Lysyl oxidase

Overview
NameLysyl oxidase
Smed IDSMED30027243
Length (bp)1540
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysyl oxidase (SMED30027243) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysyl oxidase (SMED30027243) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysyl oxidase (SMED30027243) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysyl oxidase (SMED30027243) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027243

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027243SMESG000004065.1 SMESG000004062.1 PL06010A2D02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027243SMESG000004065.1 PL08003B1G10ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30027243SMESG000004065.1 SMESG000004062.1 dd_Smed_v4_7096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027243SMESG000004065.1 SMESG000004062.1 Contig45243newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027243SMESG000004065.1 SMESG000004062.1 Contig45243uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30027243SMESG000004065.1 SMESG000004062.1 dd_Smed_v6_7096_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30027243SMESG000004065.1 SMESG000004062.1 SMED30027243smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30027243SMESG000004065.1 SMESG000004062.1 SMED30027243smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30027243SMESG000004065.1 SMESG000004062.1 dd_Smed_v4_7096_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysyl oxidase vs. Ensembl Human
Match: LOXL2 (lysyl oxidase like 2 [Source:HGNC Symbol;Acc:HGNC:6666])

HSP 1 Score: 234.572 bits (597), Expect = 5.664e-68
Identity = 148/449 (32.96%), Postives = 222/449 (49.44%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH---INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG++CDD W +  A+V+C++LG   A +    +     GI    ++++ C GN+  I  C+F       C   E  GV+C   A  +Q+++  N  R P      V + +N            S V G+   +C  N+   E  V+C Q+  G      +      G  N +K ++   +C G E SL  C        V C    + +   + C    PD+  +   V++++Y+E   ++ LQCA+ E CL  S  +     P + +   R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y++++     VA GHKASFCLED  C  + +  ++C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ++INP F V E++Y NN + C   Y G+   + +C
Sbjct:  326 VRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSRL-GQGIGPIHLNEIQCTGNEKSIIDCKFNA-ESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNG-----------SLVWGM---VCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHC--RHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQT---DPTTGY---RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANF----GDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNC 746          

HSP 2 Score: 69.707 bits (169), Expect = 6.456e-12
Identity = 58/240 (24.17%), Postives = 110/240 (45.83%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVAN--VQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGG---TIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDI 853
            EG V V+    WG++CDD +++  A+V+C++LG  +A  +   + +   G    ++D+++C GN++ +A C   GWG  DC+  E VGV C       +K  N  + +  N N     +   +++S  +    +M  +G V  +       +C  ++ A  + V+C  M+G  G      ++  M   +     +   +  C G E+ ++ C       G     D M ++ C + LP +
Sbjct:   69 EGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSY-GKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVM--EGYVEVKEGKTWKQICDKHWTAKNSRVVC-GMFGFPGERTYNTKVYKMFASRRKQRYWPFSM-DCTGTEAHISSCKL-----GPQVSLDPMKNVTCENGLPAV 298          
BLAST of Lysyl oxidase vs. Ensembl Human
Match: LOXL4 (lysyl oxidase like 4 [Source:HGNC Symbol;Acc:HGNC:17171])

HSP 1 Score: 229.565 bits (584), Expect = 2.714e-66
Identity = 145/451 (32.15%), Postives = 221/451 (49.00%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANV--QREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY--PLCPNNFKATENNVLCHQMYGKLGGTIELIPMN---TGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V +   WG++CD  W +  A+V+C+QLG   A +          G+    + +V C G +  ++ C      ++ C+      V+C  V N+  Q +V     RIP  +E L+               V  EV+G+     +C  N+  TE  V C Q+   LG  I         +G     + ++   RC G E +L QC  +   +        +  ++C+   PD+  +   V+ ++Y+E   +  L CA  E CL  S   +    P+ Y    R LLRFS+ I N+G ++F P    D W WH CH HYHS+++F  Y+++    + VA GHKASFCLED  C T  +  + C N     G QG++ GC DTY H+ DCQWVD++++ PG Y FQ+I+NP + V E+++ NN L C   Y G+   L +C
Sbjct:  311 VRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREALFGARL-GQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRC-NVPNMGFQNQVRLAGGRIP--EEGLLE--------------VQVEVNGVPRWGSVCSENWGLTEAMVACRQL--GLGFAIHAYKETWFWSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDRPLSQLYCAHEENCLSKSADHMD--WPYGY----RRLLRFSTQIYNLGRTDFRPKTGRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACANF----GEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNC 731          

HSP 2 Score: 73.9442 bits (180), Expect = 2.836e-13
Identity = 37/95 (38.95%), Postives = 55/95 (57.89%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQF-YKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCY 445
            P+EG + V     WG++CDD++ + EA V C+QLG E A+ + +   Y Q  G    ++D+V C G +S +  C   GWG  DC  +E VGV C+
Sbjct:   41 PEEGRLEVLHQGQWGTVCDDNFAIQEATVACRQLGFEAALTWAHSAKYGQGEG--PIWLDNVRCVGTESSLDQCGSNGWGVSDCSHSEDVGVICH 133          
BLAST of Lysyl oxidase vs. Ensembl Human
Match: LOXL3 (lysyl oxidase like 3 [Source:HGNC Symbol;Acc:HGNC:13869])

HSP 1 Score: 221.09 bits (562), Expect = 2.075e-64
Identity = 143/468 (30.56%), Postives = 219/468 (46.79%), Query Frame = 2
Query:  101 GFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG---IRYPL-CPNNFKATENNVLCHQMYGKLG----GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM---IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            GF++    +++  V+L  G  P EG V V     WG++CD  W +  A+V+C++LG   A +          G+    + +V C G +  +  C        DC  ++  GV+C                  LP     +  + S      +G V  ++ G   +R+ L C +++   E  V C Q+   LG    G  E    ++G  N ++ ++   RC G E SL QC  + +   + C+         + C     D+    A V+ ++Y+E   +  L CA  E CL  S       + H      R LLRFSS I N+G ++F P      W WH CH HYHSM +F  Y+I+      VA GHKASFCLED  C  +    ++C N     G QGI+ GC D Y H+ DCQW+D++++ PG Y  Q++INP F V E+++ NN + C   Y G+   + +C
Sbjct:  151 GFSD--SNVIEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGARM-GQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCN-----------------LPYTGAETRIRLSGGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQL--GLGYANHGLQETWYWDSG--NITEVVMSGVRCTGTELSLDQCAHHGTH--ITCKRTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGH------RRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANF----GEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNC 582          

HSP 2 Score: 67.0106 bits (162), Expect = 4.274e-11
Identity = 51/213 (23.94%), Postives = 83/213 (38.97%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLG-----------RCYGNESSLTQC 769
            P EG V +     WG+ICDD +T+  A+++C++LG  +A  +     +   G    ++D++ C G +  +  C   GWG  DC  +E  GV C               R+P   +S V   +   K     G    EV            KA+    +C + +     ++    +  G    +    R+G           RC G E SL +C
Sbjct:   53 PYEGRVEIQRAGEWGTICDDDFTLQAAHILCRELGFTEATGWTHSAKY-GPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDAGVIC------------KDQRLPGFSDSNVIEARVRLKGGAHPGEGRVEV-----------LKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGARMGQGMGAIHLSEVRCSGQELSLWKC 241          
BLAST of Lysyl oxidase vs. Ensembl Human
Match: LOXL3 (lysyl oxidase like 3 [Source:HGNC Symbol;Acc:HGNC:13869])

HSP 1 Score: 221.09 bits (562), Expect = 3.002e-64
Identity = 143/468 (30.56%), Postives = 219/468 (46.79%), Query Frame = 2
Query:  101 GFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG---IRYPL-CPNNFKATENNVLCHQMYGKLG----GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM---IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            GF++    +++  V+L  G  P EG V V     WG++CD  W +  A+V+C++LG   A +          G+    + +V C G +  +  C        DC  ++  GV+C                  LP     +  + S      +G V  ++ G   +R+ L C +++   E  V C Q+   LG    G  E    ++G  N ++ ++   RC G E SL QC  + +   + C+         + C     D+    A V+ ++Y+E   +  L CA  E CL  S       + H      R LLRFSS I N+G ++F P      W WH CH HYHSM +F  Y+I+      VA GHKASFCLED  C  +    ++C N     G QGI+ GC D Y H+ DCQW+D++++ PG Y  Q++INP F V E+++ NN + C   Y G+   + +C
Sbjct:  151 GFSD--SNVIEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGARM-GQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCN-----------------LPYTGAETRIRLSGGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQL--GLGYANHGLQETWYWDSG--NITEVVMSGVRCTGTELSLDQCAHHGTH--ITCKRTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGH------RRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANF----GEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNC 582          

HSP 2 Score: 67.0106 bits (162), Expect = 4.355e-11
Identity = 51/213 (23.94%), Postives = 83/213 (38.97%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLG-----------RCYGNESSLTQC 769
            P EG V +     WG+ICDD +T+  A+++C++LG  +A  +     +   G    ++D++ C G +  +  C   GWG  DC  +E  GV C               R+P   +S V   +   K     G    EV            KA+    +C + +     ++    +  G    +    R+G           RC G E SL +C
Sbjct:   53 PYEGRVEIQRAGEWGTICDDDFTLQAAHILCRELGFTEATGWTHSAKY-GPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDAGVIC------------KDQRLPGFSDSNVIEARVRLKGGAHPGEGRVEV-----------LKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGARMGQGMGAIHLSEVRCSGQELSLWKC 241          
BLAST of Lysyl oxidase vs. Ensembl Human
Match: LOXL3 (lysyl oxidase like 3 [Source:HGNC Symbol;Acc:HGNC:13869])

HSP 1 Score: 218.779 bits (556), Expect = 2.485e-62
Identity = 141/458 (30.79%), Postives = 213/458 (46.51%), Query Frame = 2
Query:  131 DGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG---IRYPL-CPNNFKATENNVLCHQMYGKLG----GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM---IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            +  V+L  G  P EG V V     WG++CD  W +  A+V+C++LG   A +          G+    + +V C G +  +  C        DC  ++  GV+C                  LP     +  + S      +G V  ++ G   +R+ L C +++   E  V C Q+   LG    G  E    ++G  N ++ ++   RC G E SL QC  + +   + C+         + C     D+    A V+ ++Y+E   +  L CA  E CL  S       + H      R LLRFSS I N+G ++F P      W WH CH HYHSM +F  Y+I+      VA GHKASFCLED  C  +    ++C N     G QGI+ GC D Y H+ DCQW+D++++ PG Y  Q++INP F V E+++ NN + C   Y G+   + +C
Sbjct:  304 EARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGARM-GQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCN-----------------LPYTGAETRIRLSGGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQL--GLGYANHGLQETWYWDSG--NITEVVMSGVRCTGTELSLDQCAHHGTH--ITCKRTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGH------RRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANF----GEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNC 727          

HSP 2 Score: 67.0106 bits (162), Expect = 4.707e-11
Identity = 41/141 (29.08%), Postives = 64/141 (45.39%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC----------YKVANVQREVNWNPLRI---------PLP-KESLVSLR 526
            P EG V +     WG+ICDD +T+  A+++C++LG  +A  +     +   G    ++D++ C G +  +  C   GWG  DC  +E  GV C            V  V+  +    +RI         PLP  E LV +R
Sbjct:   53 PYEGRVEIQRAGEWGTICDDDFTLQAAHILCRELGFTEATGWTHSAKY-GPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRRPLPVTEGLVEVR 192          
BLAST of Lysyl oxidase vs. Ensembl Celegans
Match: C06B8.7 (pep chromosome:WBcel235:V:15498743:15511421:1 gene:WBGene00007372.1 transcript:C06B8.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06B8.7)

HSP 1 Score: 55.4546 bits (132), Expect = 1.079e-7
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  137 DVKLVD---GGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKK-NYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKH---DCRSNEQVGVQC 442
            D++LVD        EG + V +   WG++C+  WT     + C QLG+   VQ+++    F   G     MD++ C  N+  I  C   G  ++    CRS E VG++C
Sbjct: 1034 DIRLVDVDGNYEVTEGRLEVLVDDQWGTVCNRSWTPQLTILACNQLGLVADVQYFENWRIFPEPGDLPMIMDNIRCEENEVDITKCRHDGVERNCAAGCRSTEVVGLRC 1142          
BLAST of Lysyl oxidase vs. Ensembl Fly
Match: Loxl2 (gene:FBgn0034660 transcript:FBtr0071745)

HSP 1 Score: 306.22 bits (783), Expect = 4.218e-98
Identity = 169/511 (33.07%), Postives = 277/511 (54.21%), Query Frame = 2
Query:   17 LKISDMSKLIITLKIFISFALIFTRYSKGFNELQKKLV----------DGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLR------IPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY-PLCPNNFKATENNVLCHQMYGKLGGTIELIPMNT-GKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGV-PCESDKMIHINCISD--LPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
            LK+      +  L I ++ A++  R  +   + +++LV          +G ++LV G +  EG + V     WG++CDD W  TEA+++C+QLG     ++ +  +F     + ++MD+++C G++  +  C F GWG++DC   E  GV CY   N    +    +R       P+   S + +R    +  +E  V +S +DG R+  +C + +   E NV+C Q+   LG   E    +  G FN S+ ++    CYGNE+ L  CL + +S G+  C  ++      I D   PD+  DY E+E+++++E   +  +QCA+ E C+ +  Y+I    PH + + +R LL+F++   N G ++F P +++ +WEWH CH+H+HSM++FA ++I + +   VA GHKASFCLED+ C+      + C N     G QGIS  C D YL+  DCQWVD++++ PGTY  ++ INP F V E NY NN   C L Y    A +++C    P
Sbjct:   10 LKMGLTLVCLTLLAIHMADAVVQHRSLEDARQERQRLVHRYTKVLNKEEGAIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFF-GPARRRFWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVCYPPENALIPMATPIIRDEDLPKYPIHSRSRLYVRLRGGRSRIEGRVEVS-LDGGRWGSVCADGWSLLEANVVCRQL--GLGYASEAFQTDFFGGFNVSRPVLSGSECYGNETELADCLHHDASQGIISCHGNRQHVAAVICDYIAPDLVVDYLEIEQTAHLEDRPMLLMQCAMEENCVANEAYQIQRDDPH-WRYRSRRLLKFTAAAINAGNADFRPFKEKSQWEWHMCHMHFHSMEVFATFDIFNLRGIKVAQGHKASFCLEDSNCLPGVAKKYNCANY----GDQGISINCSDVYLYNLDCQWVDVTDLIPGTYVLKIAINPEFKVAEMNYDNNAAICDLIYTANFARVQNCQLGRP 511          
BLAST of Lysyl oxidase vs. Ensembl Fly
Match: Loxl1 (gene:FBgn0039848 transcript:FBtr0085810)

HSP 1 Score: 172.555 bits (436), Expect = 9.963e-49
Identity = 111/343 (32.36%), Postives = 166/343 (48.40%), Query Frame = 2
Query:  455 NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY-PLCPNNFKATENNVLCHQMYGKLG-GTIELIPMNTGKFNYSKYIVRL--GRCYGNESSLTQCLTYASSNGVPCESDKMIHIN-CISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPG-TYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILR 1465
            NVQ       +R+   K +L  +     +++ E  V +S   G  +  +C  ++   E NV+C Q    LG G        T   +  KY   +    C G E  L  C+  +    +    +  + I  C+S   D+     ++ER++ +E + +  L CA+ E C+    Y+I   +PH+     R LLRFS    N+GT++  P     +W WH CH HYHSM +FA +++ D     VA GHKASFCL D+ C    +  + CGNT     TQGIS GC DTY    DCQWVD++ +     Y  ++ +NP + +GE ++ NNG  C L Y G     R
Sbjct:   23 NVQNNYRNMMVRLATNKAALAGI-----QVLREGRVEVSFDFGASWGTICSTSWSMREANVVCRQ----LGLGYASKASQGTEHGDSRKYPWGMVGTLCRGTERRLADCIRESHYPNLCNARNHNVSIAACVSHSADLEIGLVDIERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHA----ARILLRFSVKASNVGTADVSPYANYKEWVWHQCHRHYHSMNVFATFDVYDLNYRKVAQGHKASFCLMDSECRPGVRQKYTCGNT-----TQGISVGCADTYTDVLDCQWVDVTRVPINRRYILRVALNPEYKLGEISFENNGAECLLDYTGVRQTTR 347          

HSP 2 Score: 52.373 bits (124), Expect = 4.800e-7
Identity = 29/95 (30.53%), Postives = 44/95 (46.32%), Query Frame = 2
Query:  104 FNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYG--WGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYC 382
            +  +  +L      L      +EG V V   +G  WG+IC   W+M EANV+C+QLG+  A +  +      S    + M    C G + R+A C
Sbjct:   28 YRNMMVRLATNKAALAGIQVLREGRVEVSFDFGASWGTICSTSWSMREANVVCRQLGLGYASKASQGTEHGDSRKYPWGMVGTLCRGTERRLADC 122          
BLAST of Lysyl oxidase vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0344980)

HSP 1 Score: 87.0409 bits (214), Expect = 1.669e-17
Identity = 71/287 (24.74%), Postives = 124/287 (43.21%), Query Frame = 2
Query:  101 GFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIK--NYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC----------YKVANVQRE------VNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEV------DGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGR--CYGNESSLTQC--LTYASSNGVPCESDKMIHINCISDLPDIRADYAEVE 877
            G +E      D +V+L  G SP  G + V     WG +CDD + + +A+V+C++LG +   Q  + + F +   +  NY MD+V C GN++++  C F GWG H+C  +E  GV C          Y + +  +E      V  N        +   ++ +   +  LE G   +E        G+   +C ++F      V C+ M     G      +    F  S   + L +  C+GNE+S+ QC    +   N   C   + + ++C +  P     Y++ +
Sbjct: 1803 GKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSM-----GFFGPAKIEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHN---CNHTEDVALHCSAGPPPRSQRYSQTQ 2081          
BLAST of Lysyl oxidase vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0076525)

HSP 1 Score: 86.2705 bits (212), Expect = 2.541e-17
Identity = 71/287 (24.74%), Postives = 124/287 (43.21%), Query Frame = 2
Query:  101 GFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIK--NYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC----------YKVANVQRE------VNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEV------DGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGR--CYGNESSLTQC--LTYASSNGVPCESDKMIHINCISDLPDIRADYAEVE 877
            G +E      D +V+L  G SP  G + V     WG +CDD + + +A+V+C++LG +   Q  + + F +   +  NY MD+V C GN++++  C F GWG H+C  +E  GV C          Y + +  +E      V  N        +   ++ +   +  LE G   +E        G+   +C ++F      V C+ M     G      +    F  S   + L +  C+GNE+S+ QC    +   N   C   + + ++C +  P     Y++ +
Sbjct:  874 GKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSM-----GFFGPAKIEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHN---CNHTEDVALHCSAGPPPRSQRYSQTQ 1152          
BLAST of Lysyl oxidase vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0344981)

