Tetratricopeptide repeat protein 30A

Overview
NameTetratricopeptide repeat protein 30A
Smed IDSMED30027239
Length (bp)2032
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat protein 30A (SMED30027239) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 30A (SMED30027239) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat protein 30A (SMED30027239) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 30A (SMED30027239) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027239

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027239h1SMcG0021158 SmedASXL_009624SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027239h1SMcG0021158 dd_Smed_v4_8798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027239h1SMcG0021158 dd_Smed_v4_8798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027239h1SMcG0021158 dd_Smed_v4_8798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027239h1SMcG0021158 Contig39615newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027239h1SMcG0021158 Contig39615uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30027239h1SMcG0021158 dd_Smed_v6_8798_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027239h1SMcG0021158 dd_Smed_v4_8798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Human
Match: TTC30B (tetratricopeptide repeat domain 30B [Source:HGNC Symbol;Acc:HGNC:26425])

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 444/654 (67.89%), Postives = 543/654 (83.03%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVT-CQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPP----------DDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            QI +GEFT+ +Y  I+  +Y EA+ +L  +L+  P SRA LSLLGYCY+++Q F  A++CYEQL QLHP++++Y+LY AQ+LYKA L+  A +V    +DN A+ ++VL+LQAAIKY E DL G+RSLVEQ P           ++ D  INLGCLL+KEG YEA+C+KF  A+Q   ++P L+YN+ L  Y  +QYA ALKHIA++IE+GIR+HPELGVGMTTEGI+VRSVGNTL L +TAL+E FNLKAAIEY LRN+  A EALTDMPPR+EEELD VTLHNQALM+MD  P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL++VI  QTAPEEA+ +LD +A   TE LRKLT  VQEAR N DD+++KK V EYDE +E+YIPVLM QAKIYW+LENY  VEKIFRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKK++DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y+DP+KK+YHLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KH I  +D+V+ +C+QFLEHCEL+GR++ A IEQPLEEE++H GKNTVTYE+R +K+L+ +++
Sbjct:    8 QIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEII 661          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Human
Match: TTC30A (tetratricopeptide repeat domain 30A [Source:HGNC Symbol;Acc:HGNC:25853])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 437/654 (66.82%), Postives = 538/654 (82.26%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVT-CQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQC----------PPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            QI +GEFT+ +Y  I++ +Y EA+ +L  +L+  P SRA LSLLGYCY+++Q F  A++CYEQL QLHP++++Y+LY AQ+LYKA L+  A +V    +DN A+ ++VL+LQAAIKY E DL G+RSLVEQ             ++ D  +NLGCLL+KEG YEA+C+KF   +Q   ++P L+YN+ L  Y  +QYA ALKHIA++IE+GIR+HPELGVGMTTEG +VRSVGNTL L +TAL+E FNLKAAIEY LRN+  A E LTDMPPR+EEELD VTLHNQALM+MD  P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LD +A   TEQLR+LTK VQEAR N DD+++KK V EYDE +E+YIPVLM QAKIYW+LENY  VEK+FRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKK++DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y+DP +K+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KHMI   D+V+ +C+QFL HCELYG ++ A IEQPLEEE++H GKNTVT E+R +K+L+ +++
