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx361.386e-6630.32DEAH-box helicase 36 [Source:NCBI gene;Acc:1011754... [more]
dhx361.790e-6630.30DEAH-box helicase 36 [Source:NCBI gene;Acc:1011754... [more]
dhx298.947e-6529.50DExH-box helicase 29 [Source:NCBI gene;Acc:1011722... [more]
dhx91.221e-6129.22DExH-box helicase 9 [Source:NCBI gene;Acc:10115619... [more]
dhx302.637e-5829.30DExH-box helicase 30 [Source:NCBI gene;Acc:1011720... [more]
back to top
BLAST of ATP-dependent RNA helicase TDRD9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016118.10.000e+0100.00SMESG000016118.1[more]
SMESG000079975.11.294e-5628.78SMESG000079975.1[more]
SMESG000079969.12.358e-5629.36SMESG000079969.1[more]
SMESG000079969.13.036e-5629.50SMESG000079969.1[more]
SMESG000079969.13.401e-5629.50SMESG000079969.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027258 ID=SMED30027258|Name=ATP-dependent RNA helicase TDRD9|organism=Schmidtea mediterranea sexual|type=transcript|length=4974bp
AATTGAATGAAATATGACTGAAAAATTTCTCAACAAAGAAAATAATTTGT
TAAATGCAGTTAGAAAAAATATAGAAAAAGTTTTTATAGAAAGAAAGAAA
AATATGTCAGAAAACCCTATTCAATCAACCTTTTCTAAAGAAATTGCGCA
ACCAGCATTTAAATTCCATTTAAACCAATACAATCCAAATCTTCCACTGG
GCGATGGAACAAAAAATGTAATGAATATGCGTGGAAATGATTTTATCAAG
CAAAAAAATATGGATGATCTTGAGAGTGTTACGACACGTCAAAACGGTTC
AGTTATCACCGGTCACGGATTTGATGTTAACGTTAACAGTTTAGAGACTA
TTAAAGAAAATAGTCGGTACAAATTAACTCACGAAAATCTTTCTAAGATT
AAAAGCAATAACAAAAGCAAGCGATCAATAATATTACCTATTCATCGACA
TGAAAAGGATATATTACGCGAAATTGAAAATAATCAGACTTTAGTAATTC
AAGGAAGTACTGGTTGTGGTAAAAGTACTCAAGTGCCACAATTTATTTTA
GACAATGCATTTGCCAATGATGAACCTGTCAATATTGTTGTAACCCAACC
TCGTAGAATAGCTGCCATTAGTGTGGCAATGCACGTAGCCTCAGAACGGG
GCTGGGAAATTGGTTCATATGTGGGTTATCAGGTTGGATTGGATAGGAAA
TGCAGCAACGAGACCGTTATCTCATTCGTAACAACTGGTGTTTTACTAGA
ACAATTAATTCACAATCAAACACTTACTGATTATACTCATATCATTCTCG
ATGAAGTACATGAAAGAGATGTTGACATGGATCTGTTGTTATCTGTCGTG
AAGGATCTATTAATGCACGATACTCGCACGAAAATTATCCTCATGTCAGC
TACTGTTGCCGCGGATAAATTTTCATGTTATTTTTCAAAACAAATTGATC
CGAAAACCCTGGAACCGCTACCGGGTTCAATTTTCCGCATTGAAGGAAAA