HSP 1 Score: 85.8853 bits (211), Expect = 3.562e-17
Identity = 71/287 (24.74%), Postives = 124/287 (43.21%), Query Frame = 2
Query:  101 GFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIK--NYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC----------YKVANVQRE------VNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEV------DGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGR--CYGNESSLTQC--LTYASSNGVPCESDKMIHINCISDLPDIRADYAEVE 877
            G +E      D +V+L  G SP  G + V     WG +CDD + + +A+V+C++LG +   Q  + + F +   +  NY MD+V C GN++++  C F GWG H+C  +E  GV C          Y + +  +E      V  N        +   ++ +   +  LE G   +E        G+   +C ++F      V C+ M     G      +    F  S   + L +  C+GNE+S+ QC    +   N   C   + + ++C +  P     Y++ +
Sbjct: 2216 GKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSM-----GFFGPAKIEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHN---CNHTEDVALHCSAGPPPRSQRYSQTQ 2494          
BLAST of Lysyl oxidase vs. Ensembl Zebrafish
Match: loxl2a (lysyl oxidase-like 2a [Source:NCBI gene;Acc:565508])

HSP 1 Score: 238.81 bits (608), Expect = 4.698e-70
Identity = 151/448 (33.71%), Postives = 218/448 (48.66%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G +  EG V V     WG++CDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F       C   E   V+C            N   +   K   +S  +N F+  +E   VL+E +G  +   +C  N+   E  V+C Q+  G      +      G  N    ++   RC G E SL QCL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCAL E CL  +  K    + HS +   R LLRFSS I N+G S+F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C       + C N     G QGI+ GC DTY H+ DCQW+D++++ PG Y FQ++INP + V E++Y NN + C   Y GY     SC
Sbjct:  294 VRLRGGANVGEGRVEVLKNGVWGTVCDDNWNLKAATVVCRELGFGSAKEALTGAKL-GQGMGPVHMNEVECSGFEKSLTDCYFNN-DALGCSHEEDAAVRC------------NVPAMGFQKRIRLSGGRNPFEGRVE---VLAEKNGSLVWGTVCSENWGIIEAMVVCRQLGLGFASHAFQETWYWAGDANADNVVMSGVRCSGTEMSLPQCLHHGKHINCPKGGGRFAAGVSCSDTAPDLVLNAQLVEQTTYLEDRPMYALQCALEENCLSSTARK----NDHSSY---RRLLRFSSQIHNVGQSDFRPKLGYHAWTWHECHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDTHCDEGISKRYHCANF----GEQGITVGCWDTYRHDIDCQWIDVTDVKPGDYIFQVVINPNYDVAESDYTNNVMKCKCRYDGYRIWTYSC 713          

HSP 2 Score: 73.9442 bits (180), Expect = 1.939e-13
Identity = 65/235 (27.66%), Postives = 105/235 (44.68%), Query Frame = 2
Query:  110 ELQKKLVDGDVKLVDGGSPK---EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLRKNSF-----KIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLG------GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            + Q +L    ++L   G  +   EG + VF    WG++CDD +++  A+V C+QLG   AV +     F   G    ++D+V+C G ++ +A C   G+G  DCR +E VGV C  K     R +N     +   +E +  +R         +I + +G V  +  G    +C   +    + V C  MYG  G           + M   K NY  + V    C GNE+ ++ C
Sbjct:   17 QAQSELQQPKIELRLAGDKRKHYEGRLEVFYNNEWGTVCDDDFSIEAAHVACRQLGFLGAVAWSPSAKF-GQGEGRIWLDNVHCTGRENSLAACPSNGFGVSDCRHSEDVGVICNQKRIPGHRFINIMNNNVETLEERVEEIRIRPISSHLKRIPITEGYVEVKERGKWRQICDEEWTPLNSRVAC-GMYGFPGEKNYNNKVYRSLSMRKKK-NYWGFSV---NCTGNEAHVSSC 245          
BLAST of Lysyl oxidase vs. Ensembl Zebrafish
Match: loxl2b (lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144])

HSP 1 Score: 235.343 bits (599), Expect = 1.565e-68
Identity = 151/468 (32.26%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD-CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F      + C   E  GV+C            N   +   +   +S  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  N    ++   RC G E SL+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P       R LLRFSS I N G S+F P    + W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  302 MTGYKKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDNWNLLAATVVCRELGFGSAKEALSGGQL-GQGMGPVHMNEVQCSGFEKSVTECSFNMEKDSEGCSHEEDAGVKC------------NVPAMGFQQRLRLSGGRNPFEGRVE---VLVERNGSLVWGTVCGEGWTTMEAMVVCRQLGLGFASNAFQETWYWPGAVNADAVVMSGVRCAGTEMSLSHCLHHGEYLSCPKGGGRFAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSATPANSP-------RRLLRFSSQIHNNGQSDFRPKISRENWVWHDCHRHYHSMEVFTHYDLLSTNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQIVINPNYEVAESDYTNNIVKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 78.9518 bits (193), Expect = 4.849e-15
Identity = 66/238 (27.73%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V VF    WG++CDD +T+  A VIC++LG  +A+ +   + +   G    + D+V+C G +  +A CE  G G  DC+ +E VGV C       +K  N     N N L I +     +  L S RK   +I + +G V  +  G    +C + +    + V+C  M+G     +    +  +     K +Y  Y +    C G E+ L+ C    + +   CE    + ++CI
Sbjct:   64 EGRVEVFYEGEWGTVCDDDFTIHAAQVICRELGYFEAISWSPSSKY-GKGEGRIWFDNVHCKGKEKSLAQCESNGIGVSDCKHSEDVGVVCSDKRIPGFKFVNTLTN-NINSLNIQVEDVRIRPILASYRK---RIPVTEGYVEVKDGGKWKQICDDEWTQMNSRVIC-GMFGFPGQKRYNTRVYKMFARRRKPSYWDYTI---NCTGKEAHLSSCTLGHTLSNSTCEEGTPVVVSCI 292          
BLAST of Lysyl oxidase vs. Ensembl Zebrafish
Match: loxl2b (lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144])

HSP 1 Score: 235.343 bits (599), Expect = 1.565e-68
Identity = 151/468 (32.26%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD-CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F      + C   E  GV+C            N   +   +   +S  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  N    ++   RC G E SL+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P       R LLRFSS I N G S+F P    + W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  302 MTGYKKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDNWNLLAATVVCRELGFGSAKEALSGGQL-GQGMGPVHMNEVQCSGFEKSVTECSFNMEKDSEGCSHEEDAGVKC------------NVPAMGFQQRLRLSGGRNPFEGRVE---VLVERNGSLVWGTVCGEGWTTMEAMVVCRQLGLGFASNAFQETWYWPGAVNADAVVMSGVRCAGTEMSLSHCLHHGEYLSCPKGGGRFAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSATPANSP-------RRLLRFSSQIHNNGQSDFRPKISRENWVWHDCHRHYHSMEVFTHYDLLSTNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQIVINPNYEVAESDYTNNIVKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 78.9518 bits (193), Expect = 4.849e-15
Identity = 66/238 (27.73%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V VF    WG++CDD +T+  A VIC++LG  +A+ +   + +   G    + D+V+C G +  +A CE  G G  DC+ +E VGV C       +K  N     N N L I +     +  L S RK   +I + +G V  +  G    +C + +    + V+C  M+G     +    +  +     K +Y  Y +    C G E+ L+ C    + +   CE    + ++CI
Sbjct:   64 EGRVEVFYEGEWGTVCDDDFTIHAAQVICRELGYFEAISWSPSSKY-GKGEGRIWFDNVHCKGKEKSLAQCESNGIGVSDCKHSEDVGVVCSDKRIPGFKFVNTLTN-NINSLNIQVEDVRIRPILASYRK---RIPVTEGYVEVKDGGKWKQICDDEWTQMNSRVIC-GMFGFPGQKRYNTRVYKMFARRRKPSYWDYTI---NCTGKEAHLSSCTLGHTLSNSTCEEGTPVVVSCI 292          
BLAST of Lysyl oxidase vs. Ensembl Zebrafish
Match: loxl2b (lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144])

HSP 1 Score: 235.343 bits (599), Expect = 1.565e-68
Identity = 151/468 (32.26%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD-CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F      + C   E  GV+C            N   +   +   +S  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  N    ++   RC G E SL+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P       R LLRFSS I N G S+F P    + W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  302 MTGYKKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDNWNLLAATVVCRELGFGSAKEALSGGQL-GQGMGPVHMNEVQCSGFEKSVTECSFNMEKDSEGCSHEEDAGVKC------------NVPAMGFQQRLRLSGGRNPFEGRVE---VLVERNGSLVWGTVCGEGWTTMEAMVVCRQLGLGFASNAFQETWYWPGAVNADAVVMSGVRCAGTEMSLSHCLHHGEYLSCPKGGGRFAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSATPANSP-------RRLLRFSSQIHNNGQSDFRPKISRENWVWHDCHRHYHSMEVFTHYDLLSTNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQIVINPNYEVAESDYTNNIVKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 78.9518 bits (193), Expect = 4.849e-15
Identity = 66/238 (27.73%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V VF    WG++CDD +T+  A VIC++LG  +A+ +   + +   G    + D+V+C G +  +A CE  G G  DC+ +E VGV C       +K  N     N N L I +     +  L S RK   +I + +G V  +  G    +C + +    + V+C  M+G     +    +  +     K +Y  Y +    C G E+ L+ C    + +   CE    + ++CI
Sbjct:   64 EGRVEVFYEGEWGTVCDDDFTIHAAQVICRELGYFEAISWSPSSKY-GKGEGRIWFDNVHCKGKEKSLAQCESNGIGVSDCKHSEDVGVVCSDKRIPGFKFVNTLTN-NINSLNIQVEDVRIRPILASYRK---RIPVTEGYVEVKDGGKWKQICDDEWTQMNSRVIC-GMFGFPGQKRYNTRVYKMFARRRKPSYWDYTI---NCTGKEAHLSSCTLGHTLSNSTCEEGTPVVVSCI 292          
BLAST of Lysyl oxidase vs. Ensembl Zebrafish
Match: loxl2b (lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144])

HSP 1 Score: 235.343 bits (599), Expect = 1.565e-68
Identity = 151/468 (32.26%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD-CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F      + C   E  GV+C            N   +   +   +S  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  N    ++   RC G E SL+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P       R LLRFSS I N G S+F P    + W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  302 MTGYKKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDNWNLLAATVVCRELGFGSAKEALSGGQL-GQGMGPVHMNEVQCSGFEKSVTECSFNMEKDSEGCSHEEDAGVKC------------NVPAMGFQQRLRLSGGRNPFEGRVE---VLVERNGSLVWGTVCGEGWTTMEAMVVCRQLGLGFASNAFQETWYWPGAVNADAVVMSGVRCAGTEMSLSHCLHHGEYLSCPKGGGRFAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSATPANSP-------RRLLRFSSQIHNNGQSDFRPKISRENWVWHDCHRHYHSMEVFTHYDLLSTNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQIVINPNYEVAESDYTNNIVKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 78.9518 bits (193), Expect = 4.849e-15
Identity = 66/238 (27.73%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V VF    WG++CDD +T+  A VIC++LG  +A+ +   + +   G    + D+V+C G +  +A CE  G G  DC+ +E VGV C       +K  N     N N L I +     +  L S RK   +I + +G V  +  G    +C + +    + V+C  M+G     +    +  +     K +Y  Y +    C G E+ L+ C    + +   CE    + ++CI
Sbjct:   64 EGRVEVFYEGEWGTVCDDDFTIHAAQVICRELGYFEAISWSPSSKY-GKGEGRIWFDNVHCKGKEKSLAQCESNGIGVSDCKHSEDVGVVCSDKRIPGFKFVNTLTN-NINSLNIQVEDVRIRPILASYRK---RIPVTEGYVEVKDGGKWKQICDDEWTQMNSRVIC-GMFGFPGQKRYNTRVYKMFARRRKPSYWDYTI---NCTGKEAHLSSCTLGHTLSNSTCEEGTPVVVSCI 292          
BLAST of Lysyl oxidase vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 231.491 bits (589), Expect = 3.270e-67
Identity = 152/486 (31.28%), Postives = 231/486 (47.53%), Query Frame = 2
Query:   26 SDMSKLIITLKIFISFALI-FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            SD S  +++     +FA    T + K F + Q       V+L  G +  EG V V     WG+ICDD W +  A+V+C++LG   A +          G+ +  M ++ C G +  +  C+F       C   E   V+C   A   + +V  +  R P      V + +N     L  G V           C + +   E  ++C Q+  G      +      G  N    ++   +C G E SL  C    ++   P    +    ++C+   PD+  + A VE+++Y+E   ++ LQCA  E+CL  S  +     P + +   R LLRFSS I N G ++F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C T+ +  + C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ+IINP   V E++Y NN + C   Y G+   + +C
Sbjct:  244 SDGSPAVVSCTPGRAFAPSPGTGFRKAFRQEQPL-----VRLRGGANTGEGRVEVLKNGEWGTICDDKWNLVTASVVCRELGFGSAKEALAGAQM-GQGMGHIHMSEIQCNGFEKSLIDCKF-NVHSQGCNHEEDAAVRCNVPAMGFENQVRLSGGRHPTEGRVEVLMERNG---TLRWGTV-----------CSDTWGTMEAMIVCRQLGLGFASHAFQETWYWQGDINADDVVMSGVKCSGTEMSLAHCRHDGANINCPRGGGRFAAGVSCVETAPDLVLNAALVEQTTYLEDRPMFMLQCAHEEQCLSSSADRT---SPTTGY---RRLLRFSSQIHNNGQADFRPKTGRHSWIWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECETDVQKQYACANF----GEQGITVGCWDVYRHDIDCQWVDITDVAPGDYFFQVIINPNQEVAESDYTNNIMKCRCRYDGHRIWMYNC 698          

HSP 2 Score: 81.6481 bits (200), Expect = 9.281e-16
Identity = 62/210 (29.52%), Postives = 102/210 (48.57%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSK---YIVRLGRCYGNESSLTQC 769
            EG V V+    WG++CDD ++M  A+++C++LG + AV +   + +   G    ++D+V C G +  IA C   GWG  DC+ +E VGVQC       +KV+N +       +RI   +  L + RK   ++ + +G V  +V G    +C   + +  + V+C    G  G   E    N   F+  +   Y      C GNE+ L+ C
Sbjct:   30 EGRVEVYYEGEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKY-GKGEGRIWLDNVNCNGREKSIASCGSNGWGVTDCKHSEDVGVQCSDRRIPGFKVSN-ELPGQLEEVRI---RAILSAYRK---RVPVTEGFVEVKVQGSWRQVCNAEWSSKNSRVVC----GMFGFPAEKKFNNKVLFSSRRKHTYWQFSANCTGNEAHLSSC 227          
BLAST of Lysyl oxidase vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 231.106 bits (588), Expect = 3.270e-67
Identity = 152/486 (31.28%), Postives = 231/486 (47.53%), Query Frame = 2
Query:   26 SDMSKLIITLKIFISFA-LIFTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            SD S  +++     +FA    T + K F + Q       V+L  G +  EG V V     WG+ICDD W +  A+V+C++LG   A +          G+ +  M ++ C G +  +  C+F       C   E   V+C   A   + +V  +  R P      V + +N     L  G V           C + +   E  ++C Q+  G      +      G  N    ++   +C G E SL  C    ++   P    +    ++C+   PD+  + A VE+++Y+E   ++ LQCA  E+CL  S  +     P + +   R LLRFSS I N G ++F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C T+ +  + C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ+IINP   V E++Y NN + C   Y G+   + +C
Sbjct:  232 SDGSPAVVSCTPGRAFAPSPGTGFRKAFRQEQPL-----VRLRGGANTGEGRVEVLKNGEWGTICDDKWNLVTASVVCRELGFGSAKEALAGAQM-GQGMGHIHMSEIQCNGFEKSLIDCKF-NVHSQGCNHEEDAAVRCNVPAMGFENQVRLSGGRHPTEGRVEVLMERNG---TLRWGTV-----------CSDTWGTMEAMIVCRQLGLGFASHAFQETWYWQGDINADDVVMSGVKCSGTEMSLAHCRHDGANINCPRGGGRFAAGVSCVETAPDLVLNAALVEQTTYLEDRPMFMLQCAHEEQCLSSSADRT---SPTTGY---RRLLRFSSQIHNNGQADFRPKTGRHSWIWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECETDVQKQYACANF----GEQGITVGCWDVYRHDIDCQWVDITDVAPGDYFFQVIINPNQEVAESDYTNNIMKCRCRYDGHRIWMYNC 686          

HSP 2 Score: 83.1889 bits (204), Expect = 3.080e-16
Identity = 64/210 (30.48%), Postives = 102/210 (48.57%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV---QREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            EG V V+    WG++CDD ++M  A+++C++LG + AV +   + +   G    ++D+V C G +  IA C   GWG  DC+ +E VGVQC       +KV+N    Q EV    +RI   +  L + RK   ++ + +G V  +V G    +C   + +  + V+C  M+G         P      N   Y      C GNE+ L+ C
Sbjct:   23 EGRVEVYYEGEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKY-GKGEGRIWLDNVNCNGREKSIASCGSNGWGVTDCKHSEDVGVQCSDRRIPGFKVSNELPGQLEV-IEEVRI---RAILSAYRK---RVPVTEGFVEVKVQGSWRQVCNAEWSSKNSRVVC-GMFG--------FPAEKKFNNKHTYWQFSANCTGNEAHLSSC 215          
BLAST of Lysyl oxidase vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 231.106 bits (588), Expect = 7.000e-67
Identity = 152/486 (31.28%), Postives = 231/486 (47.53%), Query Frame = 2
Query:   26 SDMSKLIITLKIFISFA-LIFTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            SD S  +++     +FA    T + K F + Q       V+L  G +  EG V V     WG+ICDD W +  A+V+C++LG   A +          G+ +  M ++ C G +  +  C+F       C   E   V+C   A   + +V  +  R P      V + +N     L  G V           C + +   E  ++C Q+  G      +      G  N    ++   +C G E SL  C    ++   P    +    ++C+   PD+  + A VE+++Y+E   ++ LQCA  E+CL  S  +     P + +   R LLRFSS I N G ++F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C T+ +  + C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ+IINP   V E++Y NN + C   Y G+   + +C
Sbjct:  276 SDGSPAVVSCTPGRAFAPSPGTGFRKAFRQEQPL-----VRLRGGANTGEGRVEVLKNGEWGTICDDKWNLVTASVVCRELGFGSAKEALAGAQM-GQGMGHIHMSEIQCNGFEKSLIDCKF-NVHSQGCNHEEDAAVRCNVPAMGFENQVRLSGGRHPTEGRVEVLMERNG---TLRWGTV-----------CSDTWGTMEAMIVCRQLGLGFASHAFQETWYWQGDINADDVVMSGVKCSGTEMSLAHCRHDGANINCPRGGGRFAAGVSCVETAPDLVLNAALVEQTTYLEDRPMFMLQCAHEEQCLSSSADRT---SPTTGY---RRLLRFSSQIHNNGQADFRPKTGRHSWIWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECETDVQKQYACANF----GEQGITVGCWDVYRHDIDCQWVDITDVAPGDYFFQVIINPNQEVAESDYTNNIMKCRCRYDGHRIWMYNC 730          