Sbjct:    8 QIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDALITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKVFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHMIVIHDSVIQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEII 661          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Celegans
Match: dyf-1 (Tetratricopeptide repeat protein 30 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q8I7G4])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 318/649 (49.00%), Postives = 439/649 (67.64%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQ---EARQNHDDDSV--KKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN-ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            + I+EGEFTSTIY  I E K+ +AI +L  Q E  P + AALSLL YCY+  Q+F+ A+DCY QLS   P   +YKLY AQSLY A     A+ V   I +     + +KL+AAIKY EDDL+  R LVEQ P +D    IN  C+ +KEGNYE +  KF +A +   ++  LAY+I LC Y    Y  ALK I+++I +G+++HPE  +GM TEGI+V  + NT  L E+ALIE FNLK AI Y  +++  A E+LTDMPPR+E + D +TLHN A+ + + +      KLQFLL  + FP ETFANLL LY K DY+ LAADVLAEN    +  L++Y F+ LE++I   T PEE+ ++L+++  +  ++LRK    +Q   E +    DDS+  + L+  YD+ LE Y+PVLM  AK YWD  +Y+ VEK+FR SV++C EH+TWKLNVAH +FMQ+ KYK+A  FYEPIV K +D+ IL + A++LANL V YIMT+Q +EAE +++ +E EEEA     P +K +H  I++LVIG+LYC+KGN+EFGISRV+K+LEP +KKLG DTW+YAKRC ++ IE MAK+++  +D+V+++ IQFL  CE+ GR++    +   E+      K  VTYEARMIK+ L+ +
Sbjct:    5 LNIKEGEFTSTIYTLIHEHKFNDAIRILQYQHERNPKNLAALSLLAYCYYYTQDFMNAADCYSQLSYNFPQYSQYKLYHAQSLYNAFRPADALAVVSMIQDENLLNESVKLEAAIKYQEDDLVNCRILVEQLPENDAAVIINTACIDYKEGNYEEALKKFNEATEFSGYQSGLAYSIALCHYRRGDYDSALKLISEIINRGVKDHPEFNIGMVTEGIDVNFIQNTQKLHESALIEAFNLKFAIYYRTKDFKAAKESLTDMPPRNEHDADPITLHNLAISNANSDFGDSSAKLQFLLGINPFPQETFANLLFLYCKNDYFGLAADVLAENPSHTFYCLNEYQFNLLEALIYMPTNPEESLKKLEKLEKECLDRLRKTAIEIQIKKEQKTTDSDDSLEMRNLIESYDDSLEMYLPVLMTYAKYYWDKRDYQAVEKLFRNSVDYCKEHDTWKLNVAHTIFMQEKKYKDAAAFYEPIVHKKYDDGILEVPAMILANLVVCYIMTNQTDEAELILKAVENEEEAALMMKPNEKFFHNSIISLVIGSLYCSKGNFEFGISRVVKALEPPEKKLGVDTWYYAKRCIVAAIELMAKNLLVMRDSVVMEVIQFLTSCEVPGRNIYTVPDDLFEQAGESKVKCNVTYEARMIKAALLMV 653          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Celegans
Match: dyf-1 (Tetratricopeptide repeat protein 30 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q8I7G4])

HSP 1 Score: 516.538 bits (1329), Expect = 1.492e-176
Identity = 288/595 (48.40%), Postives = 401/595 (67.39%), Query Frame = 2
Query:  260 VQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQ---EARQNHDDDSV--KKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN-ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            + A+DCY QLS   P   +YKLY AQSLY A     A+ V   I +     + +KL+AAIKY EDDL+  R LVEQ P +D    IN  C+ +KEGNYE +  KF +A +   ++  LAY+I LC Y    Y  ALK I+++I +G+++HPE  +GM TEGI+V  + NT  L E+ALIE FNLK AI Y  +++  A E+LTDMPPR+E + D +TLHN A+ + + +      KLQFLL  + FP ETFANLL LY K DY+ LAADVLAEN    +  L++Y F+ LE++I   T PEE+ ++L+++  +  ++LRK    +Q   E +    DDS+  + L+  YD+ LE Y+PVLM  AK YWD  +Y+ VEK+FR SV++C EH+TWKLNVAH +FMQ+ KYK+A  FYEPIV K +D+ IL + A++LANL V YIMT+Q +EAE +++ +E EEEA     P +K +H  I++LVIG+LYC+KGN+EFGISRV+K+LEP +KKLG DTW+YAKRC ++ IE MAK+++  +D+V+++ IQFL  CE+ GR++    +   E+      K  VTYEARMIK+ L+ + 
Sbjct:    1 MNAADCYSQLSYNFPQYSQYKLYHAQSLYNAFRPADALAVVSMIQDENLLNESVKLEAAIKYQEDDLVNCRILVEQLPENDAAVIINTACIDYKEGNYEEALKKFNEATEFSGYQSGLAYSIALCHYRRGDYDSALKLISEIINRGVKDHPEFNIGMVTEGIDVNFIQNTQKLHESALIEAFNLKFAIYYRTKDFKAAKESLTDMPPRNEHDADPITLHNLAISNANSDFGDSSAKLQFLLGINPFPQETFANLLFLYCKNDYFGLAADVLAENPSHTFYCLNEYQFNLLEALIYMPTNPEESLKKLEKLEKECLDRLRKTAIEIQIKKEQKTTDSDDSLEMRNLIESYDDSLEMYLPVLMTYAKYYWDKRDYQAVEKLFRNSVDYCKEHDTWKLNVAHTIFMQEKKYKDAAAFYEPIVHKKYDDGILEVPAMILANLVVCYIMTNQTDEAELILKAVENEEEAALMMKPNEKFFHNSIISLVIGSLYCSKGNFEFGISRVVKALEPPEKKLGVDTWYYAKRCIVAAIELMAKNLLVMRDSVVMEVIQFLTSCEVPGRNIYTVPDDLFEQAGESKVKCNVTYEARMIKAALLMVF 595          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Celegans