ATGTTTCCTGTTGAGGAATTTTTTCTTGATGATTTACCTAAATTAGGCAT
TTGTCAAGACGCGCCATATTCCTATGATGTCTGTCAGCAACCGCGATTAA
CTGCTGAATTGAAAGAAATGATCTATCAGCTTTTGATGTTTATTACTTAC
ACGGAAATGTCTGATACAAAATGCACGAATATTAATCAATTGGAAATGGG
ATCAGTTTTAATTTTTCTTCCCGGTCTCAGCGATATAACCGAATTAAACG
AGTATTTATTATTAGGATATAAAAGAGAAAATTGCGTAAATCCTCGCAAA
AGAGATTTCTTTTCAAATAATGGTCAATCAGCAGCTATATTTCCTTTGAG
AATTGACCCTAAGAGTTGTATAAGACGAGTTTTAGAAGATGAGAAACTAC
AAAAGGTGTACCAGGATACATTTTATCTGCTTGCTCTACATTCAAGTATT
GGAATTTCAGAGCAGAAACGGGCTTTTGAAAGTATCCAACTTGGAAGAAG
AAAGATAATCCTATCTACAAATATAGCAGAGAGTTCTATTACTGTTAAAG
ATATAAAATACGTTATTGATTTGTGTATGATCAAACGACTGAGATATGAT
CGAGAAACGCATTTCTCGTCTTTGAAAGCTGAATGGGCAAGTAAGTCTAG
TTGTAAGCAAAGAGCTGGTAGGGCTGGAAGAGTTAGAAACGGTGTAGTAT
ATAGGTTAATTAGCCAGTACGTTTACAATCAATTGGACGAATTTTGTCCT
CCTGAAATCCTAACAGGCCCGTTAACTCAAGTGATTTTAAGGATCAAAGA
ATTTAATAGAGACCCACGAGCGTTGTTACAAAGAGCTCTAGACTGCCCAT
CACTGGAAGACATTGGGTATACATTCCTAACTCTTAAAGAAGCTGGTGCA
TTAAGCATTAAAAGAAATGAAATTACGAAGGTTATAAATAAAGAGAATGG
TGAAAAAGTCCAACTGACTCAAGTAGTAATGCCTATCGATGATCATTGGC
AAGGAGAATTAACTTTCATTGGTCGTTTGATATCATCGCTTCCAATGGAT
TTGCACATGGGCAAACTGATAGCCCTGGGCTACGCGTTCGATGTATTAGA
AGAGACCATCATTATTGCATCTTGTTTGACAGTCAGTAGAAGTATATTTT
CACAGCCATTTTTTTCCGGAAAAGTCAAAAACACCAAGTATTCAAAAGCA
CCTAACCAAATGAAAACTTTGGATGCATTTGAAAAAAAATTACGTCTTTC
TGAATCGAAATACAGCGATTTGCTGACTATGCTCAATGGTTTCAAACTCT
GGTACCAGCGGTTAAAGACCGGCGCATTTAGATCTAGGGAAGATGAGTAT
AAATGGTGTTCCTCTTTATACTTGGATCCTCAGGCTTTGCACGAGGTTGA
AGTGTTGACTGATGAAATTAAAAGACGATTAAAAGAAAAATTTAATATTA
CTGTGGATTTTTCCACTCTTGATAAAAAAGACTGCGAAGAAGATGCTTTT
TTTGAACCCAGCGCTAACCACATCTCAAATATTCACTCAGTAGTAATTAG
CAAAACATTTCGTATTATGTTACTTCAGATAACTATAGCCGGAGCGTTTT
ATCCGAATTATTTTTTACGTATTCATAATCCTTTTATTGAGGATGATGCA
ATGCGGACATTTGACGGACTAGACCCATTCCAATGTGTAGAAATCGGTAA
TTTACCGATGGATGAAGGTTGTCTATATAGAGATACGATTGCAGATCATT
TTAAAAACTTTTGCATGAAATTCTCACCGGATAAGCCGGTTGTTATATGT
AGGAATACAAAAGGTATCATTAAGTTTCCTCCAAATAACGGTTCATATAC
AAACGAATCGACGGATTCAAATACGTTTAACTTGTCGGTTCTCATGTCGA
TAAAAATGGGTCAGTTCAGTGCTCTGAAACCCCGCATTGATGTATTTGAA
TTAACTAATGCGGAAAAAACGAAATTAAAAGCCATACTTGAAAAGGAAAG