HSP 2 Score: 80.4925 bits (197), Expect = 2.322e-15
Identity = 63/218 (28.90%), Postives = 107/218 (49.08%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV---QRE---VNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            EG V V+    WG++CDD ++M  A+++C++LG + AV +   + +   G    ++D+V C G +  IA C   GWG  DC+ +E VGVQC       +KV+N    Q E   +    +RI   +  L + RK   ++ + +G V  +V G    +C   + +  + V+C  M+G     K    +  +  +  K  Y ++      C GNE+ L+ C
Sbjct:   53 EGRVEVYYEGEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKY-GKGEGRIWLDNVNCNGREKSIASCGSNGWGVTDCKHSEDVGVQCSDRRIPGFKVSNELPGQLEGLNIQVEEVRI---RAILSAYRK---RVPVTEGFVEVKVQGSWRQVCNAEWSSKNSRVVC-GMFGFPAEKKFNNKVYKLFSSRRKHTYWQFSA---NCTGNEAHLSSC 259          
BLAST of Lysyl oxidase vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 231.106 bits (588), Expect = 7.747e-67
Identity = 152/486 (31.28%), Postives = 231/486 (47.53%), Query Frame = 2
Query:   26 SDMSKLIITLKIFISFALI-FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            SD S  +++     +FA    T + K F + Q       V+L  G +  EG V V     WG+ICDD W +  A+V+C++LG   A +          G+ +  M ++ C G +  +  C+F       C   E   V+C   A   + +V  +  R P      V + +N     L  G V           C + +   E  ++C Q+  G      +      G  N    ++   +C G E SL  C    ++   P    +    ++C+   PD+  + A VE+++Y+E   ++ LQCA  E+CL  S  +     P + +   R LLRFSS I N G ++F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C T+ +  + C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ+IINP   V E++Y NN + C   Y G+   + +C
Sbjct:  292 SDGSPAVVSCTPGRAFAPSPGTGFRKAFRQEQPL-----VRLRGGANTGEGRVEVLKNGEWGTICDDKWNLVTASVVCRELGFGSAKEALAGAQM-GQGMGHIHMSEIQCNGFEKSLIDCKF-NVHSQGCNHEEDAAVRCNVPAMGFENQVRLSGGRHPTEGRVEVLMERNG---TLRWGTV-----------CSDTWGTMEAMIVCRQLGLGFASHAFQETWYWQGDINADDVVMSGVKCSGTEMSLAHCRHDGANINCPRGGGRFAAGVSCVETAPDLVLNAALVEQTTYLEDRPMFMLQCAHEEQCLSSSADRT---SPTTGY---RRLLRFSSQIHNNGQADFRPKTGRHSWIWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECETDVQKQYACANF----GEQGITVGCWDVYRHDIDCQWVDITDVAPGDYFFQVIINPNQEVAESDYTNNIMKCRCRYDGHRIWMYNC 746          

HSP 2 Score: 80.8777 bits (198), Expect = 1.716e-15
Identity = 63/218 (28.90%), Postives = 107/218 (49.08%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV---QRE---VNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            EG V V+    WG++CDD ++M  A+++C++LG + AV +   + +   G    ++D+V C G +  IA C   GWG  DC+ +E VGVQC       +KV+N    Q E   +    +RI   +  L + RK   ++ + +G V  +V G    +C   + +  + V+C  M+G     K    +  +  +  K  Y ++      C GNE+ L+ C
Sbjct:   69 EGRVEVYYEGEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKY-GKGEGRIWLDNVNCNGREKSIASCGSNGWGVTDCKHSEDVGVQCSDRRIPGFKVSNELPGQLEGLNIQVEEVRI---RAILSAYRK---RVPVTEGFVEVKVQGSWRQVCNAEWSSKNSRVVC-GMFGFPAEKKFNNKVYKLFSSRRKHTYWQFSA---NCTGNEAHLSSC 275          
BLAST of Lysyl oxidase vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 231.106 bits (588), Expect = 8.774e-67
Identity = 152/486 (31.28%), Postives = 231/486 (47.53%), Query Frame = 2
Query:   26 SDMSKLIITLKIFISFALI-FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            SD S  +++     +FA    T + K F + Q       V+L  G +  EG V V     WG+ICDD W +  A+V+C++LG   A +          G+ +  M ++ C G +  +  C+F       C   E   V+C   A   + +V  +  R P      V + +N     L  G V           C + +   E  ++C Q+  G      +      G  N    ++   +C G E SL  C    ++   P    +    ++C+   PD+  + A VE+++Y+E   ++ LQCA  E+CL  S  +     P + +   R LLRFSS I N G ++F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C T+ +  + C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ+IINP   V E++Y NN + C   Y G+   + +C
Sbjct:  295 SDGSPAVVSCTPGRAFAPSPGTGFRKAFRQEQPL-----VRLRGGANTGEGRVEVLKNGEWGTICDDKWNLVTASVVCRELGFGSAKEALAGAQM-GQGMGHIHMSEIQCNGFEKSLIDCKF-NVHSQGCNHEEDAAVRCNVPAMGFENQVRLSGGRHPTEGRVEVLMERNG---TLRWGTV-----------CSDTWGTMEAMIVCRQLGLGFASHAFQETWYWQGDINADDVVMSGVKCSGTEMSLAHCRHDGANINCPRGGGRFAAGVSCVETAPDLVLNAALVEQTTYLEDRPMFMLQCAHEEQCLSSSADRT---SPTTGY---RRLLRFSSQIHNNGQADFRPKTGRHSWIWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECETDVQKQYACANF----GEQGITVGCWDVYRHDIDCQWVDITDVAPGDYFFQVIINPNQEVAESDYTNNIMKCRCRYDGHRIWMYNC 749          

HSP 2 Score: 80.8777 bits (198), Expect = 1.878e-15
Identity = 63/218 (28.90%), Postives = 107/218 (49.08%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV---QRE---VNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            EG V V+    WG++CDD ++M  A+++C++LG + AV +   + +   G    ++D+V C G +  IA C   GWG  DC+ +E VGVQC       +KV+N    Q E   +    +RI   +  L + RK   ++ + +G V  +V G    +C   + +  + V+C  M+G     K    +  +  +  K  Y ++      C GNE+ L+ C
Sbjct:   72 EGRVEVYYEGEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKY-GKGEGRIWLDNVNCNGREKSIASCGSNGWGVTDCKHSEDVGVQCSDRRIPGFKVSNELPGQLEGLNIQVEEVRI---RAILSAYRK---RVPVTEGFVEVKVQGSWRQVCNAEWSSKNSRVVC-GMFGFPAEKKFNNKVYKLFSSRRKHTYWQFSA---NCTGNEAHLSSC 278          
BLAST of Lysyl oxidase vs. Ensembl Mouse
Match: Loxl2 (lysyl oxidase-like 2 [Source:MGI Symbol;Acc:MGI:2137913])

HSP 1 Score: 223.787 bits (569), Expect = 2.888e-64
Identity = 145/451 (32.15%), Postives = 215/451 (47.67%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM---IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG+ICDD W +  A+V+C++LG   A +    +     GI    +++V C G +  I  C+F       C   E  GV+C   +   Q++V  N  R             N ++  +E   VL+E +G  +   +C  N+   E  V+C Q+  G      +      G    +  ++   +C G E SL  C        V C    +     + C    PD+  +   V++++Y+E   +  LQCA+ E CL  S         H      R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C  + +  ++C N     G QGI+ GC D Y H+ DCQW+D++++ PG Y FQ++INP + V E+++ NN + C   Y GY   + +C
Sbjct:  329 VRLRGGAQVGEGRVEVLKNGEWGTICDDKWDLVSASVVCRELGFGTAKEAITGSRL-GQGIGPIHLNEVQCTGTEKSIIDCKF-NTESQGCNHEEDAGVRCNIPIMGFQKKVRLNGGR-------------NPYEGRVE---VLTERNGSLVWGTVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGNIFANNVVMSGVKCSGTELSLAHC---RHDEEVACPEGGVRFGAGVACSETAPDLVLNAEIVQQTAYLEDRPMSLLQCAMEENCLSASAVHTDPTRGH------RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKASFCLEDTECEGDIQKSYECANF----GEQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINPNYEVPESDFSNNIMKCRSRYDGYRIWMYNC 748          

HSP 2 Score: 70.0922 bits (170), Expect = 3.330e-12
Identity = 33/91 (36.26%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            EG V V+    WG++CDD +++  A+V+C+Q+G  +A  +   + +   G    ++D++YC G +S +A C   GWG  DC+  E VGV C
Sbjct:   72 EGRVEVYYEGQWGTVCDDDFSIHAAHVVCRQVGYVEAKSWAASSSY-GPGEGPIWLDNIYCTGKESTLASCSSNGWGVTDCKHTEDVGVVC 161          

HSP 3 Score: 51.2174 bits (121), Expect = 3.107e-6
Identity = 51/228 (22.37%), Postives = 84/228 (36.84%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNY--FQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD------CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHIN 829
            EG V V  G  W  IC+ HWT   ++V+C   G      +  K Y  F S     Y+   + C G ++ I+ C+       D      C + +   V C        +      +   P++ LV LR  +    + +G V    +G    +C + +     +V+C ++    G   E I  +          +   +C G E S+  C     S G   E D  +  N
Sbjct:  206 EGYVEVKEGKAWKQICNKHWTAKNSHVVCGMFGFPAEKTYNPKAYKTFASRRKLRYWKFSMNCTGTEAHISSCKLGPSVTRDPVKNATCENGQPAVVSCVPSQIFSPDGPSRFRKAYKPEQPLVRLRGGA---QVGEGRVEVLKNGEWGTICDDKWDLVSASVVCREL--GFGTAKEAITGSRLGQGIGPIHLNEVQCTGTEKSIIDCKFNTESQGCNHEEDAGVRCN 428          
BLAST of Lysyl oxidase vs. Ensembl Mouse
Match: Loxl2 (lysyl oxidase-like 2 [Source:MGI Symbol;Acc:MGI:2137913])

HSP 1 Score: 223.787 bits (569), Expect = 2.888e-64
Identity = 145/451 (32.15%), Postives = 215/451 (47.67%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM---IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG+ICDD W +  A+V+C++LG   A +    +     GI    +++V C G +  I  C+F       C   E  GV+C   +   Q++V  N  R             N ++  +E   VL+E +G  +   +C  N+   E  V+C Q+  G      +      G    +  ++   +C G E SL  C        V C    +     + C    PD+  +   V++++Y+E   +  LQCA+ E CL  S         H      R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C  + +  ++C N     G QGI+ GC D Y H+ DCQW+D++++ PG Y FQ++INP + V E+++ NN + C   Y GY   + +C
Sbjct:  329 VRLRGGAQVGEGRVEVLKNGEWGTICDDKWDLVSASVVCRELGFGTAKEAITGSRL-GQGIGPIHLNEVQCTGTEKSIIDCKF-NTESQGCNHEEDAGVRCNIPIMGFQKKVRLNGGR-------------NPYEGRVE---VLTERNGSLVWGTVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGNIFANNVVMSGVKCSGTELSLAHC---RHDEEVACPEGGVRFGAGVACSETAPDLVLNAEIVQQTAYLEDRPMSLLQCAMEENCLSASAVHTDPTRGH------RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKASFCLEDTECEGDIQKSYECANF----GEQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINPNYEVPESDFSNNIMKCRSRYDGYRIWMYNC 748          

HSP 2 Score: 70.0922 bits (170), Expect = 3.330e-12
Identity = 33/91 (36.26%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            EG V V+    WG++CDD +++  A+V+C+Q+G  +A  +   + +   G    ++D++YC G +S +A C   GWG  DC+  E VGV C
Sbjct:   72 EGRVEVYYEGQWGTVCDDDFSIHAAHVVCRQVGYVEAKSWAASSSY-GPGEGPIWLDNIYCTGKESTLASCSSNGWGVTDCKHTEDVGVVC 161          

HSP 3 Score: 51.2174 bits (121), Expect = 3.107e-6
Identity = 51/228 (22.37%), Postives = 84/228 (36.84%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNY--FQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD------CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHIN 829
            EG V V  G  W  IC+ HWT   ++V+C   G      +  K Y  F S     Y+   + C G ++ I+ C+       D      C + +   V C        +      +   P++ LV LR  +    + +G V    +G    +C + +     +V+C ++    G   E I  +          +   +C G E S+  C     S G   E D  +  N
Sbjct:  206 EGYVEVKEGKAWKQICNKHWTAKNSHVVCGMFGFPAEKTYNPKAYKTFASRRKLRYWKFSMNCTGTEAHISSCKLGPSVTRDPVKNATCENGQPAVVSCVPSQIFSPDGPSRFRKAYKPEQPLVRLRGGA---QVGEGRVEVLKNGEWGTICDDKWDLVSASVVCREL--GFGTAKEAITGSRLGQGIGPIHLNEVQCTGTEKSIIDCKFNTESQGCNHEEDAGVRCN 428          
BLAST of Lysyl oxidase vs. Ensembl Mouse
Match: Loxl3 (lysyl oxidase-like 3 [Source:MGI Symbol;Acc:MGI:1337004])

HSP 1 Score: 215.312 bits (547), Expect = 2.973e-61
Identity = 140/459 (30.50%), Postives = 217/459 (47.28%), Query Frame = 2
Query:  119 KKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPL-CPNNFKATENNVLCHQMYGKLG----GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM---IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            K   +  V+L  G    EG V V     WG++CD  W +  A+V+C++LG   A +          G+    + +V C G +  +  C        DC  ++  GV+C            N     +  +  +S  ++ ++  +E  V +     +R+ L C +++   E  V C Q+   LG    G  E    ++G  N ++ ++   RC G+E SL QC  ++S   + C+         + C     D+    A V+ ++Y+E   +  L CA  E CL  S       + H      R LLRFSS I N+G ++F P      W WH CH HYHSM +F  Y+I+      VA GHKASFCLED  C  +    ++C N     G QGI+ GC D Y H+ DCQW+D++++ PG Y  Q++INP F V E+++ NN + C   Y G+   + +C
Sbjct:  301 KPQGEARVRLKGGAHQGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGTAREALSGARM-GQGMGAIHLSEVRCSGQEPSLWRCPSKNITAEDCSHSQDAGVRC------------NLPYTGVETKIRLSGGRSRYEGRVE--VQIGIPGHLRWGLICGDDWGTLEAMVACRQL--GLGYANHGLQETWYWDSG--NVTEVVMSGVRCTGSELSLNQCAHHSSH--ITCKKTGTRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGH------RRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANF----GEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNC 728          

HSP 2 Score: 67.781 bits (164), Expect = 1.699e-11
Identity = 44/141 (31.21%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV--------QREVNWNPL----RIPLP-KESLVSLR 526
            P EG V +     WG+ICDD +T+  A+V+C++LG  +A  +     +   G    ++D++ C G +  +  C   GWG  DC  +E  GV C       +  +NV          EV   P     R PLP  E LV +R
Sbjct:   54 PYEGRVEIQRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKY-GPGTGRIWLDNLSCRGTEGSVTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVEHQLQVEEVRLRPAVEWGRRPLPVTEGLVEVR 193          
BLAST of Lysyl oxidase vs. Ensembl Mouse
Match: Loxl4 (lysyl oxidase-like 4 [Source:MGI Symbol;Acc:MGI:1914823])

HSP 1 Score: 205.297 bits (521), Expect = 1.316e-57
Identity = 132/447 (29.53%), Postives = 210/447 (46.98%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLED--GVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V +   WG++CD  W +  A+V+C+QLG   A +          G+    + +V C G +  +  C      ++ C+      V+C    N+      N +R+   + S   + +   ++      G V           C +++  TE  V C Q+  G     ++      G     + ++   RC G E +L QC  +   +           + C++  PD+  +   V+ ++Y+E   +  L CA  E CL  S   +    P+ Y    R LLRFSS I N+G ++F P      W WH CH HYHS+++F  Y+++    + VA GHKASFCLED  C +  +  + C N     G QG++ GC DTY H+ DCQWVD++++ PG Y FQ+++NP   V E+++ NN + C   Y G    L +C
Sbjct:  313 VRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREALFGAQL-GQGLGPIHLSEVRCRGYERTLGDCLALEGSQNGCQHANDAAVRC----NIPDMGFQNKVRLAGGRNSEEGVVEVQVEVNGVPRWGTV-----------CSDHWGLTEAMVTCRQLGLGFANFALKDTWYWQGTPEAKEVVMSGVRCSGTEMALQQCQRHGPVHCSHGPGRFSAGVACMNSAPDLVMNAQLVQETAYLEDRPLSMLYCAHEENCLSKSADHMD--WPYGY----RRLLRFSSQIYNLGRADFRPKAGRHSWIWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPSGVQRRYACANF----GEQGVAVGCWDTYRHDIDCQWVDITDVGPGDYIFQVVVNPTNDVAESDFSNNMIRCRCKYDGQRVWLHNC 733          

HSP 2 Score: 77.411 bits (189), Expect = 1.857e-14
Identity = 52/170 (30.59%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQF-YKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCY----------KVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLC 640
            P+EG + V     WG++CDD + + EA V C+QLG E A+ + +   Y Q  G    ++D+V C G +  +  C   GWG  DCR +E VGV C+          KV+N           + L K  L S +++S    + +G V    DG    +C   +    + V+C
Sbjct:   42 PEEGRLEVLHQGQWGTVCDDDFALQEATVACRQLGFESALTWAHSAKYGQGEGP--IWLDNVRCLGTEKTLDQCGSNGWGVSDCRHSEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRL-KPILASAKRHS---PVTEGAVEVRYDGHWRQVCDQGWTMNNSRVVC 205          
BLAST of Lysyl oxidase vs. Ensembl Mouse
Match: Loxl4 (lysyl oxidase-like 4 [Source:MGI Symbol;Acc:MGI:1914823])