Match: dyf-1 (Tetratricopeptide repeat protein 30 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q8I7G4])

HSP 1 Score: 516.538 bits (1329), Expect = 1.492e-176
Identity = 288/595 (48.40%), Postives = 401/595 (67.39%), Query Frame = 2
Query:  260 VQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQ---EARQNHDDDSV--KKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN-ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            + A+DCY QLS   P   +YKLY AQSLY A     A+ V   I +     + +KL+AAIKY EDDL+  R LVEQ P +D    IN  C+ +KEGNYE +  KF +A +   ++  LAY+I LC Y    Y  ALK I+++I +G+++HPE  +GM TEGI+V  + NT  L E+ALIE FNLK AI Y  +++  A E+LTDMPPR+E + D +TLHN A+ + + +      KLQFLL  + FP ETFANLL LY K DY+ LAADVLAEN    +  L++Y F+ LE++I   T PEE+ ++L+++  +  ++LRK    +Q   E +    DDS+  + L+  YD+ LE Y+PVLM  AK YWD  +Y+ VEK+FR SV++C EH+TWKLNVAH +FMQ+ KYK+A  FYEPIV K +D+ IL + A++LANL V YIMT+Q +EAE +++ +E EEEA     P +K +H  I++LVIG+LYC+KGN+EFGISRV+K+LEP +KKLG DTW+YAKRC ++ IE MAK+++  +D+V+++ IQFL  CE+ GR++    +   E+      K  VTYEARMIK+ L+ + 
Sbjct:    1 MNAADCYSQLSYNFPQYSQYKLYHAQSLYNAFRPADALAVVSMIQDENLLNESVKLEAAIKYQEDDLVNCRILVEQLPENDAAVIINTACIDYKEGNYEEALKKFNEATEFSGYQSGLAYSIALCHYRRGDYDSALKLISEIINRGVKDHPEFNIGMVTEGIDVNFIQNTQKLHESALIEAFNLKFAIYYRTKDFKAAKESLTDMPPRNEHDADPITLHNLAISNANSDFGDSSAKLQFLLGINPFPQETFANLLFLYCKNDYFGLAADVLAENPSHTFYCLNEYQFNLLEALIYMPTNPEESLKKLEKLEKECLDRLRKTAIEIQIKKEQKTTDSDDSLEMRNLIESYDDSLEMYLPVLMTYAKYYWDKRDYQAVEKLFRNSVDYCKEHDTWKLNVAHTIFMQEKKYKDAAAFYEPIVHKKYDDGILEVPAMILANLVVCYIMTNQTDEAELILKAVENEEEAALMMKPNEKFFHNSIISLVIGSLYCSKGNFEFGISRVVKALEPPEKKLGVDTWYYAKRCIVAAIELMAKNLLVMRDSVVMEVIQFLTSCEVPGRNIYTVPDDLFEQAGESKVKCNVTYEARMIKAALLMVF 595          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Fly
Match: Ttc30 (gene:FBgn0032470 transcript:FBtr0301366)

HSP 1 Score: 501.516 bits (1290), Expect = 7.288e-170
Identity = 283/612 (46.24%), Postives = 400/612 (65.36%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDN--SAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVG--MTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIE-PAPGFQKLQFLLQ--QDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQ-KKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYG 1912
            +REG  T TIY  IK+++Y++ I  +    E+  T RA LS LG+CY+  Q + +A+ CYEQL QL P   +Y+ Y+AQSLY+AG+F  A++V  Q+ +     + + L+LQ+AI Y  +D  GA+SL+ Q      DT  + GCLLF+   +EA+  +FQ A+QV  F P +AYN+ L  +  KQ A AL + ++++E+G+R HPELG+G  M       RSVGN +T+  + + +  NLKAAIE+   N   A +AL D+PPR+E ELD VTLHN AL   D+E P  G +KL FLL+    + P ETFAN+LL+  K + Y+ AAD+LAE+T+L YKYLSQY ++ L+S+I  QT+ E A ++L  +A+    +LR L   VQE R  ++  +++  + +Y++ LE Y+PV+M +A I W  +++   E+ F  S EFC+E+  W+LN  HVLFMQ +KY EA  FYEPIV+++ D+I+ +SA VLANLCV+YIMT QNEEAEELMRK+EK EE     +  K+ +HLCIVNLV+GTLYCAK NYEFG+SR+  +LE     +L  DTW + K C L L+  MAK  I    A + + + FL  CE YG
Sbjct:    8 LREGHVTRTIYNLIKDKRYEDVIECITSFGEAANT-RAGLSTLGHCYYHAQKYEEAATCYEQLCQLAPKEAKYRFYYAQSLYQAGIFADALRVLKQMGDQEDELREQCLQLQSAILYSSEDFAGAQSLLNQRAGGTADTLNDEGCLLFQADQHEAAVQRFQAALQVGGFNPLVAYNVALAHFQKKQRAQALDYTSEIVERGMRNHPELGIGAQMDIPDGGARSVGNPITMAISGITQALNLKAAIEFQDGNEEAARDALLDLPPRAESELDPVTLHNMALT--DVEGPVAGLRKLAFLLELGAPSCPKETFANILLICCKNELYETAADILAEHTDLTYKYLSQYLYELLDSLITAQTSAELAEKKLGTLASSLAGKLRSLAAKVQEVRATNEQQALRDALKDYEQALELYLPVVMARAWISWRDDDFVGAEREFHASAEFCSENSIWRLNAGHVLFMQGDKYNEAAAFYEPIVRQHSDDIMSVSAAVLANLCVSYIMTFQNEEAEELMRKVEKAEEMKG--NLGKQYHHLCIVNLVVGTLYCAKSNYEFGLSRIAHALESGSGNRLYADTWLHVKHCILGLLTGMAKQNIILPYATVQEVLNFLRFCESYG 614          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Fly