TATCAAAAACAATCATATTCTTCCTCTGAATTACAAATATAAATCGGGAC
ATAAAAACTTCATTGGGTTTCCAAGCATTGATTGCAATTTCATAAAGATT
TATGTCACTTATGCATCTGAATGTGGATCATTTTATGGAATATACGAAGA
AGAAAAGGACAATGAACAAAAACTTTTTATGGAAATAAGCGATTTCGTTA
CTCATGCTAAAAATCTTGTGAAATCAAAAATATTTGAAGTTAATGATTTT
TGTCTAGCTCCATATGAGGGAGATTTTTATCGAGCAGAAATCATTTCTAA
ATCCAATCAAAATTGCACAGTATTTTTTGTCGATTATGGAAATAGTGTAA
CGTTACAATATAATCAATTATTTGATTTGCCAGATTTTCTTCTCAAATCT
TGCCCTCTGCTTGCCGTTAAATTTATTCTAAGTGAAATGAAACCTTATAC
TGCTTACCATCCAGATCATAAATGGAGTGCTCAAGATAAAGAAATATTTC
TTAACTACATTAATTGCTATACAAACACCCCAGTCGGATGTAAAATTTAC
TCAGTGGTCGATAATGCTGTGAGAGTTCGAGTGCTAATGGTTGATCATCA
AGACAAGATTCTAAATGAAGAATTAATACTTATGAGAATAGCCGAATATG
CCGAAGAATCCTACGCAAGTCGCCAAGATAATATATTGCGAACTAAGTGC
AACAATAAGCGCCATATTGATTTGTTTGGTCATACTCACAGTGAATCTAA
AATAAACTTCATGAAAAATTTGTTAAGTAATGATTCTGGAAGTGACCAAA
ATAGCGACAGTGGAAGAGAATCCAGTTCTCAAAATGAAGGACTTGATTAT
TTAATGAAAACAGTATGTTTAAGACAAACAGTTCCTCAAACTGTTGTACT
CAGTGCTCCATGTCATCCTTATATAATGAAATTCCACGGAATTACTGAAT
CGTGCAAAAGGCCGGTGACATTGGCAACAGATTCAGTCAATAGCATTATA
ATTGATCCAGAACCTCAGAACCACCTTCACAGAATGATGGTTGCTCACTG
TGTTCAATCAAGCGGAGGAGGAGAACAAGGAAATGACTTATTACTTCGAA
ATACGACTTTGATGCCATCGATTCCTGGCTTTCCGTTTTTAATTGCATTA
ATTTTCACTCCATATGCCGAATTAATATCTGACAAGTTTCAAACTCGTTA
CATTGGGGCTAAATGTGGCCTAGGTATTGATTCCGAAGGCCGTCCATTGC
ACCCAGCTAATGATATGGAAATGATCACCGATGTCAGGTTCGATTCAAGT
GACATAAAAAATGTCAACGGTATTAGAAGTTTACTAAATATTGCACTGGG
TAGCTCAATGCACAGTCAAGATGCTATGGACAAATACCAGTCGGGTATTA
AAAAATTCATTGCATCATTGCTTCTTAAACACAGCCGGGACTTAGTTAAC
AATAATAATGTTGGAGAATATCGTGTGAAAACAGATATTTCCGTTCTTGA
GAATGACTCCTATTCTAACGTTAGACAAATAACTAAAATTTTCATTCCAC
ATATCGTTATCGAAGGAGTGGCCCGTCGACTCGATTGGGTTCGCAATCCT
ATATTAGGAGATCCTAGAACTGAACGCGCAAAAGCTGAATGGTTGCCGCG
TTATATGGCGGCTGCCGAAGAAAATTTAAAAGATTTATTACAGCCTCAAA
GACCAATGTCTCGAGTGAAATCGAGTCGCGAAGTATTATCGGAAGTCAAA
ATTTGCGAATTATGCACGCAAAATAGCGACTATATTACCGAGAGATCTAG
ACTCGGCGTGCCGATATTTACCGAATCGGATCTCGAAGATCATATTCAAT
CCAATCAACACAAACAAAATGTTTTACAAATGAGAAATATTTTAAATGTA
TAATAAGAATTCCATGAACTTTTTAAGTGTAGAAATCAATTATTTTTTCT