HSP 1 Score: 205.297 bits (521), Expect = 1.327e-57
Identity = 132/447 (29.53%), Postives = 210/447 (46.98%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLED--GVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V +   WG++CD  W +  A+V+C+QLG   A +          G+    + +V C G +  +  C      ++ C+      V+C    N+      N +R+   + S   + +   ++      G V           C +++  TE  V C Q+  G     ++      G     + ++   RC G E +L QC  +   +           + C++  PD+  +   V+ ++Y+E   +  L CA  E CL  S   +    P+ Y    R LLRFSS I N+G ++F P      W WH CH HYHS+++F  Y+++    + VA GHKASFCLED  C +  +  + C N     G QG++ GC DTY H+ DCQWVD++++ PG Y FQ+++NP   V E+++ NN + C   Y G    L +C
Sbjct:  312 VRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREALFGAQL-GQGLGPIHLSEVRCRGYERTLGDCLALEGSQNGCQHANDAAVRC----NIPDMGFQNKVRLAGGRNSEEGVVEVQVEVNGVPRWGTV-----------CSDHWGLTEAMVTCRQLGLGFANFALKDTWYWQGTPEAKEVVMSGVRCSGTEMALQQCQRHGPVHCSHGPGRFSAGVACMNSAPDLVMNAQLVQETAYLEDRPLSMLYCAHEENCLSKSADHMD--WPYGY----RRLLRFSSQIYNLGRADFRPKAGRHSWIWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPSGVQRRYACANF----GEQGVAVGCWDTYRHDIDCQWVDITDVGPGDYIFQVVVNPTNDVAESDFSNNMIRCRCKYDGQRVWLHNC 732          

HSP 2 Score: 77.411 bits (189), Expect = 1.823e-14
Identity = 52/170 (30.59%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  164 PKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQF-YKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCY----------KVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLC 640
            P+EG + V     WG++CDD + + EA V C+QLG E A+ + +   Y Q  G    ++D+V C G +  +  C   GWG  DCR +E VGV C+          KV+N           + L K  L S +++S    + +G V    DG    +C   +    + V+C
Sbjct:   42 PEEGRLEVLHQGQWGTVCDDDFALQEATVACRQLGFESALTWAHSAKYGQGEGP--IWLDNVRCLGTEKTLDQCGSNGWGVSDCRHSEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRL-KPILASAKRHS---PVTEGAVEVRYDGHWRQVCDQGWTMNNSRVVC 205          

HSP 3 Score: 49.6766 bits (117), Expect = 9.457e-6
Identity = 60/255 (23.53%), Postives = 93/255 (36.47%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAV----QFYK----------KNYFQSSGIKNYF-MDDVYCFGNKSRIAYCEF---PGWGK--HDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSE------VDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTY-ASSNGVPCESDKMIHINCISDLPDI 853
            EG V V     W  +CD  WTM  + V+C  LG          +Y+          K+   S   KN F +  V C G +  +A C+    PG GK    C       V C    + +R+          PK +         K+ L  G  + E      ++     +C + +     +V+C Q+ G       L     G+     ++  + RC G E +L  CL    S NG    +D  +  N    +PD+
Sbjct:  177 EGAVEVRYDGHWRQVCDQGWTMNNSRVVCGMLGFPSQTSVNSHYYRKVWNLKMKDPKSRLNSLTKKNSFWIHRVDCLGTEPHLAKCQVQVAPGRGKLRPACPGGMHAVVSCVAGPHFRRQK---------PKPTRKESHAEELKVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQL-GFGSAREALFGAQLGQGLGPIHLSEV-RCRGYERTLGDCLALEGSQNGCQHANDAAVRCN----IPDM 416          
BLAST of Lysyl oxidase vs. UniProt/SwissProt
Match: sp|F1QQC3|LOL2A_DANRE (Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 3.547e-69
Identity = 151/448 (33.71%), Postives = 218/448 (48.66%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G +  EG V V     WG++CDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F       C   E   V+C            N   +   K   +S  +N F+  +E   VL+E +G  +   +C  N+   E  V+C Q+  G      +      G  N    ++   RC G E SL QCL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCAL E CL  +  K    + HS +   R LLRFSS I N+G S+F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C       + C N     G QGI+ GC DTY H+ DCQW+D++++ PG Y FQ++INP + V E++Y NN + C   Y GY     SC
Sbjct:  294 VRLRGGANVGEGRVEVLKNGVWGTVCDDNWNLKAATVVCRELGFGSAKEALTGAKL-GQGMGPVHMNEVECSGFEKSLTDCYFNN-DALGCSHEEDAAVRC------------NVPAMGFQKRIRLSGGRNPFEGRVE---VLAEKNGSLVWGTVCSENWGIIEAMVVCRQLGLGFASHAFQETWYWAGDANADNVVMSGVRCSGTEMSLPQCLHHGKHINCPKGGGRFAAGVSCSDTAPDLVLNAQLVEQTTYLEDRPMYALQCALEENCLSSTARK----NDHSSY---RRLLRFSSQIHNVGQSDFRPKLGYHAWTWHECHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDTHCDEGISKRYHCANF----GEQGITVGCWDTYRHDIDCQWIDVTDVKPGDYIFQVVINPNYDVAESDYTNNVMKCKCRYDGYRIWTYSC 713          

HSP 2 Score: 73.9442 bits (180), Expect = 1.463e-12
Identity = 65/235 (27.66%), Postives = 105/235 (44.68%), Query Frame = 2
Query:  110 ELQKKLVDGDVKLVDGGSPK---EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLRKNSF-----KIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLG------GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            + Q +L    ++L   G  +   EG + VF    WG++CDD +++  A+V C+QLG   AV +     F   G    ++D+V+C G ++ +A C   G+G  DCR +E VGV C  K     R +N     +   +E +  +R         +I + +G V  +  G    +C   +    + V C  MYG  G           + M   K NY  + V    C GNE+ ++ C
Sbjct:   17 QAQSELQQPKIELRLAGDKRKHYEGRLEVFYNNEWGTVCDDDFSIEAAHVACRQLGFLGAVAWSPSAKF-GQGEGRIWLDNVHCTGRENSLAACPSNGFGVSDCRHSEDVGVICNQKRIPGHRFINIMNNNVETLEERVEEIRIRPISSHLKRIPITEGYVEVKERGKWRQICDEEWTPLNSRVAC-GMYGFPGEKNYNNKVYRSLSMRKKK-NYWGFSV---NCTGNEAHVSSC 245          
BLAST of Lysyl oxidase vs. UniProt/SwissProt
Match: sp|A1L1V4|LOL2B_DANRE (Lysyl oxidase homolog 2B OS=Danio rerio OX=7955 GN=loxl2b PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.181e-67
Identity = 151/468 (32.26%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD-CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD+W +  A V+C++LG   A +          G+    M++V C G +  +  C F      + C   E  GV+C            N   +   +   +S  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  N    ++   RC G E SL+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P       R LLRFSS I N G S+F P    + W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  302 MTGYKKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDNWNLLAATVVCRELGFGSAKEALSGGQL-GQGMGPVHMNEVQCSGFEKSVTECSFNMEKDSEGCSHEEDAGVKC------------NVPAMGFQQRLRLSGGRNPFEGRVE---VLVERNGSLVWGTVCGEGWTTMEAMVVCRQLGLGFASNAFQETWYWPGAVNADAVVMSGVRCAGTEMSLSHCLHHGEYLSCPKGGGRFAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSATPANSP-------RRLLRFSSQIHNNGQSDFRPKISRENWVWHDCHRHYHSMEVFTHYDLLSTNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQIVINPNYEVAESDYTNNIVKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 78.9518 bits (193), Expect = 3.661e-14
Identity = 66/238 (27.73%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V VF    WG++CDD +T+  A VIC++LG  +A+ +   + +   G    + D+V+C G +  +A CE  G G  DC+ +E VGV C       +K  N     N N L I +     +  L S RK   +I + +G V  +  G    +C + +    + V+C  M+G     +    +  +     K +Y  Y +    C G E+ L+ C    + +   CE    + ++CI
Sbjct:   64 EGRVEVFYEGEWGTVCDDDFTIHAAQVICRELGYFEAISWSPSSKY-GKGEGRIWFDNVHCKGKEKSLAQCESNGIGVSDCKHSEDVGVVCSDKRIPGFKFVNTLTN-NINSLNIQVEDVRIRPILASYRK---RIPVTEGYVEVKDGGKWKQICDDEWTQMNSRVIC-GMFGFPGQKRYNTRVYKMFARRRKPSYWDYTI---NCTGKEAHLSSCTLGHTLSNSTCEEGTPVVVSCI 292          
BLAST of Lysyl oxidase vs. UniProt/SwissProt
Match: sp|Q9Y4K0|LOXL2_HUMAN (Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.720e-67
Identity = 148/449 (32.96%), Postives = 222/449 (49.44%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH---INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG++CDD W +  A+V+C++LG   A +    +     GI    ++++ C GN+  I  C+F       C   E  GV+C   A  +Q+++  N  R P      V + +N            S V G+   +C  N+   E  V+C Q+  G      +      G  N +K ++   +C G E SL  C        V C    + +   + C    PD+  +   V++++Y+E   ++ LQCA+ E CL  S  +     P + +   R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y++++     VA GHKASFCLED  C  + +  ++C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ++INP F V E++Y NN + C   Y G+   + +C
Sbjct:  326 VRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSRL-GQGIGPIHLNEIQCTGNEKSIIDCKFNA-ESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNG-----------SLVWGM---VCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHC--RHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQT---DPTTGY---RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANF----GDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNC 746          

HSP 2 Score: 69.707 bits (169), Expect = 3.101e-11
Identity = 58/240 (24.17%), Postives = 110/240 (45.83%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVAN--VQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGG---TIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDI 853
            EG V V+    WG++CDD +++  A+V+C++LG  +A  +   + +   G    ++D+++C GN++ +A C   GWG  DC+  E VGV C       +K  N  + +  N N     +   +++S  +    +M  +G V  +       +C  ++ A  + V+C  M+G  G      ++  M   +     +   +  C G E+ ++ C       G     D M ++ C + LP +
Sbjct:   69 EGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSY-GKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVM--EGYVEVKEGKTWKQICDKHWTAKNSRVVC-GMFGFPGERTYNTKVYKMFASRRKQRYWPFSM-DCTGTEAHISSCKL-----GPQVSLDPMKNVTCENGLPAV 298          
BLAST of Lysyl oxidase vs. UniProt/SwissProt
Match: sp|Q5RFQ6|LOXL2_PONAB (Lysyl oxidase homolog 2 OS=Pongo abelii OX=9601 GN=LOXL2 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.138e-67
Identity = 148/449 (32.96%), Postives = 223/449 (49.67%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH---INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG++CDD W +  A+V+C++LG   A +    +     GI    ++++ C GN+  I  C+F       C   E  GV+C   A  +Q+++  N  R P      V + +N            S V G+   +C  N+   E  V+C Q+  G      +      G  N +K ++   +C G E SL  C        V C    + +   + C    PD+  +   V++++Y+E   ++ LQCA+ E CL  S  +    +P + +   R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y++++     VA GHKASFCLED  C  + +  ++C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ++INP F V E++Y NN + C   Y G+   + +C
Sbjct:  326 VRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSRL-GQGIGPIHLNEIQCTGNEKSIIDCKF-NTESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNG-----------SLVWGM---VCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHC--RHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQT---NPTTGY---RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANF----GDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNC 746          

HSP 2 Score: 69.3218 bits (168), Expect = 4.833e-11
Identity = 32/91 (35.16%), Postives = 55/91 (60.44%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            EG V V+    WG++CDD +++  A+V+C++LG  +A  +   + +   G    ++D+++C GN++ +A C   GWG  DC+  E VGV C
Sbjct:   69 EGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSY-GKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVC 158          

HSP 3 Score: 52.7582 bits (125), Expect = 7.387e-6
Identity = 53/228 (23.25%), Postives = 85/228 (37.28%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNY--FQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHD------CRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHIN 829
            EG V V  G  W  ICD HWT   + VIC   G      +  K Y  F S   + Y+   + C G ++ I+ C+       D      C +     V C        +      +   P++ LV LR  ++   + +G V    +G    +C + +     +V+C ++    G   E +  +          +   +C GNE S+  C     S G   E D  +  N
Sbjct:  203 EGYVEVKEGKTWKQICDKHWTAKNSRVICGMFGFPGERTYNAKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAY---IGEGRVEVLKNGEWGTVCDDKWDLVSASVVCREL--GFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNTESQGCNHEEDAGVRCN 425          
BLAST of Lysyl oxidase vs. UniProt/SwissProt
Match: sp|A6H737|LOXL2_BOVIN (Lysyl oxidase homolog 2 OS=Bos taurus OX=9913 GN=LOXL2 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.171e-66
Identity = 146/447 (32.66%), Postives = 220/447 (49.22%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKM-IHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G +  EG V V     WG++CDD W +  A+V+C++LG   A +    +     GI    ++++ C GN+  I  C+F       C   E   V+C   A   Q+++  N  R P      V + +N            S V G+   +C  N+   E  V+C Q+  G      +      G  N +K ++   +C G E SL  C         P    +    + C    PD+  +   V++S+Y+E   ++ LQCA+ E CL  S  +    +P + +   R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y++++     VA GHKASFCLED  C  + +  ++C N     G QGI+ GC D Y H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  326 VRLRGGANVGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAITGSRL-GQGIGPIHLNEIECTGNEKSIIDCKFNA-ESQGCNHEEDAAVRCNIPAMGFQKKLRLNGGRNPYEGRVEVLVERNG-----------SLVWGM---VCGENWGIVEAMVVCRQLGLGFASNAFQETWYWHGNINANKVVMSGVKCSGTELSLAHCRHDGEDVACPEGGVRYGAGVACSETAPDLVLNAEIVQQSTYLEDRPMFMLQCAMEENCLSASAAQT---NPTTGY---RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKSYECANF----GEQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNYEVAESDYTNNIMKCRTRYDGHRIWMYNC 746          