Match: Ttc30 (gene:FBgn0032470 transcript:FBtr0336855)

HSP 1 Score: 501.516 bits (1290), Expect = 7.288e-170
Identity = 283/612 (46.24%), Postives = 400/612 (65.36%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDN--SAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVG--MTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIE-PAPGFQKLQFLLQ--QDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQ-KKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYG 1912
            +REG  T TIY  IK+++Y++ I  +    E+  T RA LS LG+CY+  Q + +A+ CYEQL QL P   +Y+ Y+AQSLY+AG+F  A++V  Q+ +     + + L+LQ+AI Y  +D  GA+SL+ Q      DT  + GCLLF+   +EA+  +FQ A+QV  F P +AYN+ L  +  KQ A AL + ++++E+G+R HPELG+G  M       RSVGN +T+  + + +  NLKAAIE+   N   A +AL D+PPR+E ELD VTLHN AL   D+E P  G +KL FLL+    + P ETFAN+LL+  K + Y+ AAD+LAE+T+L YKYLSQY ++ L+S+I  QT+ E A ++L  +A+    +LR L   VQE R  ++  +++  + +Y++ LE Y+PV+M +A I W  +++   E+ F  S EFC+E+  W+LN  HVLFMQ +KY EA  FYEPIV+++ D+I+ +SA VLANLCV+YIMT QNEEAEELMRK+EK EE     +  K+ +HLCIVNLV+GTLYCAK NYEFG+SR+  +LE     +L  DTW + K C L L+  MAK  I    A + + + FL  CE YG
Sbjct:    8 LREGHVTRTIYNLIKDKRYEDVIECITSFGEAANT-RAGLSTLGHCYYHAQKYEEAATCYEQLCQLAPKEAKYRFYYAQSLYQAGIFADALRVLKQMGDQEDELREQCLQLQSAILYSSEDFAGAQSLLNQRAGGTADTLNDEGCLLFQADQHEAAVQRFQAALQVGGFNPLVAYNVALAHFQKKQRAQALDYTSEIVERGMRNHPELGIGAQMDIPDGGARSVGNPITMAISGITQALNLKAAIEFQDGNEEAARDALLDLPPRAESELDPVTLHNMALT--DVEGPVAGLRKLAFLLELGAPSCPKETFANILLICCKNELYETAADILAEHTDLTYKYLSQYLYELLDSLITAQTSAELAEKKLGTLASSLAGKLRSLAAKVQEVRATNEQQALRDALKDYEQALELYLPVVMARAWISWRDDDFVGAEREFHASAEFCSENSIWRLNAGHVLFMQGDKYNEAAAFYEPIVRQHSDDIMSVSAAVLANLCVSYIMTFQNEEAEELMRKVEKAEEMKG--NLGKQYHHLCIVNLVVGTLYCAKSNYEFGLSRIAHALESGSGNRLYADTWLHVKHCILGLLTGMAKQNIILPYATVQEVLNFLRFCESYG 614          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Zebrafish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 455/643 (70.76%), Postives = 550/643 (85.54%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            M I++GE+T+T+Y  IKE +Y +AI +L+ + + +  SRAALSLLGYCY+ MQ+F  A++CYEQL+QLHP+V++YKLY+AQSLY A  F  AMK T  +DN+    K++KLQAAIKYGE+D  GA++LVEQ P +DPD  ++LGCLL+KEG +E +C KF  +M VL ++P LAYNI LC Y +KQYA ALK+IA++IE+GIREHPEL +GMTTEGI+VRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y ++FL+++I  QTAPEEA+R+ DE A K TEQLRK+TK VQEAR N DD+S+KK V +YDEVLE+YIPVLM QAKIYW+ ENY  VEKIF KS+EFCNEH+TWKLNVAHVLFMQDNKYKEAIGFYEPIVKK+++NIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y+DP+KK++HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFYAKRCFLSL+ENMAKHMI  +D+V+ +CIQFLEHCELYG+DV A IEQPLEE+++H GKNTVTYE+R+IK+L  ++
Sbjct:    4 MTIKDGEYTATVYKMIKEGRYGDAIHILSKEHQKHTKSRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRKVTKQVQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLLENMAKHMIMLRDSVVQECIQFLEHCELYGKDVLAIIEQPLEEDRMHIGKNTVTYESRLIKALFYEV 646          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Zebrafish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 897.886 bits (2319), Expect = 0.000e+0
Identity = 455/659 (69.04%), Postives = 550/659 (83.46%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN----------------ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            M I++GE+T+T+Y  IKE +Y +AI +L+ + + +  SRAALSLLGYCY+ MQ+F  A++CYEQL+QLHP+V++YKLY+AQSLY A  F  AMK T  +DN+    K++KLQAAIKYGE+D  GA++LVEQ P +DPD  ++LGCLL+KEG +E +C KF  +M VL ++P LAYNI LC Y +KQYA ALK+IA++IE+GIREHPEL +GMTTEGI+VRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y ++FL+++I  QTAPEEA+R+ DE A K TEQLRK+TK VQEAR N DD+S+KK V +YDEVLE+YIPVLM QAKIYW+ ENY  VEKIF KS+EFCNEH+TWKLNVAHVLFMQDNKYKEAIGFYEPIVKK+++N                IL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y+DP+KK++HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFYAKRCFLSL+ENMAKHMI  +D+V+ +CIQFLEHCELYG+DV A IEQPLEE+++H GKNTVTYE+R+IK+L  ++