GTGCTGTATTGATGTTTGTATAAT
back to top

protein sequence of SMED30027258-orf-1

>SMED30027258-orf-1 ID=SMED30027258-orf-1|Name=SMED30027258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1630bp
MTEKFLNKENNLLNAVRKNIEKVFIERKKNMSENPIQSTFSKEIAQPAFK
FHLNQYNPNLPLGDGTKNVMNMRGNDFIKQKNMDDLESVTTRQNGSVITG
HGFDVNVNSLETIKENSRYKLTHENLSKIKSNNKSKRSIILPIHRHEKDI
LREIENNQTLVIQGSTGCGKSTQVPQFILDNAFANDEPVNIVVTQPRRIA
AISVAMHVASERGWEIGSYVGYQVGLDRKCSNETVISFVTTGVLLEQLIH
NQTLTDYTHIILDEVHERDVDMDLLLSVVKDLLMHDTRTKIILMSATVAA
DKFSCYFSKQIDPKTLEPLPGSIFRIEGKMFPVEEFFLDDLPKLGICQDA
PYSYDVCQQPRLTAELKEMIYQLLMFITYTEMSDTKCTNINQLEMGSVLI
FLPGLSDITELNEYLLLGYKRENCVNPRKRDFFSNNGQSAAIFPLRIDPK
SCIRRVLEDEKLQKVYQDTFYLLALHSSIGISEQKRAFESIQLGRRKIIL
STNIAESSITVKDIKYVIDLCMIKRLRYDRETHFSSLKAEWASKSSCKQR
AGRAGRVRNGVVYRLISQYVYNQLDEFCPPEILTGPLTQVILRIKEFNRD
PRALLQRALDCPSLEDIGYTFLTLKEAGALSIKRNEITKVINKENGEKVQ
LTQVVMPIDDHWQGELTFIGRLISSLPMDLHMGKLIALGYAFDVLEETII
IASCLTVSRSIFSQPFFSGKVKNTKYSKAPNQMKTLDAFEKKLRLSESKY
SDLLTMLNGFKLWYQRLKTGAFRSREDEYKWCSSLYLDPQALHEVEVLTD
EIKRRLKEKFNITVDFSTLDKKDCEEDAFFEPSANHISNIHSVVISKTFR
IMLLQITIAGAFYPNYFLRIHNPFIEDDAMRTFDGLDPFQCVEIGNLPMD
EGCLYRDTIADHFKNFCMKFSPDKPVVICRNTKGIIKFPPNNGSYTNEST
DSNTFNLSVLMSIKMGQFSALKPRIDVFELTNAEKTKLKAILEKESIKNN
HILPLNYKYKSGHKNFIGFPSIDCNFIKIYVTYASECGSFYGIYEEEKDN
EQKLFMEISDFVTHAKNLVKSKIFEVNDFCLAPYEGDFYRAEIISKSNQN
CTVFFVDYGNSVTLQYNQLFDLPDFLLKSCPLLAVKFILSEMKPYTAYHP
DHKWSAQDKEIFLNYINCYTNTPVGCKIYSVVDNAVRVRVLMVDHQDKIL
NEELILMRIAEYAEESYASRQDNILRTKCNNKRHIDLFGHTHSESKINFM
KNLLSNDSGSDQNSDSGRESSSQNEGLDYLMKTVCLRQTVPQTVVLSAPC
HPYIMKFHGITESCKRPVTLATDSVNSIIIDPEPQNHLHRMMVAHCVQSS
GGGEQGNDLLLRNTTLMPSIPGFPFLIALIFTPYAELISDKFQTRYIGAK
CGLGIDSEGRPLHPANDMEMITDVRFDSSDIKNVNGIRSLLNIALGSSMH
SQDAMDKYQSGIKKFIASLLLKHSRDLVNNNNVGEYRVKTDISVLENDSY
SNVRQITKIFIPHIVIEGVARRLDWVRNPILGDPRTERAKAEWLPRYMAA
AEENLKDLLQPQRPMSRVKSSREVLSEVKICELCTQNSDYITERSRLGVP
IFTESDLEDHIQSNQHKQNVLQMRNILNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR007502Helicase-assoc_dom
IPR002999Tudor
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016787hydrolase activity