HSP 2 Score: 71.633 bits (174), Expect = 8.324e-12
Identity = 34/91 (37.36%), Postives = 55/91 (60.44%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            EG V V+    WG++CDD +T+  A+V+C++LG  +A  +   + +   G    ++D+VYC G+++ +A C   GWG  DC+  E VGV C
Sbjct:   69 EGRVEVYYDGQWGTVCDDDFTIHAAHVVCRELGYVEAKSWTASSSY-GKGEGPIWLDNVYCTGSEATLAACSSNGWGVTDCKHTEDVGVVC 158          
BLAST of Lysyl oxidase vs. TrEMBL
Match: A0A183A5L7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2252 PE=4 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 4.011e-172
Identity = 236/494 (47.77%), Postives = 333/494 (67.41%), Query Frame = 2
Query:   50 TLKIFISFALIFTRYSKGFN-ELQKKL-VDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGV------------VLSEVD-GIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
             L +F SF    + +S G+   L K+   DGD+KLVDG +P  GTVLVF GYGWG ICDDHWTM EA V+C+QLGM  A++ +++N + S+   +Y MD+V+C G + R+  C F GWG HDC+ NE+VGV+C   A V+    WNPL + L +  L  L K    ++    +            VL E+D G +  +CP++F+  E  V C Q+    GG +  +P +    + +  +  +G CYGNE++++QC TYAS  GVPC+S+    + C+ DLPD+  D   +E SSY++R+++W L+CAL E CLPD++Y+II+ +P +Y W+TRTLLRFSSIIEN+GT+ F PLE+ + WEWH CH+HYHSMK+F+ YE++D    +V+ G KASFCLEDN+C     P F+C N + +KGTQGI+PGC+D YLH+YDCQWVD++++ PG YTFQ+  NP F V E+NYFNN L+C L +MG++A+LRSC + HP
Sbjct:    4 ALVLFASFIFALS-WSNGWTLSLDKQTHRDGDLKLVDGPAPTMGTVLVFRGYGWGRICDDHWTMREAQVVCRQLGMGHALEAHRRNRYASNIGGSYLMDEVHCTGREERLIDCRFSGWGVHDCKHNEEVGVKCSYEAPVKLRPAWNPLSLELSQADLEKLSKVGVNLVRPRNLPQRTDAIASFYPVLVELDDGTKGSVCPDHFRGAEAIVYCKQIGAGNGGRVIPMPQHHTGVSRNTSVAIIGFCYGNETNVSQCKTYASPEGVPCKSNLAAAVECVKDLPDLVPDRYSLESSSYLQRMSLWLLECALEENCLPDTVYQIIDRNPGNYAWMTRTLLRFSSIIENVGTAAFKPLEEPENWEWHACHMHYHSMKVFSRYEVVDTDLRLVSVGLKASFCLEDNVCQAGVTPVFRCSNVIDSKGTQGITPGCRDMYLHDYDCQWVDITDVAPGKYTFQVSFNPDFLVPESNYFNNALTCELTHMGHHAVLRSCRYAHP 496          
BLAST of Lysyl oxidase vs. TrEMBL
Match: A0A4E0RIM4 (Lysyl oxidase OS=Fasciola hepatica OX=6192 GN=D915_003347 PE=4 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 1.923e-171
Identity = 230/494 (46.56%), Postives = 337/494 (68.22%), Query Frame = 2
Query:   41 LIITLKIFISFALIFTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIM------LEDGV-----VLSEV-DGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
            L + L + + F+ ++    +  +  ++   DGD+KL+DG +P  GTVLV+ GYGWG ICDDHW+M EA V+C+QLGM  A++ +++N + S  + +Y MD+V+C G + R+  C+F GWG HDC+ NE+VGV+C   A V+ +  WNPL++ L +  L  + K   +++        DG+     VL E+ DG +  +C ++FK  E  V C Q+    GG    +P +    + +  I  +G CYGNE+S++ C TYA SNGV C+S+    + C+ DLPD+  D   +E SSYM+R+++W L+CAL E CLPD++Y+II+ +P +Y W+TRTLLRFSS+IENIGT+ F PLE+ + WEWH CH+HYHSMK+F+ YE++D +  +V+ G KASFCLEDN+C +   P ++C N + +KGTQGI+PGC+D YLH+YDCQWVD++++ PG YTFQ+  NP F V E+NYFNN L C L +MG++A+LRSC + HP
Sbjct:    3 LRLVLPVIVCFSHLWLS-GRAVSLDKRSHQDGDLKLIDGPAPTMGTVLVYRGYGWGRICDDHWSMREAQVVCRQLGMGHALEAHRRNRYASKVVGSYLMDEVHCTGREERLVDCQFLGWGVHDCKQNEEVGVKCSYEAPVKLKPAWNPLQLELNQTVLEKMAKVGVELVHPKHLPQRDGIPSFYPVLVELEDGTQGSVCADHFKGAEAIVYCRQIGAGNGGRTIPMPQHHTGVDRNSSIAIVGFCYGNETSVSDCKTYADSNGVLCKSNMAAAVECVQDLPDLVPDPYSLESSSYMQRMSLWLLECALEENCLPDTVYQIIDRNPGNYAWMTRTLLRFSSVIENIGTAAFKPLEEPENWEWHACHMHYHSMKVFSRYEVVDPEQRLVSVGLKASFCLEDNICQSGVTPVYRCSNVIDSKGTQGITPGCRDMYLHDYDCQWVDITDVAPGKYTFQVSFNPDFLVAESNYFNNALVCELTHMGHHAVLRSCRYSHP 495          
BLAST of Lysyl oxidase vs. TrEMBL
Match: A0A4Z2CUN6 (Lysyl oxidase-like protein 3A isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007442 PE=4 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 1.774e-170
Identity = 222/462 (48.05%), Postives = 318/462 (68.83%), Query Frame = 2
Query:  131 DGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLED-----------GVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDH 1483
            DGD+KLVDG + + GTVLV+  YGWG +CDDHWTM EANV+C+QLGM +A++ +++N F SS   NY MD+V+C G++ R+  C F GWGKHDCR NE+ GV+C + A +  + +WNPLR+ L +  L  + K  FK++ +             V++   +G +  +C ++F +TE  V CHQ+    GG +  +P+     N +  I  +G CYGNE+SL QC +Y   NG+ C++     + C  +LPD+  D   +E S+Y++++++W L+CAL E CLPD +Y+II+ +P++Y W+TRTL+RFSSIIEN+G   F PLE  D WEWH CH+HYHSMK+F+ YE++D +  +VA GHK+SFCLEDNLC +   P F+C N + +KGTQGISPGC+D YLH+YDCQWVD+++I PG Y FQ+  NP F V E+N+FNN L+C + ++GY A+LR C + H
Sbjct:   59 DGDIKLVDGPNEQTGTVLVYRTYGWGKVCDDHWTMNEANVVCRQLGMGQALEVHRRNRFGSSSQANYLMDEVHCTGSEKRLTDCRFDGWGKHDCRLNEEAGVKCAQKAVIINKPSWNPLRLNLSQLELEQMSKVDFKVISQQYNFSKHSPTFIPVLIETENGTKGTVCSDHFHSTEAIVFCHQLNVGHGGRVISMPIKQTGINTTNSIAIIGYCYGNETSLRQCKSYIDYNGIQCQTQLAAAVECTDNLPDLLPDRYSLETSTYIQKMSLWLLECALEENCLPDIVYRIIDNNPYNYTWMTRTLMRFSSIIENVGNEVFRPLEDPDNWEWHACHMHYHSMKVFSRYEVVDTEKRLVAVGHKSSFCLEDNLCKSGGVPKFRCSNVVDSKGTQGISPGCRDMYLHDYDCQWVDITDIAPGQYIFQVSFNPDFLVPESNFFNNALTCQMTHLGYTAVLRQCRFIH 520          
BLAST of Lysyl oxidase vs. TrEMBL
Match: A0A075ABB3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_14305 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.326e-169
Identity = 234/470 (49.79%), Postives = 313/470 (66.60%), Query Frame = 2
Query:  131 DGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLR-----------------KNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
            DGD+KLVDG  P  GT+LVF GYGWG ICDDHWTM EA V+C+QL M  A++  ++N++ S     Y MD+V C G ++R+  C+F GWG HDC+ NE+VGV+C Y+   VQR V  NPL I L    L+ +R                 +   KI     V+++  DG    +C ++F+  E  V CHQ+    GG +  +P +      +  +  +GRCYGNE+ L+QC+TYA  NGVPC S     + C  +LPD+  D   +E S+Y++++++W L+CAL E CLPD++Y+II+ +P SY W+TRTLLRFSSIIENIGT  F PLEK D WEWH CH+HYHSMK+F+ YE++D +  +VA G KASFCLEDN+C +   P F+C N + +KGTQGISPGCKD YLH+YDCQWVD+++I PG YTFQ+  NP F V E+NYFNN L+C L +MG+ A+LR C   HP
Sbjct:   41 DGDLKLVDGPLPTMGTLLVFRGYGWGRICDDHWTMKEAQVVCRQLKMGYALEANRRNHYGSRISAAYLMDEVRCTGAENRLTDCQFAGWGIHDCKQNEEVGVKCAYEAPIVQRSVT-NPLSIKLRDSELMRMRSMGITLKKPRLPSDISAQAELKIASFYPVIVTLEDGTMGSVCSDHFRGAEAIVFCHQIGLGRGGRVIPMPRHHTGLGANTSVAIIGRCYGNETQLSQCVTYADPNGVPCNSPLAAAVECTKNLPDLVPDRYSLESSAYLQKMSLWLLECALEENCLPDTVYRIIDRNPTSYAWMTRTLLRFSSIIENIGTDVFRPLEKPDNWEWHACHMHYHSMKIFSRYEVVDPEKRLVAVGLKASFCLEDNICRSGVIPHFRCSNVVDSKGTQGISPGCKDMYLHDYDCQWVDVTDIAPGRYTFQVSFNPDFLVPESNYFNNALTCELTHMGHQAVLRQCRHVHP 509          
BLAST of Lysyl oxidase vs. TrEMBL
Match: A0A4S2LRG0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005360 PE=4 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 6.329e-168
Identity = 234/472 (49.58%), Postives = 312/472 (66.10%), Query Frame = 2
Query:  131 DGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDG-------------------VVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
            DGD+KLVDG  P  GTVLVF GYGWG ICDDHWTM EA V+C+QL M  A++  ++N + S     Y MD+V C G ++RI  C+F GWG HDC+ NE+VGV+C YK   VQR    NPL I L +  L+ +R  S  I L+                     V+++  DG    +C ++F   E  V CHQ+    GG +  +P +      +  +  +GRCYGNE+ L+QC+TYA  NGVPC S     + C  +LPD+  D   +E S+Y++++++W L+CAL E CLPD++Y+II+ +P SY W+TRTLLRFSS+IENIGT  F PLE+ + WEWH CH+HYHSMK+F+ YE++D +  +V+ G KASFCLEDNLC +   P F+C N + +KGTQGISPGCKD YLH+YDCQWVD+++I PG YTFQ+  NP F V E+NYFNN L+C L +MG+ A+LR C   HP
Sbjct:   41 DGDLKLVDGPLPTMGTVLVFRGYGWGRICDDHWTMKEAQVVCRQLNMGYALEATRRNPYGSRISAAYLMDEVRCTGAENRITDCQFAGWGIHDCKQNEEVGVKCAYKAPIVQRSAT-NPLSIKLKESELIRMR--SVGITLKKPQFPSDVSTQADVETATFYPVIVTLEDGTAGSVCSDHFHGAEAIVFCHQIGLGTGGRVIPMPQHHTGLGANTSVAIIGRCYGNETKLSQCVTYADPNGVPCNSPLAAAVECTKNLPDLIPDRYSLESSAYLQKMSLWLLECALEENCLPDTVYRIIDRNPTSYAWMTRTLLRFSSVIENIGTDVFRPLEEPENWEWHACHMHYHSMKIFSRYEVVDPEKRLVSVGLKASFCLEDNLCKSGVIPHFRCSNVVDSKGTQGISPGCKDMYLHDYDCQWVDVTDIAPGKYTFQVSFNPDFLVPESNYFNNALTCELTHMGHQAVLRQCRHVHP 509          
BLAST of Lysyl oxidase vs. Ensembl Cavefish
Match: loxl3b (lysyl oxidase homolog 3B-like [Source:NCBI gene;Acc:103043058])

HSP 1 Score: 237.654 bits (605), Expect = 1.432e-69
Identity = 145/457 (31.73%), Postives = 223/457 (48.80%), Query Frame = 2
Query:  113 LQKKL-VDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY--PLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            ++KKL     V+L  G  P EG V V  G  WG++CDD W +  A+V+C+++G   A +          GI    M++V C G++  +  C F      DC+  E   V+C            N   +   K   ++  ++ F+  +E  V+ S  +G +Y   +C   +   E  V C Q+  G     ++      G  N +  ++   +C G+E SL+QC  + + +     +     + C     D+  +   V++S Y+E   +  L CA  E CL  +  K    + H      R LLRFSS I NIG ++F P      W WH CH HYHSM +F  Y+++      VA GHKASFCLEDN C       ++C N     G QGI+ GC+D Y H+ DCQW+D++++ PG Y  Q++INP + V E+++ NNG+ C   Y G+   L +C
Sbjct:  296 MKKKLKTSSTVRLKGGARPGEGRVEVLKGSEWGTVCDDRWNLQAASVVCREMGYGSA-KLALTGARMGQGIGPIHMNEVQCTGHERSLLNCNFKNITAEDCKHTEDAAVRC------------NVPYMGYEKTVRITGGRSGFEGRVE--VLRSSANGTQYWGLICGEGWGTKEAMVACKQLGLGYSNHGLQETWYWDGS-NVTDMVMSGVKCTGDELSLSQCQHHKTVSCQKSGARFSAGVICSETASDLVLNAPLVQQSVYIEDRPLHMLYCAAEENCLSSTASKANWPYGH------RRLLRFSSEIHNIGRADFRPKAGRHSWVWHACHGHYHSMDIFTHYDLLSINGTKVAEGHKASFCLEDNECQEGVSKRYECANF----GEQGITVGCRDLYRHDIDCQWIDITDVKPGNYILQIVINPNYEVSESDFTNNGMKCNCKYDGHRIWLHNC 726          

HSP 2 Score: 79.337 bits (194), Expect = 3.188e-15
Identity = 52/180 (28.89%), Postives = 89/180 (49.44%), Query Frame = 2
Query:  140 VKLVDGGSPK---EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQF-YKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLR------KNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM 649
            +K    G P+   EG + VF    WG+ICDD +++  ANV+C+QLG   A  + +   Y + SG    ++D+V C G++  I+ C+  GWG  DC  +E  GV C K   +   V+ N + + + +  +  +R        S ++ + +GVV  +       +C N +    + V+C  M
Sbjct:   44 LKFRLAGHPRKHNEGRIEVFYKGEWGTICDDDFSLANANVLCRQLGFVSATGWAHSAKYGKGSG--KIWLDNVQCSGSERSISVCKSRGWGNSDCTHDEDAGVIC-KDERLPGFVDSNVIEVQVDERKVEEVRLRPVVTTASRRLPVTEGVVEVKYKDSWVQVCDNGWTPKNSRVVCGMM 220          
BLAST of Lysyl oxidase vs. Ensembl Cavefish
Match: loxl3b (lysyl oxidase homolog 3B-like [Source:NCBI gene;Acc:103043058])

HSP 1 Score: 237.269 bits (604), Expect = 4.017e-69
Identity = 145/457 (31.73%), Postives = 223/457 (48.80%), Query Frame = 2
Query:  113 LQKKL-VDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY--PLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            ++KKL     V+L  G  P EG V V  G  WG++CDD W +  A+V+C+++G   A +          GI    M++V C G++  +  C F      DC+  E   V+C            N   +   K   ++  ++ F+  +E  V+ S  +G +Y   +C   +   E  V C Q+  G     ++      G  N +  ++   +C G+E SL+QC  + + +     +     + C     D+  +   V++S Y+E   +  L CA  E CL  +  K    + H      R LLRFSS I NIG ++F P      W WH CH HYHSM +F  Y+++      VA GHKASFCLEDN C       ++C N     G QGI+ GC+D Y H+ DCQW+D++++ PG Y  Q++INP + V E+++ NNG+ C   Y G+   L +C
Sbjct:  340 MKKKLKTSSTVRLKGGARPGEGRVEVLKGSEWGTVCDDRWNLQAASVVCREMGYGSA-KLALTGARMGQGIGPIHMNEVQCTGHERSLLNCNFKNITAEDCKHTEDAAVRC------------NVPYMGYEKTVRITGGRSGFEGRVE--VLRSSANGTQYWGLICGEGWGTKEAMVACKQLGLGYSNHGLQETWYWDGS-NVTDMVMSGVKCTGDELSLSQCQHHKTVSCQKSGARFSAGVICSETASDLVLNAPLVQQSVYIEDRPLHMLYCAAEENCLSSTASKANWPYGH------RRLLRFSSEIHNIGRADFRPKAGRHSWVWHACHGHYHSMDIFTHYDLLSINGTKVAEGHKASFCLEDNECQEGVSKRYECANF----GEQGITVGCRDLYRHDIDCQWIDITDVKPGNYILQIVINPNYEVSESDFTNNGMKCNCKYDGHRIWLHNC 770          

HSP 2 Score: 79.337 bits (194), Expect = 3.972e-15
Identity = 52/180 (28.89%), Postives = 89/180 (49.44%), Query Frame = 2
Query:  140 VKLVDGGSPK---EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQF-YKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLR------KNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM 649
            +K    G P+   EG + VF    WG+ICDD +++  ANV+C+QLG   A  + +   Y + SG    ++D+V C G++  I+ C+  GWG  DC  +E  GV C K   +   V+ N + + + +  +  +R        S ++ + +GVV  +       +C N +    + V+C  M
Sbjct:   44 LKFRLAGHPRKHNEGRIEVFYKGEWGTICDDDFSLANANVLCRQLGFVSATGWAHSAKYGKGSG--KIWLDNVQCSGSERSISVCKSRGWGNSDCTHDEDAGVIC-KDERLPGFVDSNVIEVQVDERKVEEVRLRPVVTTASRRLPVTEGVVEVKYKDSWVQVCDNGWTPKNSRVVCGMM 220          
BLAST of Lysyl oxidase vs. Ensembl Cavefish
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:103031258])

HSP 1 Score: 233.417 bits (594), Expect = 6.320e-68
Identity = 148/465 (31.83%), Postives = 223/465 (47.96%), Query Frame = 2
Query:   92 YSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFP-GWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDK-MIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            Y K F + Q       V+L  G    EG V V     WG+ICDD W +  A V+C++LG+  A +          G+    M++V C G +  +  C+F        C   E  GV+C            N   +   +   ++  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  +    ++   RC G E +L+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P + +   R LLRFSS I N G S+F P    D W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  313 YRKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDQWNLVSATVVCRELGLGTAKEALSGGQL-GQGMGPVHMNEVKCSGFEKSVTECQFNMDKDSEGCSHEEDAGVRC------------NVPAMGFQQRLRLTGGRNPFEGRVE---VLVERNGSLVWGTVCSEGWSTMEAMVVCRQLGLGFASNAFQETWYWPGLVSADAVVMSGVRCAGTEMTLSHCLHHGEHLSCPKGGARYAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSST----PANSY---RRLLRFSSQIHNNGQSDFRPKASRDSWVWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYMFQIVINPNYEVAESDYTNNVVKCRCRYDGHRIWMYNC 745          

HSP 2 Score: 65.0846 bits (157), Expect = 1.104e-10
Identity = 62/241 (25.73%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGT-----IELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCL---TYASSNGVPCESDKMIHINCI 835
            EG + VF    WG++CDD + +  A V+C++LG  +AV +     +   G    + D+V C G +  +A C+  G G  DC+ +E VGV C       ++  N     N + L I +     +  L S RK   +I + +G V  +  G    +C   +    + V+C  M+G  G       +  +       +Y +Y V    C GNE+ L+ C    + ++     C     + ++CI
Sbjct:   69 EGRLEVFYEGQWGTVCDDDFNIHSAQVVCRELGYAEAVSWAPSAKY-GKGEGRIWFDNVQCTGKEKTLAQCQSNGIGVSDCKHSEDVGVVCSDKRIPGFRFLN-HLTNNIDSLNIQVEDVRIRPILSSYRK---RIPVTEGYVEVKDGGKWKQICNEEWDPMNSRVIC-GMFGFPGDQRYNTRVYRMFARRRTPSYWEYSV---NCTGNEAHLSSCKLGHSVSAKGNSSCSQGIPVVVSCI 300          
BLAST of Lysyl oxidase vs. Ensembl Cavefish
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:103031258])

HSP 1 Score: 233.417 bits (594), Expect = 6.320e-68
Identity = 148/465 (31.83%), Postives = 223/465 (47.96%), Query Frame = 2
Query:   92 YSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFP-GWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDG--IRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDK-MIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            Y K F + Q       V+L  G    EG V V     WG+ICDD W +  A V+C++LG+  A +          G+    M++V C G +  +  C+F        C   E  GV+C            N   +   +   ++  +N F+  +E   VL E +G  +   +C   +   E  V+C Q+  G      +      G  +    ++   RC G E +L+ CL +      P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA  E CL  +        P + +   R LLRFSS I N G S+F P    D W WH CH HYHSM++F  Y+++      VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+   + +C
Sbjct:  313 YRKAFRQEQPL-----VRLRGGAVVGEGRVEVLKNGEWGTICDDQWNLVSATVVCRELGLGTAKEALSGGQL-GQGMGPVHMNEVKCSGFEKSVTECQFNMDKDSEGCSHEEDAGVRC------------NVPAMGFQQRLRLTGGRNPFEGRVE---VLVERNGSLVWGTVCSEGWSTMEAMVVCRQLGLGFASNAFQETWYWPGLVSADAVVMSGVRCAGTEMTLSHCLHHGEHLSCPKGGARYAAGVSCSETAPDLVLNPQVVEQTTYLEDRPMFMLQCAYEENCLASTSSST----PANSY---RRLLRFSSQIHNNGQSDFRPKASRDSWVWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECDEGIEKRYECANF----GEQGITVGCWDTYRHDIDCQWVDITDVKPGDYMFQIVINPNYEVAESDYTNNVVKCRCRYDGHRIWMYNC 745          

HSP 2 Score: 65.0846 bits (157), Expect = 1.104e-10
Identity = 62/241 (25.73%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLP----KESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGT-----IELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCL---TYASSNGVPCESDKMIHINCI 835
            EG + VF    WG++CDD + +  A V+C++LG  +AV +     +   G    + D+V C G +  +A C+  G G  DC+ +E VGV C       ++  N     N + L I +     +  L S RK   +I + +G V  +  G    +C   +    + V+C  M+G  G       +  +       +Y +Y V    C GNE+ L+ C    + ++     C     + ++CI
Sbjct:   69 EGRLEVFYEGQWGTVCDDDFNIHSAQVVCRELGYAEAVSWAPSAKY-GKGEGRIWFDNVQCTGKEKTLAQCQSNGIGVSDCKHSEDVGVVCSDKRIPGFRFLN-HLTNNIDSLNIQVEDVRIRPILSSYRK---RIPVTEGYVEVKDGGKWKQICNEEWDPMNSRVIC-GMFGFPGDQRYNTRVYRMFARRRTPSYWEYSV---NCTGNEAHLSSCKLGHSVSAKGNSSCSQGIPVVVSCI 300          
BLAST of Lysyl oxidase vs. Ensembl Cavefish
Match: loxl3a (lysyl oxidase like 3 [Source:NCBI gene;Acc:103045344])