Sbjct:    4 MTIKDGEYTATVYKMIKEGRYGDAIHILSKEHQKHTKSRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRKVTKQVQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENLEQCNIQECPCKTKPSILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLLENMAKHMIMLRDSVVQECIQFLEHCELYGKDVLAIIEQPLEEDRMHIGKNTVTYESRLIKALFYEV 662          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Zebrafish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 448/643 (69.67%), Postives = 536/643 (83.36%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            M I++GE+T+T+Y                        SRAALSLLGYCY+ MQ+F  A++CYEQL+QLHP+V++YKLY+AQSLY A  F  AMK T  +DN+    K++KLQAAIKYGE+D  GA++LVEQ P +DPD  ++LGCLL+KEG +E +C KF  +M VL ++P LAYNI LC Y +KQYA ALK+IA++IE+GIREHPEL +GMTTEGI+VRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y ++FL+++I  QTAPEEA+R+ DE A K TEQLRK+TK VQEAR N DD+S+KK V +YDEVLE+YIPVLM QAKIYW+ ENY  VEKIF KS+EFCNEH+TWKLNVAHVLFMQDNKYKEAIGFYEPIVKK+++NIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y+DP+KK++HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFYAKRCFLSL+ENMAKHMI  +D+V+ +CIQFLEHCELYG+DV A IEQPLEE+++H GKNTVTYE+R+IK+L  ++
Sbjct:    4 MTIKDGEYTATVYKM----------------------SRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRKVTKQVQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLLENMAKHMIMLRDSVVQECIQFLEHCELYGKDVLAIIEQPLEEDRMHIGKNTVTYESRLIKALFYEV 624          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Zebrafish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 368/534 (68.91%), Postives = 447/534 (83.71%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIG 1696
            M I++GE+T+T+Y  IKE +Y +AI +L+ + + +  SRAALSLLGYCY+ MQ+F  A++CYEQL+QLHP+V++YKLY+AQSLY A  F  AMK T  +DN+    K++KLQAAIKYGE+D  GA++LVEQ P +DPD  ++LGCLL+KEG +E +C KF  +M VL ++P LAYNI LC Y +KQYA ALK+IA++IE+GIREHPEL +GMTTEGI+VRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y ++FL+++I  QTAPEEA+R+ DE A K TEQLRK    VQEAR N DD+S+KK V +YDEVLE+YIPVLM QAKIYW+ ENY  VEKIF KS+EFCNEH+TWKLNVAHVLFMQDNKYKEAIGFYEPIVKK+++NIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y+DP+KK++HLCIVNLVIG
Sbjct:    4 MTIKDGEYTATVYKMIKEGRYGDAIHILSKEHQKHTKSRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRK----VQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIG 533          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Xenopus
Match: ttc30a (tetratricopeptide repeat domain 30a [Source:NCBI gene;Acc:100124881])

HSP 1 Score: 937.176 bits (2421), Expect = 0.000e+0
Identity = 467/642 (72.74%), Postives = 561/642 (87.38%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            QI++GE+T+TIY  IKE +Y EAI +L+ +L+    SRA LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +D+SA+++K+LKLQA+I+YGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DNIL +SA VLANLCV+YIMTSQNEEAEELMRKIEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+ +C+QFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:    5 QIKDGEYTATIYKLIKEARYGEAIQILSNELQKQYRSRAGLSLLGYCYYQIQDFVNAADCYEQLIQITPEVEEYKLYYAQSLYKACMYPEAMKATFALDSSAYQSKMLKLQASIRYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSYNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFFKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDNILNVSAAVLANLCVSYIMTSQNEEAEELMRKIEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIAECLQFLEHCEIYGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 646          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Xenopus