HSP 1 Score: 219.164 bits (557), Expect = 4.692e-64
Identity = 138/458 (30.13%), Postives = 215/458 (46.94%), Query Frame = 2
Query:  113 LQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLG----GTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            L   +++  V+L  G    EG V V  G  WG++CDD W +  A+V+C++LG   A +          G+    M++V C G++  +  C        +C+  E   V+C       ++ +     R  L  E  V L   +   + + G++           C + + + E  V C Q+   LG    G  E    ++   N ++ ++   +C G+E +L+ C  +   +     +     + C     D+  +   VE+S Y+E   +  L CA  E CL  S  +    + H      R LLRFSS I N+G ++F P      W WH CH HYHSM +F  Y+++D     VA GHKASFCLED  C       ++C N     G QGI+ GC DTY H+ DCQW+D++++ PG Y  Q+++NP F V E+++ NN + C   Y G    L  C
Sbjct:  150 LDSNIIESKVRLKGGAKAGEGRVEVLKGSEWGTVCDDLWNLQSASVVCRELGFGTAKEALTGARM-GQGMGPIHMNEVQCVGDEKSLLKCPHKSITAENCKHMEDASVKCNIPYMGFEKTIRLTGGRTQL--EGRVELLAPNASSLEQWGLI-----------CGDGWTSREAMVACRQL--GLGHASSGLSETWYWDSS--NVTEMVMSGVKCRGDEMTLSDCQHHHIVSCKRAGAQFSAGVICSDSASDLVLNAPLVEKSVYIEDRPLHLLYCAAEENCLSKSAVRANWPYGH------RRLLRFSSEIHNVGRADFRPRLGRHSWVWHECHRHYHSMDIFTHYDLLDLNGTKVADGHKASFCLEDTDCHEGISKRYECANF----GEQGITVGCWDTYRHDIDCQWIDITDVKPGNYILQVVLNPNFEVAESDFTNNAMRCNCKYDGNRIWLHKC 579          

HSP 2 Score: 72.0182 bits (175), Expect = 6.180e-13
Identity = 57/224 (25.45%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  140 VKLVDGGSPK---EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLG-----------RCYGNESSLTQC 769
            +K    G P+   EG V VF    WG+ICDD +T++ A+V+C+ LG  +A+ +     +  +G    ++D+V C G+++ I  C   GWG  DC   E  GV C               R+P   +S +   K   K   + G    EV            K +E   +C  ++     ++    +  G    +    R+G           +C G+E SL +C
Sbjct:   39 LKFRLAGYPRKHNEGRVEVFYSGEWGTICDDDFTLSNAHVLCRHLGFVEALSWSHSAKY-GAGTGKIWLDNVMCSGSETSIDKCLSRGWGNSDCTHEEDAGVIC------------KDERLPGFLDSNIIESKVRLKGGAKAGEGRVEV-----------LKGSEWGTVCDDLWNLQSASVVCRELGFGTAKEALTGARMGQGMGPIHMNEVQCVGDEKSLLKC 238          
BLAST of Lysyl oxidase vs. Ensembl Sea Lamprey
Match: loxl3a (lysyl oxidase-like 3a [Source:NCBI gene;Acc:568839])

HSP 1 Score: 206.453 bits (524), Expect = 1.118e-58
Identity = 144/461 (31.24%), Postives = 208/461 (45.12%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVN-----------WNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLG-GTIELIPMNT-----GKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V  G  WG++CD  W+   A+V+C++LG   A +           +    M  V C G +  I  C       H C  +E   V+C+  A    + N           WN + + L            F  + E    LSE  G+            E +V C Q    LG G   + P+       G   + + ++   +C G+E SL  C  + +             I   S  PD+  +   V+ SSY+E   +  L CA  E CL  S     N+H   + +  R LLRFSS I N+G ++F P      W WH CH HYHSM++F  Y+I+      VA GHKASFCLED  C    +  ++C N     G QGI+  C DTY H+ DCQWVD++++ PG Y FQ+++NP + V E ++ NN + C   Y G+   + +C
Sbjct:  358 VRLKGGAMTGEGRVEVQRGGEWGTVCDQRWSTVSASVVCRELGFGSAKEALTSGRM-GQAMGPIHMAMVQCTGQERSIFDCPHGNASDHGCGHHEDAAVRCHVPAMGFEKRNFRQCAKGFHNSWNWVDVNL-----------GFCPVRELDSGLSEGWGM-----------LEASVACRQ----LGLGYASMPPLQETWYFEGSPLHDQVVMSGVKCVGSEMSLQYCRHHNA------------RIPKRSVAPDLVLNAPLVQVSSYLEDRPLHLLYCAAEEDCLAQSAR---NMH---WPYGQRRLLRFSSEIHNLGRADFRPKAGRHSWVWHECHRHYHSMEVFTHYDILSTNGTKVAEGHKASFCLEDTDCQEGGQKVYECANF----GEQGITVNCHDTYRHDIDCQWVDVTDLKPGNYIFQVVLNPNYEVAETDFTNNAMKCNCKYDGHRIWMYNC 769          

HSP 2 Score: 81.6481 bits (200), Expect = 1.349e-16
Identity = 67/256 (26.17%), Postives = 112/256 (43.75%), Query Frame = 2
Query:  128 VDGDVKLVDGGSPK---EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESL----VSLR----KNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELI---PMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDI 853
             +G  KL   G P+   EG V VF    WG++CDD ++M  ANV+C++ G   A  +     +   GI   ++D+V+C G++  +A C   GWG  DC  +E VGV C K   ++    +N + +P+    +    V LR        ++ + +GVV     G    +C  N+    + V+C  M       +  +     +  +     ++V    C G ES +T C       G         H +C++ +P I
Sbjct:   85 ANGGYKLRLAGYPRKPFEGRVEVFHQGEWGTVCDDDFSMEAANVVCQEAGFIGANGWAHSAKY-GRGIGRIWLDNVHCRGSEQSLAECVSRGWGISDCNHDEDVGVVC-KETRLKGTPEFNVIEVPIGGGVIQCEDVRLRPILPAAKKRLPVTEGVVEVRYMGSWRHVCDENWTPRNSRVICGMMGFPAERKVNRVLYRHFSERQQERPSFLVHSLNCTGTESHITACQHDLLPLG------PKAHNSCLAGMPAI 332          
BLAST of Lysyl oxidase vs. Ensembl Sea Lamprey
Match: LOXL2 (lysyl oxidase like 2 [Source:HGNC Symbol;Acc:HGNC:6666])

HSP 1 Score: 176.407 bits (446), Expect = 4.380e-51
Identity = 100/298 (33.56%), Postives = 152/298 (51.01%), Query Frame = 2
Query:  596 LCPNNFKATENNVLCHQMYGKLGGTIELIPMN---TGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDK---MIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            +C + +   E  V C Q+   LG  +  +       G     + ++   +C G E SL  C  + S   V C+         + C    PD+  +   V+ S+Y+E   +  L CA  E CL  S   +      ++ + +R LLRFSS I N+G ++F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C    +  ++C N     G QGI+ GC+D Y H+ DCQWVD++++ PG Y FQ++INP + V E ++ NN + C   + G+   + +C
Sbjct:   27 VCGDGWTTLEAMVACRQL--GLGFAVHALTETWYFQGDSGVEEVLMSGVQCSGTEMSLAHCRHHGSR--VKCKRGGGRYAAGVVCTESAPDLVLNSRIVQESAYLEDRPLHLLYCAAEENCLSASASAM------NWPYGSRRLLRFSSQIHNVGRTDFRPKAGSHAW-WHQCHRHYHSMEVFTHYDLLTLNGTKVAEGHKASFCLEDTSCEPGVQKRYECANF----GDQGIAVGCQDIYRHDIDCQWVDVTDVAPGDYIFQVVINPNYEVSETDFTNNAMKCNCKFDGHRVWMYNC 309          

HSP 2 Score: 59.3066 bits (142), Expect = 6.569e-10
Identity = 32/87 (36.78%), Postives = 46/87 (52.87%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKN-YFQS-SGIKNYFMDDVYCFGNKSRIAYCEFPG 394
            ++L  G +  EG + V     WG++C D WT  EA V C+QLG+  AV    +  YFQ  SG++   M  V C G +  +A+C   G
Sbjct:    3 IRLTGGRNEWEGRLEVRRSKRWGTVCGDGWTTLEAMVACRQLGLGFAVHALTETWYFQGDSGVEEVLMSGVQCSGTEMSLAHCRHHG 89          
BLAST of Lysyl oxidase vs. Ensembl Sea Lamprey
Match: LOXL2 (lysyl oxidase like 2 [Source:HGNC Symbol;Acc:HGNC:6666])

HSP 1 Score: 172.17 bits (435), Expect = 2.729e-50
Identity = 91/249 (36.55%), Postives = 134/249 (53.82%), Query Frame = 2
Query:  734 RCYGNESSLTQCLTYASSNGVPCESDK---MIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            +C G E SL  C  + S   V C+         + C    PD+  +   V+ S+Y+E   +  L CA  E CL  S   +      ++ + +R LLRFSS I N+G ++F P      W WH  H HYHSM++F  Y+++      VA GHKASFCLED  C    +  ++C N     G QGI+ GC+D Y H+ DCQWVD++++ PG Y FQ++INP + V E ++ NN + C   + G+   + +C
Sbjct:    7 QCSGTEMSLAHCRHHGSR--VKCKRGGGRYAAGVVCTESAPDLVLNSRIVQESAYLEDRPLHLLYCAAEENCLSASASAM------NWPYGSRRLLRFSSQIHNVGRTDFRPKAGSHAWGWHVLHGHYHSMEVFTHYDLLTLNGTKVAEGHKASFCLEDTSCEPGVQKRYECANF----GDQGIAVGCQDIYRHDIDCQWVDVTDVAPGDYIFQVVINPNYEVSETDFTNNAMKCNCKFDGHRVWMYNC 243          
BLAST of Lysyl oxidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003501.1 (pep scaffold:Pmarinus_7.0:GL480380:12751:21659:1 gene:ENSPMAG00000003198.1 transcript:ENSPMAT00000003501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 5.225e-20
Identity = 61/211 (28.91%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            +V+LV GG+  +G V V  G  WG++CDD W + +A V+C+QLG   AV     N F   G    +MD+V C G++S+++ C   GWG HDC   E   V C +   +  EV              V  RK                  I   +C + +   +  V+CHQ+    G  +  +          +  +   +C G+ES L+QC
Sbjct:  111 EVRLVGGGNACQGRVEVLYGRSWGTVCDDVWDLQDAEVVCRQLGCGSAVSAL-GNAFYGVGSGRIWMDNVQCNGSESQLSLCRQNGWGTHDCSHVEDASVICSRGVAIGVEVRLVGGGNACQGRVEVLYRK------------------IWGTVCDDFWDLQDAEVVCHQL--GCGSAVSALGNAFYGVGSGRIWMDNVQCNGSESQLSQC 300          

HSP 2 Score: 82.0333 bits (201), Expect = 4.358e-17
Identity = 42/105 (40.00%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKV 451
            +V+LV GG+  +G V V     WG++CDD W + +A V+C QLG   AV     N F   G    +MD+V C G++S+++ C   GWG HDC   E   V C +V
Sbjct:  220 EVRLVGGGNACQGRVEVLYRKIWGTVCDDFWDLQDAEVVCHQLGCGSAVSAL-GNAFYGVGSGRIWMDNVQCNGSESQLSQCRQNGWGTHDCSHVEDASVICSRV 323          

HSP 3 Score: 76.6406 bits (187), Expect = 2.641e-15
Identity = 39/102 (38.24%), Postives = 57/102 (55.88%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            +V+LV GG+  +G V V     WG++CDD W + +A V+C+QL    AV     N    +G    +MD+V C G++S+++ C   GWG HDC   E   V C
Sbjct:  329 EVRLVGGGNACQGRVEVLYRKIWGTVCDDFWELQDAEVVCRQLSCGSAVSA-PGNARYGAGSGRIWMDNVQCNGSESQLSLCRQNGWGAHDCSHVEDASVVC 429          

HSP 4 Score: 71.633 bits (174), Expect = 1.206e-13
Identity = 40/104 (38.46%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKV 451
            V LV GG+   G V V     WG++CDD W + +A V+C+QL    AV     N    +G    +MD+V C G++S+++ C   GWG HDC   E   V C +V
Sbjct:    2 VHLVGGGTC-HGRVEVQYRGTWGTVCDDFWELQDAEVVCRQLSCGSAVSA-PGNAQYGAGSGQIWMDNVQCSGSESQLSQCRQNGWGAHDCSHVEDASVICSQV 103          
BLAST of Lysyl oxidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003504.1 (pep scaffold:Pmarinus_7.0:GL480380:12760:21677:1 gene:ENSPMAG00000003198.1 transcript:ENSPMAT00000003504.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.372e-19
Identity = 61/211 (28.91%), Postives = 95/211 (45.02%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            +V+LV GG+  +G V V  G  WG++CDD W + +A V+C+QLG   AV     N F   G    +MD+V C G++S+++ C   GWG HDC   E   V C +   V+     N  +  +     V  RK                  I   +C + +   +  V+CHQ+    G  +  +          +  +   +C G+ES L+QC
Sbjct:  105 EVRLVGGGNACQGRVEVLYGRSWGTVCDDVWDLQDAEVVCRQLGCGSAVSAL-GNAFYGVGSGRIWMDNVQCNGSESQLSLCRQNGWGTHDCSHVEDASVICSRGVEVRLVGGGNACQGRVE----VLYRK------------------IWGTVCDDFWDLQDAEVVCHQL--GCGSAVSALGNAFYGVGSGRIWMDNVQCNGSESQLSQC 290          

HSP 2 Score: 80.4925 bits (197), Expect = 1.286e-16
Identity = 42/109 (38.53%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQ 463
            +V+LV GG+  +G V V     WG++CDD W + +A V+C QLG   AV     N F   G    +MD+V C G++S+++ C   GWG HDC   E   V C +   V+
Sbjct:  210 EVRLVGGGNACQGRVEVLYRKIWGTVCDDFWDLQDAEVVCHQLGCGSAVSAL-GNAFYGVGSGRIWMDNVQCNGSESQLSQCRQNGWGTHDCSHVEDASVICSRGVEVR 317          

HSP 3 Score: 76.2554 bits (186), Expect = 3.448e-15
Identity = 39/102 (38.24%), Postives = 57/102 (55.88%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            +V+LV GG+  +G V V     WG++CDD W + +A V+C+QL    AV     N    +G    +MD+V C G++S+++ C   GWG HDC   E   V C
Sbjct:  315 EVRLVGGGNACQGRVEVLYRKIWGTVCDDFWELQDAEVVCRQLSCGSAVSA-PGNARYGAGSGRIWMDNVQCNGSESQLSLCRQNGWGAHDCSHVEDASVVC 415          

HSP 4 Score: 71.2478 bits (173), Expect = 1.459e-13
Identity = 37/101 (36.63%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  155 GGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVAN 457
            GG    G V V     WG++CDD W + +A V+C+QL    AV     N    +G    +MD+V C G++S+++ C   GWG HDC   E   V C +V++
Sbjct:    3 GGGTCHGRVEVQYRGTWGTVCDDFWELQDAEVVCRQLSCGSAVSA-PGNAQYGAGSGQIWMDNVQCSGSESQLSQCRQNGWGAHDCSHVEDASVICSQVSS 102          
BLAST of Lysyl oxidase vs. Ensembl Nematostella
Match: EDO26980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAJ1])

HSP 1 Score: 108.227 bits (269), Expect = 4.764e-27
Identity = 70/210 (33.33%), Postives = 105/210 (50.00%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            V+LV+G    EG V +F    WGS+CDD W+  +ANV+C+QLG E AV ++    F  S     +MDDV C G +  +  C FPGWG+H+CR +E  GV C            N   IP P+ +   +  +SF     +G V    +G    +C +++  ++  V+CHQ+ G  G        + G+ N   ++  +  C G E SL  C
Sbjct:    8 VRLVNGSRYNEGRVEIFKYGNWGSVCDDSWSREDANVVCRQLGFEGAVSWHGSARFGES-CGPIWMDDVQCMGYERSLDSCYFPGWGRHNCRHSEDAGVVCQTR---------NTTAIP-PRPTTWLVNGSSFN----EGRVEIYHNGTWGTVCDDSWDISDAQVVCHQL-GYPGAVSSPGRAHFGRGNGQIWMDDV-HCMGYERSLDSC 200          

HSP 2 Score: 86.6557 bits (213), Expect = 2.063e-19
Identity = 41/99 (41.41%), Postives = 59/99 (59.60%), Query Frame = 2
Query:  146 LVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            LV+G S  EG V ++    WG++CDD W +++A V+C QLG   AV    + +F   G    +MDDV+C G +  +  C FPGWG+H+C  +E  GV C
Sbjct:  123 LVNGSSFNEGRVEIYHNGTWGTVCDDSWDISDAQVVCHQLGYPGAVSSPGRAHF-GRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCIHSEDAGVVC 220          
BLAST of Lysyl oxidase vs. Ensembl Nematostella
Match: EDO37718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEY3])

HSP 1 Score: 100.908 bits (250), Expect = 1.451e-25
Identity = 49/123 (39.84%), Postives = 69/123 (56.10%), Query Frame = 2
Query: 1103 HYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            HYHSM++F+ Y++ID +   VA GHKASFCLED  C       + C     + G QG+ P C D Y    DCQW+D+++   G Y  Q+ +NP   V E +Y NN   C  Y  G   ++++C
Sbjct:    2 HYHSMEVFSTYDLIDDRGQKVAEGHKASFCLEDTGCDAGIHRHWNC----TDGGDQGVKPNCYDEYKWTIDCQWIDVTDRPHGNYRLQIKVNPNQMVAETDYDNNIAMCDAYDYGSFLLMQNC 120          
BLAST of Lysyl oxidase vs. Ensembl Nematostella
Match: EDO39811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Y4])

HSP 1 Score: 102.064 bits (253), Expect = 5.425e-25
Identity = 66/210 (31.43%), Postives = 105/210 (50.00%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQC 769
            V+LV+G S  EG V ++    WG++CDD W +++A V+C+QLG   AV    + +F   G    +MDDV+C G +  +  C FPGWG+H+C  +E  GV C            N   IP P+ +   +  +SF     +G V    +G    +C +++  ++  V+CHQ+ G  G        + G+ N   ++  +  C G E SL  C
Sbjct:    1 VRLVNGSSFNEGRVEIYHNGTWGTVCDDSWDISDAQVVCRQLGYPGAVSSPGRAHF-GRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCIHSEDAGVVCQTR---------NTTAIP-PRPTTWLVNGSSFN----EGRVEIYHNGTWGTVCDDSWDISDAQVVCHQL-GYPGAVSSPGRAHFGRGNGQIWMDDV-HCMGYERSLDSC 193          

HSP 2 Score: 86.6557 bits (213), Expect = 1.401e-19
Identity = 41/99 (41.41%), Postives = 59/99 (59.60%), Query Frame = 2
Query:  146 LVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            LV+G S  EG V ++    WG++CDD W +++A V+C QLG   AV    + +F   G    +MDDV+C G +  +  C FPGWG+H+C  +E  GV C
Sbjct:  116 LVNGSSFNEGRVEIYHNGTWGTVCDDSWDISDAQVVCHQLGYPGAVSSPGRAHF-GRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCIHSEDAGVVC 213          
BLAST of Lysyl oxidase vs. Ensembl Nematostella
Match: EDO27407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9C0])

HSP 1 Score: 93.2041 bits (230), Expect = 4.040e-23
Identity = 44/101 (43.56%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            ++L  G  P EG V VF    WG++CDD W M +ANV+C+ LG   A+Q+ + + F   G    +MD+V C GN+S +A C+F GWG H+C   E  GV C
Sbjct:    3 IRLSGGKKPSEGRVEVFYNNTWGTVCDDSWQMKDANVVCRMLGFPYALQYTQTSSF-GGGSGPIWMDNVGCRGNESSLADCQFNGWGVHNCDHEEDAGVVC 102          
BLAST of Lysyl oxidase vs. Ensembl Nematostella
Match: EDO39898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8V9])

HSP 1 Score: 91.6633 bits (226), Expect = 2.114e-22
Identity = 44/105 (41.90%), Postives = 61/105 (58.10%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSS----GIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            V+LV G  P EG V V     WG++CDD W + + NV+C+ LG   A+Q +K    ++S    G    +MD+V C GN+S +A C+F GWG H+C   E  GV C
Sbjct:    5 VRLVGGSLPSEGRVEVLHDGAWGTVCDDEWDIKDGNVVCRSLGYRFALQVHKVGPKETSSFGGGSGPIWMDNVGCRGNESSLADCQFNGWGVHNCDHEEDAGVVC 109          
BLAST of Lysyl oxidase vs. Ensembl Medaka
Match: loxl2a (lysyl oxidase homolog 2A [Source:NCBI gene;Acc:101169105])

HSP 1 Score: 236.113 bits (601), Expect = 5.167e-69
Identity = 148/448 (33.04%), Postives = 221/448 (49.33%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY--PLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG++CDD+W +  A V+C++LG   A +          GI    M++V C G +  +  C F       C   E   V+C            N   +   K+  +S  +N ++  +E   VL+E +G+     +C +++   E  V+C Q+  G      +      G  +    ++   RC G E +L QCL + S    P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA+ E CL  +  K     P SY    R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C    +  ++C N     G+QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+     +C
Sbjct:  299 VRLRGGAMLGEGRVEVLRNGEWGTVCDDNWNIRAATVVCRELGFGSAKEALSGAKM-GQGIGPVHMNEVECSGFEKSLTECSF-NLESLGCSHEEDAAVKC------------NIPAMGFNKKLRLSGGRNPYEGRVE---VLAERNGLLTWGSVCSDSWGTMEAMVVCRQLGLGFASHAFQETWYWQGDSSSDVVVMSGVRCSGTELTLDQCLHHGSHIDCPKGGGRFAAGVSCTLTAPDLVLNAPVVEQTTYLEDRPLYALQCAMEENCLSSAASKA---DPTSY----RRLLRFSSQIHNNGLSDFQPRAAHHSWTWHECHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDTQCDEGIQKRYECANF----GSQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQVVINPNYEVAESDYTNNVMKCQTRYDGHRIWTYNC 718          

HSP 2 Score: 74.3294 bits (181), Expect = 1.148e-13
Identity = 57/218 (26.15%), Postives = 98/218 (44.95%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGR-----------CYGNESSLTQC 769
            EG V V     WG++CDD +++  A+V+C++LG   A  +Y    +   G    ++D+V+C G++  +A CE  G+G  DC+ +E VGV C       +K    Q   N   L + +    + +   +  ++ + +G V  +  G    +C  ++    + V+C  MYG  G           +FN   Y +   R           C GNE+ L+ C
Sbjct:   45 EGRVEVLYNGEWGTVCDDDFSLYAAHVVCRELGYMDAQAWYPSAKY-GKGEGRIWLDNVHCSGSEKSLAQCESNGFGVSDCKHSEDVGVVCSTKRIPGFKFIRNQIH-NDQGLTVQVEDVRIRATYSHRKRVPITEGFVEVKDGGKWRQICSEDWTEMNSRVIC-GMYGFPG---------VKRFNVRPYKLLAQRRKKNYWGFGVNCTGNEADLSDC 250          

HSP 3 Score: 52.373 bits (124), Expect = 1.017e-6
Identity = 58/227 (25.55%), Postives = 85/227 (37.44%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNY--FQSSGIKNYFMDDVYCFGNKSRIAYC----EFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHIN 829
            EG V V  G  W  IC + WT   + VIC   G     +F  + Y        KNY+   V C GN++ ++ C    E    G   C       + C         V+    +    ++ LV LR  +   ML +G V    +G    +C +N+      V+C ++ +G     +    M  G        V    C G E SLT+C     S G   E D  +  N
Sbjct:  178 EGFVEVKDGGKWRQICSEDWTEMNSRVICGMYGFPGVKRFNVRPYKLLAQRRKKNYWGFGVNCTGNEADLSDCKLGREIKLKGNSTCGRGMPTVISCVPGRAFAPSVSIGFRKAYRVEQPLVRLRGGA---MLGEGRVEVLRNGEWGTVCDDNWNIRAATVVCRELGFGSAKEALSGAKMGQGIGPVHMNEV---ECSGFEKSLTECSFNLESLGCSHEEDAAVKCN 398          
BLAST of Lysyl oxidase vs. Ensembl Medaka
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101164651])

HSP 1 Score: 231.106 bits (588), Expect = 4.527e-67
Identity = 155/466 (33.26%), Postives = 222/466 (47.64%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVP-CESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD W +  A V+C++LG   A +          G+    M++V C G +  I  C F G     C   E   V+C   A   Q+ +  +  R P      V + +N   +    G V SE  GI            E  V+C Q+  G      +      G+ +  + ++   RC G E SL+ CL +      P     K   ++C    PD+  +   VE+++YME   ++ LQCA  E CL  +  ++    P + +   R LLRFSS I N G S+F P     +W WH CH HYHSM++F  Y++     + VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQW+D+++I PG Y FQ++INP + V E +Y NN   C   Y G+   + +C
Sbjct:  304 MTGYRKAFRQEQPL-----VRLRGGAIVGEGRVEVLKNGEWGTICDDKWNLLAATVVCRELGFGTAKEALSGGRL-GQGMGPVHMNEVQCSGFEKSITECLFNG-EILGCSHEEDAAVRCNVPAMGFQQRLRLSGGRNPYEGRVEVLMERNDSLVW---GTVCSEGWGI-----------MEAMVVCRQLGLGFASNAFQETWYWPGEVSADQVVMSGVRCSGTEMSLSHCLHHGEHLSCPRGGGRKAAGVSCSETAPDLVLNPQVVEQTTYMEDRPMFMLQCAYEENCLSSTSGQV----PANTY---RRLLRFSSQIHNNGQSDFRPKAGRHEWVWHECHRHYHSMEVFTTYDLFTLNGSKVAEGHKASFCLEDSECDEGIEKKYECANF----GEQGITVGCWDTYRHDIDCQWIDITDIKPGDYLFQIVINPNYEVPETDYTNNITKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 65.0846 bits (157), Expect = 9.838e-11
Identity = 58/240 (24.17%), Postives = 104/240 (43.33%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV------QREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V V+    WG++CDD + +  A V+C++LG  +AV +   + +   G    + D++ C G +  +A C   G G  DC+  E VGV C       +K  N+        ++    +RI   +  L S RK   +I + +G V  +  G    +C   +    + V+C  M+G     +    +  +     K  Y  + V    C G E+ L+ C    +++   C     + ++C+
Sbjct:   66 EGRVEVYYNGEWGTVCDDDFNIHAAQVVCRELGYVEAVSWSPSSKY-GKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSDCKHTEDVGVVCSDRRIPGFKFVNLLPNHVENLDIRVEDVRI---RAILSSYRK---RIPVTEGYVEVKDGGKWKQICDTEWTQFNSRVIC-GMFGFPGEKRYNARVYKMFARRRKPTYWDFSV---NCTGTEAHLSSCRLGHANSSDTCTEGLPVVVSCV 294          
BLAST of Lysyl oxidase vs. Ensembl Medaka
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101164651])

HSP 1 Score: 231.106 bits (588), Expect = 4.527e-67
Identity = 155/466 (33.26%), Postives = 222/466 (47.64%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVP-CESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD W +  A V+C++LG   A +          G+    M++V C G +  I  C F G     C   E   V+C   A   Q+ +  +  R P      V + +N   +    G V SE  GI            E  V+C Q+  G      +      G+ +  + ++   RC G E SL+ CL +      P     K   ++C    PD+  +   VE+++YME   ++ LQCA  E CL  +  ++    P + +   R LLRFSS I N G S+F P     +W WH CH HYHSM++F  Y++     + VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQW+D+++I PG Y FQ++INP + V E +Y NN   C   Y G+   + +C
Sbjct:  304 MTGYRKAFRQEQPL-----VRLRGGAIVGEGRVEVLKNGEWGTICDDKWNLLAATVVCRELGFGTAKEALSGGRL-GQGMGPVHMNEVQCSGFEKSITECLFNG-EILGCSHEEDAAVRCNVPAMGFQQRLRLSGGRNPYEGRVEVLMERNDSLVW---GTVCSEGWGI-----------MEAMVVCRQLGLGFASNAFQETWYWPGEVSADQVVMSGVRCSGTEMSLSHCLHHGEHLSCPRGGGRKAAGVSCSETAPDLVLNPQVVEQTTYMEDRPMFMLQCAYEENCLSSTSGQV----PANTY---RRLLRFSSQIHNNGQSDFRPKAGRHEWVWHECHRHYHSMEVFTTYDLFTLNGSKVAEGHKASFCLEDSECDEGIEKKYECANF----GEQGITVGCWDTYRHDIDCQWIDITDIKPGDYLFQIVINPNYEVPETDYTNNITKCRCRYDGHRIWMYNC 737          

HSP 2 Score: 65.0846 bits (157), Expect = 9.838e-11
Identity = 58/240 (24.17%), Postives = 104/240 (43.33%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV------QREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            EG V V+    WG++CDD + +  A V+C++LG  +AV +   + +   G    + D++ C G +  +A C   G G  DC+  E VGV C       +K  N+        ++    +RI   +  L S RK   +I + +G V  +  G    +C   +    + V+C  M+G     +    +  +     K  Y  + V    C G E+ L+ C    +++   C     + ++C+
Sbjct:   66 EGRVEVYYNGEWGTVCDDDFNIHAAQVVCRELGYVEAVSWSPSSKY-GKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSDCKHTEDVGVVCSDRRIPGFKFVNLLPNHVENLDIRVEDVRI---RAILSSYRK---RIPVTEGYVEVKDGGKWKQICDTEWTQFNSRVIC-GMFGFPGEKRYNARVYKMFARRRKPTYWDFSV---NCTGTEAHLSSCRLGHANSSDTCTEGLPVVVSCV 294          
BLAST of Lysyl oxidase vs. Ensembl Medaka
Match: loxl2a (lysyl oxidase homolog 2A [Source:NCBI gene;Acc:101169105])

HSP 1 Score: 234.572 bits (597), Expect = 4.906e-67
Identity = 148/448 (33.04%), Postives = 221/448 (49.33%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRY--PLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIH-INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
            V+L  G    EG V V     WG++CDD+W +  A V+C++LG   A +          GI    M++V C G +  +  C F       C   E   V+C            N   +   K+  +S  +N ++  +E   VL+E +G+     +C +++   E  V+C Q+  G      +      G  +    ++   RC G E +L QCL + S    P    +    ++C    PD+  +   VE+++Y+E   ++ LQCA+ E CL  +  K     P SY    R LLRFSS I N G S+F P      W WH CH HYHSM++F  Y+++      VA GHKASFCLED  C    +  ++C N     G+QGI+ GC DTY H+ DCQWVD++++ PG Y FQ++INP + V E++Y NN + C   Y G+     +C
Sbjct:  299 VRLRGGAMLGEGRVEVLRNGEWGTVCDDNWNIRAATVVCRELGFGSAKEALSGAKM-GQGIGPVHMNEVECSGFEKSLTECSF-NLESLGCSHEEDAAVKC------------NIPAMGFNKKLRLSGGRNPYEGRVE---VLAERNGLLTWGSVCSDSWGTMEAMVVCRQLGLGFASHAFQETWYWQGDSSSDVVVMSGVRCSGTELTLDQCLHHGSHIDCPKGGGRFAAGVSCTLTAPDLVLNAPVVEQTTYLEDRPLYALQCAMEENCLSSAASK---ADPTSY----RRLLRFSSQIHNNGLSDFQPRAAHHSWTWHECHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDTQCDEGIQKRYECANF----GSQGITVGCWDTYRHDIDCQWVDITDVKPGDYIFQVVINPNYEVAESDYTNNVMKCQTRYDGHRIWTYNC 718          

HSP 2 Score: 73.9442 bits (180), Expect = 2.068e-13
Identity = 57/218 (26.15%), Postives = 98/218 (44.95%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGR-----------CYGNESSLTQC 769
            EG V V     WG++CDD +++  A+V+C++LG   A  +Y    +   G    ++D+V+C G++  +A CE  G+G  DC+ +E VGV C       +K    Q   N   L + +    + +   +  ++ + +G V  +  G    +C  ++    + V+C  MYG  G           +FN   Y +   R           C GNE+ L+ C
Sbjct:   45 EGRVEVLYNGEWGTVCDDDFSLYAAHVVCRELGYMDAQAWYPSAKY-GKGEGRIWLDNVHCSGSEKSLAQCESNGFGVSDCKHSEDVGVVCSTKRIPGFKFIRNQIH-NDQGLTVQVEDVRIRATYSHRKRVPITEGFVEVKDGGKWRQICSEDWTEMNSRVIC-GMYGFPG---------VKRFNVRPYKLLAQRRKKNYWGFGVNCTGNEADLSDC 250          

HSP 3 Score: 50.8322 bits (120), Expect = 2.901e-6
Identity = 60/236 (25.42%), Postives = 89/236 (37.71%), Query Frame = 2
Query:  170 EGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNY--FQSSGIKNYFMDDVYCFGNKSRIAYC----EFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YG---------KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHIN 829
            EG V V  G  W  IC + WT   + VIC   G     +F  + Y        KNY+   V C GN++ ++ C    E    G   C       + C         V+    +    ++ LV LR  +   ML +G V    +G    +C +N+      V+C ++ +G         K+G  I  + MN  +            C G E SLT+C     S G   E D  +  N
Sbjct:  178 EGFVEVKDGGKWRQICSEDWTEMNSRVICGMYGFPGVKRFNVRPYKLLAQRRKKNYWGFGVNCTGNEADLSDCKLGREIKLKGNSTCGRGMPTVISCVPGRAFAPSVSIGFRKAYRVEQPLVRLRGGA---MLGEGRVEVLRNGEWGTVCDDNWNIRAATVVCRELGFGSAKEALSGAKMGQGIGPVHMNEVE------------CSGFEKSLTECSFNLESLGCSHEEDAAVKCN 398          
BLAST of Lysyl oxidase vs. Ensembl Medaka
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101164651])

HSP 1 Score: 231.106 bits (588), Expect = 5.445e-67
Identity = 155/466 (33.26%), Postives = 222/466 (47.64%), Query Frame = 2
Query:   83 FTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVA-NVQREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQM-YGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVP-CESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSC 1471
             T Y K F + Q       V+L  G    EG V V     WG+ICDD W +  A V+C++LG   A +          G+    M++V C G +  I  C F G     C   E   V+C   A   Q+ +  +  R P      V + +N   +    G V SE  GI            E  V+C Q+  G      +      G+ +  + ++   RC G E SL+ CL +      P     K   ++C    PD+  +   VE+++YME   ++ LQCA  E CL  +  ++    P + +   R LLRFSS I N G S+F P     +W WH CH HYHSM++F  Y++     + VA GHKASFCLED+ C    +  ++C N     G QGI+ GC DTY H+ DCQW+D+++I PG Y FQ++INP + V E +Y NN   C   Y G+   + +C
Sbjct:  316 MTGYRKAFRQEQPL-----VRLRGGAIVGEGRVEVLKNGEWGTICDDKWNLLAATVVCRELGFGTAKEALSGGRL-GQGMGPVHMNEVQCSGFEKSITECLFNG-EILGCSHEEDAAVRCNVPAMGFQQRLRLSGGRNPYEGRVEVLMERNDSLVW---GTVCSEGWGI-----------MEAMVVCRQLGLGFASNAFQETWYWPGEVSADQVVMSGVRCSGTEMSLSHCLHHGEHLSCPRGGGRKAAGVSCSETAPDLVLNPQVVEQTTYMEDRPMFMLQCAYEENCLSSTSGQV----PANTY---RRLLRFSSQIHNNGQSDFRPKAGRHEWVWHECHRHYHSMEVFTTYDLFTLNGSKVAEGHKASFCLEDSECDEGIEKKYECANF----GEQGITVGCWDTYRHDIDCQWIDITDIKPGDYLFQIVINPNYEVPETDYTNNITKCRCRYDGHRIWMYNC 749          

HSP 2 Score: 65.855 bits (159), Expect = 5.304e-11
Identity = 68/306 (22.22%), Postives = 130/306 (42.48%), Query Frame = 2
Query:   20 KISDMSKLIITLKIFISFALIFTRYS-----KGFNELQKK-----LVDGDVKLV------DGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC-------YKVANV------QREVNWNPLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYG-----KLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCI 835
            K+S  ++L  T+ + +   L+  +Y       G+ + +++     ++D D   +      D     EG V V+    WG++CDD + +  A V+C++LG  +AV +   + +   G    + D++ C G +  +A C   G G  DC+  E VGV C       +K  N+        ++    +RI   +  L S RK   +I + +G V  +  G    +C   +    + V+C  M+G     +    +  +     K  Y  + V    C G E+ L+ C    +++   C     + ++C+
Sbjct:   12 KMSVQTELCCTVILLVLSKLVPAQYELHGYPPGYPDPEQEQYTPPVLDPDTPRIQLRLAGDKRKHNEGRVEVYYNGEWGTVCDDDFNIHAAQVVCRELGYVEAVSWSPSSKY-GKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSDCKHTEDVGVVCSDRRIPGFKFVNLLPNHVENLDIRVEDVRI---RAILSSYRK---RIPVTEGYVEVKDGGKWKQICDTEWTQFNSRVIC-GMFGFPGEKRYNARVYKMFARRRKPTYWDFSV---NCTGTEAHLSSCRLGHANSSDTCTEGLPVVVSCV 306          
BLAST of Lysyl oxidase vs. Planmine SMEST
Match: SMESG000004065.1 (SMESG000004065.1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 311/314 (99.04%), Postives = 313/314 (99.68%), Query Frame = 2
Query:  545 MLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
            MLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTG+FNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMI INCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGE+NYFNNGLSCTLYYMGYNAILRSCAWDHP
Sbjct:    1 MLEDGVVLSEVDGIRYPLCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGRFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCESDKMIQINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGESNYFNNGLSCTLYYMGYNAILRSCAWDHP 314          
BLAST of Lysyl oxidase vs. Planmine SMEST
Match: SMESG000078255.1 (SMESG000078255.1)

HSP 1 Score: 378.637 bits (971), Expect = 1.124e-126
Identity = 197/460 (42.83%), Postives = 267/460 (58.04%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVN-WNPLRIPLPKESLVSLRKNSFKIMLE----DGVVLSEVDGIRYP-----LCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYASSNGVPCE-SDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHP 1486
            V L++G    EGTV+V+    WG ICDD+W+  EANV+CK+LG   A++   ++YF+S+   +Y MDDV C G +  I  C F  W  HDC   +  G  CYK   V+R  N WNPL +   K  L  +   SF+++ +    +      V  I Y      +CPNNF   E  V+C QM    G  I L+   +   +    ++RL RCYGNE+ +  C  Y  +    C   +K I I C   LPD+  D  E++ S YM+ + I  + CA+ E C P  +Y++    P+SY  + R LLRFSSII N GT++F P + ++ WEWH CH H+HSM+ FAIYEI D++   V  GHKASFCLEDN+CV+  +  F C N   NKG+QGISPGC D YLH YDCQW+D+SE+  G YTF++I+NP F V E ++FNNG+SCTL        L  C   HP
Sbjct:   26 VMLLNGLFKNEGTVMVYNNNRWGPICDDNWSFKEANVVCKELGFSYALRATTEDYFRSNENDDYVMDDVSCIGTERSIFNCTF--WSDHDCGLGKAAGAICYKEPEVKRRKNEWNPLDLKFKKNQLKKMSMASFQVLFKHYTNENSSKYSVPVIFYQNQTGGVCPNNFGLLEATVMCRQMNLGYGKAIVLLNNPSNFISNEHNLLRLHRCYGNETIINDCQYYVGTGKNLCLFHNKSIQIECTDALPDLAPDVPEIQNSLYMDIVTIRSVSCAVEEGCFPPIVYRMKERAPYSYHVVQRRLLRFSSIISNFGTADFQPYQDKETWEWHACHQHFHSMEKFAIYEIYDRRMRKVTVGHKASFCLEDNMCVSGVQKKFLCSNLRSNKGSQGISPGCSDNYLHNYDCQWIDVSELQSGIYTFRVILNPDFLVPELSFFNNGVSCTLNLGDGFGSLTECRMVHP 483          
BLAST of Lysyl oxidase vs. Planmine SMEST
Match: SMESG000074486.1 (SMESG000074486.1)

HSP 1 Score: 229.18 bits (583), Expect = 1.308e-70
Identity = 123/314 (39.17%), Postives = 176/314 (56.05%), Query Frame = 2
Query:  590 YPLCPNNFKATENNVLCHQMYGKLGGTIELIP-MNTGKFNYSKYIVRLGRCYGNESSLTQCL-TYASSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALTEKCLPDS-IYKIINLHPHSYF------WITRTLLRFSSIIENIGTSNFLPLEKEDKWEWHGCHLHYHSMKLFAIYEI-------IDKKSNIVASGHKASFCLEDNLCVTESKPFFKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINPLFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDH 1483
            + +C +       NV+C QM   +  +I   P MNT +       +    CYGNE S+T+C+ +    NG  C++  ++ I C+  LP++  D   +E S Y+    I++L+CA+ E CL  S I K   L     +       I R LLRFSSII+N GT+ FLP    D WEWH CH H+HSM +FA Y+I       + +   ++ +GHKASFCLEDN+C+    P+F+C       GTQGI+PGC DTYLH  DCQW+D++ +    Y F+M+INP F V E++Y +N ++C LYY  +   L  C   H
Sbjct:   23 FSVCFDGSSVLAANVMCQQMNKGMAHSINKYPIMNTVELILH---INYSNCYGNELSITECVESIHMINGNKCKTSSILGIRCVLALPNLIPDVESLESSIYVHLEPIYNLKCAMEENCLVSSAIEKYGKLSQQQLYSIKDDKQIIRKLLRFSSIIKNSGTTAFLPHLTNDVWEWHKCHEHFHSMDIFAAYQIYNLSTTSLSETEGLLLAGHKASFCLEDNVCIDGVMPYFRCSKAKNITGTQGITPGCSDTYLHNIDCQWIDITNLPFNRYIFRMVINPHFLVAESDYHDNTIACELYYFSHYTGLHYCHLTH 333          
BLAST of Lysyl oxidase vs. Planmine SMEST
Match: SMESG000004062.1 (SMESG000004062.1)

HSP 1 Score: 196.052 bits (497), Expect = 3.767e-61
Identity = 93/103 (90.29%), Postives = 99/103 (96.12%), Query Frame = 2
Query:   32 MSKLIITLKIFISFALIFTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMD 340
            MSKLIITL+IFISFALIFTRYS+GFNELQKK+VDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWT+TEANVICKQLGMEKAVQFYKKNYFQSSGI    ++
Sbjct:    1 MSKLIITLRIFISFALIFTRYSEGFNELQKKIVDGDVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTITEANVICKQLGMEKAVQFYKKNYFQSSGISKLIIN 103          
BLAST of Lysyl oxidase vs. Planmine SMEST
Match: SMESG000016089.1 (SMESG000016089.1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.720e-14
Identity = 61/239 (25.52%), Postives = 104/239 (43.51%), Query Frame = 2
Query:  137 DVKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKN--YFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWNPLRIPLPKESLVSLRKNSFKIMLED------GVVLSEVDGIRYP-----------------LCPNNFKATENNVLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTY 778
            +++L    +  EG V +     WG ICDD +T++EA+VICKQLG  +A+++   +  +   +++    +D++ C G +  I  C    W KH+C+S E  GV C     V R       R    K  +   +    K+   D      G     V  +  P                 +C + F  +E +V+C +M G + G  + +          + ++   RC GNE+SL QC ++
Sbjct:  681 EIRLTGSKNDWEGKVEIRYQGEWGYICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVIC----KVDRACTNTEFRCQKDKTCIKMSQMCDGKVDCSDRSDEPEGQCFLSVKLVNGPDSYSGRVEIQRSLSKGTVCDDGFTDSEASVIC-RMLG-ISGRAQAVTDTRFGSGVGEIVLSNPRCRGNETSLVQCNSF 913          

HSP 2 Score: 65.4698 bits (158), Expect = 6.893e-11
Identity = 35/101 (34.65%), Postives = 51/101 (50.50%), Query Frame = 2
Query:  140 VKLVDGGSPKEGTVLVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNYFMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQC 442
            VKLV+G     G V +      G++CDD +T +EA+VIC+ LG+    Q      F  SG+    + +  C GN++ +  C    WG+H C   E  GV C
Sbjct:  831 VKLVNGPDSYSGRVEIQRSLSKGTVCDDGFTDSEASVICRMLGISGRAQAVTDTRF-GSGVGEIVLSNPRCRGNETSLVQCNSFKWGEHKCSHKEDAGVIC 930          

HSP 3 Score: 50.8322 bits (120), Expect = 2.291e-6
Identity = 23/63 (36.51%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  203 WGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSG---IKNYFMDDVYCFGNKSRIAYC 382
            WG +CDD+W + +ANV CKQLG   A +   +      G    K+Y +D + C G+++ I  C
Sbjct:  107 WGLVCDDYWNLPDANVSCKQLGFVNAAREATRQDHHGRGKWTKKDYIIDKIKCLGSEASIFEC 169          
The following BLAST results are available for this feature:
BLAST of Lysyl oxidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LOXL25.664e-6832.96lysyl oxidase like 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
LOXL42.714e-6632.15lysyl oxidase like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
LOXL32.075e-6430.56lysyl oxidase like 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
LOXL33.002e-6430.56lysyl oxidase like 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
LOXL32.485e-6230.79lysyl oxidase like 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C06B8.71.079e-731.19pep chromosome:WBcel235:V:15498743:15511421:1 gene... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Loxl24.218e-9833.07gene:FBgn0034660 transcript:FBtr0071745[more]
Loxl19.963e-4932.36gene:FBgn0039848 transcript:FBtr0085810[more]
teq1.669e-1724.74gene:FBgn0023479 transcript:FBtr0344980[more]
teq2.541e-1724.74gene:FBgn0023479 transcript:FBtr0076525[more]
teq3.562e-1724.74gene:FBgn0023479 transcript:FBtr0344981[more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
loxl2a4.698e-7033.71lysyl oxidase-like 2a [Source:NCBI gene;Acc:565508... [more]
loxl2b1.565e-6832.26lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144... [more]
loxl2b1.565e-6832.26lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144... [more]
loxl2b1.565e-6832.26lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144... [more]
loxl2b1.565e-6832.26lysyl oxidase-like 2b [Source:NCBI gene;Acc:791144... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
loxl23.270e-6731.28lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl23.270e-6731.28lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl27.000e-6731.28lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl27.747e-6731.28lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl28.774e-6731.28lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Loxl22.888e-6432.15lysyl oxidase-like 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Loxl22.888e-6432.15lysyl oxidase-like 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Loxl32.973e-6130.50lysyl oxidase-like 3 [Source:MGI Symbol;Acc:MGI:13... [more]
Loxl41.316e-5729.53lysyl oxidase-like 4 [Source:MGI Symbol;Acc:MGI:19... [more]
Loxl41.327e-5729.53lysyl oxidase-like 4 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Lysyl oxidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1QQC3|LOL2A_DANRE3.547e-6933.71Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN... [more]
sp|A1L1V4|LOL2B_DANRE1.181e-6732.26Lysyl oxidase homolog 2B OS=Danio rerio OX=7955 GN... [more]
sp|Q9Y4K0|LOXL2_HUMAN2.720e-6732.96Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q5RFQ6|LOXL2_PONAB3.138e-6732.96Lysyl oxidase homolog 2 OS=Pongo abelii OX=9601 GN... [more]
sp|A6H737|LOXL2_BOVIN1.171e-6632.66Lysyl oxidase homolog 2 OS=Bos taurus OX=9913 GN=L... [more]
back to top
BLAST of Lysyl oxidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A5L74.011e-17247.77Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RIM41.923e-17146.56Lysyl oxidase OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A4Z2CUN61.774e-17048.05Lysyl oxidase-like protein 3A isoform 1 OS=Schisto... [more]
A0A075ABB31.326e-16949.79Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LRG06.329e-16849.58Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
loxl3b1.432e-6931.73lysyl oxidase homolog 3B-like [Source:NCBI gene;Ac... [more]
loxl3b4.017e-6931.73lysyl oxidase homolog 3B-like [Source:NCBI gene;Ac... [more]
loxl2b6.320e-6831.83lysyl oxidase homolog 2B [Source:NCBI gene;Acc:103... [more]
loxl2b6.320e-6831.83lysyl oxidase homolog 2B [Source:NCBI gene;Acc:103... [more]
loxl3a4.692e-6430.13lysyl oxidase like 3 [Source:NCBI gene;Acc:1030453... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
loxl3a1.118e-5831.24lysyl oxidase-like 3a [Source:NCBI gene;Acc:568839... [more]
LOXL24.380e-5133.56lysyl oxidase like 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
LOXL22.729e-5036.55lysyl oxidase like 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSPMAT00000003501.15.225e-2028.91pep scaffold:Pmarinus_7.0:GL480380:12751:21659:1 g... [more]
ENSPMAT00000003504.11.372e-1928.91pep scaffold:Pmarinus_7.0:GL480380:12760:21677:1 g... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysyl oxidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO269804.764e-2733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377181.451e-2539.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398115.425e-2531.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274074.040e-2343.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398982.114e-2241.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysyl oxidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
loxl2a5.167e-6933.04lysyl oxidase homolog 2A [Source:NCBI gene;Acc:101... [more]
loxl2b4.527e-6733.26lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101... [more]
loxl2b4.527e-6733.26lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101... [more]
loxl2a4.906e-6733.04lysyl oxidase homolog 2A [Source:NCBI gene;Acc:101... [more]
loxl2b5.445e-6733.26lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Lysyl oxidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004065.10.000e+099.04SMESG000004065.1[more]
SMESG000078255.11.124e-12642.83SMESG000078255.1[more]
SMESG000074486.11.308e-7039.17SMESG000074486.1[more]
SMESG000004062.13.767e-6190.29SMESG000004062.1[more]
SMESG000016089.13.720e-1425.52SMESG000016089.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027243 ID=SMED30027243|Name=Lysyl oxidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1540bp
ACAAAACTCATTTTAATTGAAAATTTCGGACATGAGCAAGCTTATCATTA
CTTTGAAGATTTTTATTAGTTTTGCTTTAATTTTTACAAGATATTCAAAA
GGGTTTAACGAACTACAAAAGAAACTCGTTGATGGTGATGTAAAATTAGT
CGATGGTGGTTCTCCGAAAGAAGGAACAGTTTTAGTCTTTCTTGGATATG
GATGGGGTTCTATCTGTGACGATCACTGGACGATGACTGAGGCCAATGTC
ATATGTAAACAGCTTGGAATGGAAAAAGCTGTTCAGTTTTATAAAAAGAA
TTATTTCCAAAGTTCTGGAATAAAAAATTATTTTATGGATGACGTTTATT
GTTTTGGAAATAAATCTAGAATAGCCTATTGCGAGTTTCCAGGTTGGGGT
AAGCATGACTGTAGAAGTAATGAACAAGTCGGAGTGCAGTGTTACAAAGT
TGCAAATGTTCAAAGAGAAGTAAATTGGAATCCATTGCGTATACCTTTAC
CCAAAGAAAGTCTTGTCAGTCTAAGAAAAAACAGTTTCAAAATTATGTTA
GAAGATGGAGTTGTTCTTTCAGAAGTGGATGGGATAAGATATCCATTGTG
TCCTAATAACTTTAAAGCTACGGAAAATAATGTTTTATGTCACCAAATGT
ATGGAAAGCTTGGAGGAACGATTGAATTAATTCCAATGAATACTGGAAAA
TTCAATTATTCTAAATACATCGTAAGACTAGGAAGGTGTTATGGTAATGA
ATCAAGTTTGACTCAATGCCTTACGTATGCAAGTTCAAACGGTGTCCCTT
GTGAAAGTGACAAAATGATTCATATTAATTGCATTTCAGATTTACCGGAT
ATTAGGGCTGATTATGCAGAGGTTGAAAGGTCGTCTTACATGGAACGCCT
GAACATTTGGCATTTACAGTGCGCATTGACTGAAAAGTGTCTCCCAGATT
CTATTTATAAAATAATAAATCTTCATCCTCATTCTTATTTTTGGATTACG
AGAACACTGTTAAGATTTTCCAGTATAATAGAGAATATTGGAACGTCCAA
TTTTCTACCCTTAGAAAAAGAGGATAAATGGGAATGGCATGGTTGTCATT
TACATTATCATAGCATGAAGTTATTCGCTATTTATGAAATAATTGACAAG
AAATCAAACATTGTTGCCTCTGGTCACAAAGCCAGCTTTTGCCTAGAAGA
TAACTTATGCGTCACTGAATCAAAGCCTTTTTTTAAATGTGGTAATACGA
TGTTTAATAAAGGAACACAGGGAATATCTCCAGGTTGTAAAGATACATAT
TTACATGAATATGACTGTCAATGGGTTGATTTGAGTGAAATTACTCCTGG
AACGTATACATTTCAGATGATAATAAATCCCTTATTTGCTGTCGGTGAAA
ATAATTATTTCAATAATGGACTGAGTTGTACATTGTATTACATGGGTTAT
AATGCTATTTTGCGGTCTTGTGCATGGGATCACCCATATAATTTACTTTA
ATATTTAATGCTGTATCAATTGTTGTAAAATAAATTCTAG
back to top

protein sequence of SMED30027243-orf-1

>SMED30027243-orf-1 ID=SMED30027243-orf-1|Name=SMED30027243-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MSKLIITLKIFISFALIFTRYSKGFNELQKKLVDGDVKLVDGGSPKEGTV
LVFLGYGWGSICDDHWTMTEANVICKQLGMEKAVQFYKKNYFQSSGIKNY
FMDDVYCFGNKSRIAYCEFPGWGKHDCRSNEQVGVQCYKVANVQREVNWN
PLRIPLPKESLVSLRKNSFKIMLEDGVVLSEVDGIRYPLCPNNFKATENN
VLCHQMYGKLGGTIELIPMNTGKFNYSKYIVRLGRCYGNESSLTQCLTYA
SSNGVPCESDKMIHINCISDLPDIRADYAEVERSSYMERLNIWHLQCALT
EKCLPDSIYKIINLHPHSYFWITRTLLRFSSIIENIGTSNFLPLEKEDKW
EWHGCHLHYHSMKLFAIYEIIDKKSNIVASGHKASFCLEDNLCVTESKPF
FKCGNTMFNKGTQGISPGCKDTYLHEYDCQWVDLSEITPGTYTFQMIINP
LFAVGENNYFNNGLSCTLYYMGYNAILRSCAWDHPYNLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0055114oxidation-reduction process
GO:0006898receptor-mediated endocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036772SRCR-like_dom_sf
IPR001190SRCR
IPR001695Lysyl_oxidase
IPR017448SRCR-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005044scavenger receptor activity
GO:0005507copper ion binding
GO:0016641oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001695Lysyl oxidasePRINTSPR00074LYSYLOXIDASEcoord: 278..295
score: 50.0
coord: 235..257
score: 47.83
coord: 110..134
score: 33.0
coord: 258..277
score: 35.0
IPR001695Lysyl oxidasePFAMPF01186Lysyl_oxidasecoord: 101..310
e-value: 5.3E-74
score: 248.3
IPR036772SRCR-like domain superfamilyGENE3DG3DSA:3.10.250.10coord: 3..100
e-value: 5.0E-6
score: 28.3
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 10..98
IPR001190SRCR domainPFAMPF00530SRCRcoord: 12..96
e-value: 2.7E-6
score: 27.8
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 1..97
score: 8.338
NoneNo IPR availablePANTHERPTHR45817FAMILY NOT NAMEDcoord: 17..311
NoneNo IPR availablePANTHERPTHR45817:SF4LYSYL OXIDASE-LIKE-RELATEDcoord: 17..311