Match: ttc30a (tetratricopeptide repeat domain 30a [Source:NCBI gene;Acc:100124881])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 448/604 (74.17%), Postives = 533/604 (88.25%), Query Frame = 2
Query:  212 AALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            A LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +D+SA+++K+LKLQA+I+YGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DNIL +SA VLANLCV+YIMTSQNEEAEELMRKIEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+ +C+QFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:    5 AGLSLLGYCYYQIQDFVNAADCYEQLIQITPEVEEYKLYYAQSLYKACMYPEAMKATFALDSSAYQSKMLKLQASIRYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSYNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFFKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDNILNVSAAVLANLCVSYIMTSQNEEAEELMRKIEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIAECLQFLEHCEIYGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 608          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Xenopus
Match: ttc30a (tetratricopeptide repeat domain 30a [Source:NCBI gene;Acc:100124881])

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 450/612 (73.53%), Postives = 535/612 (87.42%), Query Frame = 2
Query:  206 SRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN------ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            SRA LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +D+SA+++K+LKLQA+I+YGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DN      IL +SA VLANLCV+YIMTSQNEEAEELMRKIEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+ +C+QFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:    2 SRAGLSLLGYCYYQIQDFVNAADCYEQLIQITPEVEEYKLYYAQSLYKACMYPEAMKATFALDSSAYQSKMLKLQASIRYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSYNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFFKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDNVIVLFQILNVSAAVLANLCVSYIMTSQNEEAEELMRKIEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIAECLQFLEHCEIYGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 613          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Xenopus
Match: ttc30a (tetratricopeptide repeat domain 30a [Source:NCBI gene;Acc:100124881])

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 445/642 (69.31%), Postives = 538/642 (83.80%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            QI++GE+T+TIY  IKE +Y EAI +L+ +L+    SRA LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +D+SA+++K+LKLQA+I+YGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DN       V  NLC   +M             IEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+ +C+QFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:    5 QIKDGEYTATIYKLIKEARYGEAIQILSNELQKQYRSRAGLSLLGYCYYQIQDFVNAADCYEQLIQITPEVEEYKLYYAQSLYKACMYPEAMKATFALDSSAYQSKMLKLQASIRYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSYNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFFKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDN-------VKCNLCAEELMRK-----------IEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIAECLQFLEHCEIYGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 628          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Xenopus
Match: ttc30a (tetratricopeptide repeat domain 30a [Source:NCBI gene;Acc:100124881])

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 447/618 (72.33%), Postives = 532/618 (86.08%), Query Frame = 2
Query:  212 AALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN--------------ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
              LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +D+SA+++K+LKLQA+I+YGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DN              IL +SA VLANLCV+YIMTSQNEEAEELMRKIEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+ +C+QFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:   27 TGLSLLGYCYYQIQDFVNAADCYEQLIQITPEVEEYKLYYAQSLYKACMYPEAMKATFALDSSAYQSKMLKLQASIRYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSYNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFFKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDNVNKYYCNIQFVLFQILNVSAAVLANLCVSYIMTSQNEEAEELMRKIEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIAECLQFLEHCEIYGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 644          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Mouse
Match: Ttc30a1 (tetratricopeptide repeat domain 30A1 [Source:MGI Symbol;Acc:MGI:1926052])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 446/657 (67.88%), Postives = 549/657 (83.56%), Query Frame = 2
Query:   86 QMSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQC----------PPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            Q S ++ +GEFT+ +Y  I++ +Y EA+ +L+ +L+    SRA LSLL YCY+++Q F  A++CYEQLSQ+HP++++Y+LY AQ+LYKA L+  A +VT  +DN A++ +VL+LQAAIKY E DL GARSLVEQ             +DPD  +N+GCLL+KEG+YEA+C+KF  A+Q   ++P L+YN+ L  Y  +QYAPALKHIAD+IE+GIR+HPELGVGMTTEGI+VRSVGNT+ L +TALIE FNLKAAIEY LRN+  A E LTDMPPR+EEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LD +A   TEQLR+LTK VQEAR N DD+ +KK + EYDE LE+YIPVLM QAKIYW+LENY  VEKIFRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKKN+DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y DP+KK+YHLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KHMI   D V+ +C+QFLE+CELYGR++ A +EQPLEEE+IH GKNTVTYE+R++K+L+ +++
Sbjct:    4 QSSSKVPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVTFLLDNPAYQTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGNTVVLHQTALIEAFNLKAAIEYQLRNFEVAQETLTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEIIKKAMNEYDETLEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHMIVLCDGVVQECVQFLEYCELYGRNIPAVLEQPLEEERIHTGKNTVTYESRLLKALIYEVI 660          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Mouse
Match: Ttc30b (tetratricopeptide repeat domain 30B [Source:MGI Symbol;Acc:MGI:1919671])

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 444/655 (67.79%), Postives = 544/655 (83.05%), Query Frame = 2
Query:   92 SMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQC----------PPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            S QI +GEFT+ +Y  I++ +Y EA+ +L+ +L+    SRA LSLL YCY+++Q F  A++CYEQLSQ+HP++++Y+LY AQ+LYKA L+  A +V   +DN A++ +VL+LQAAIKY E DL GARSLVEQ              D D  INLGCLL+KEG+YEA+C+KF  A+Q   ++P L+YN+ L  Y  +QYAPALKHIAD+IE+GIR+HPELGVGMTTEGI+VRSVGNT+ L +TAL+E FNLKAAIEY LRN+  A EALTDMPPR+EEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LD +A   TEQLRKLT  VQ++R + DD+S KK V EYDE LE+YIPVLM QAKIYW+ ENY  VEKIFRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKKN+DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y DP+KK+YHLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KH I  +D+V+ +C+QFLEHCELYGR++ A IEQPLEEE++H GKNTVTYE+R +++L+ +++
Sbjct:    6 SSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPAYQTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEGVEDSGGESDYDGQINLGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGNTIVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRKLTIQVQDSRHSRDDESAKKAVNEYDETLEKYIPVLMAQAKIYWNFENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELYGRNIPAVIEQPLEEERMHTGKNTVTYESRKLRALIYEII 660          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Mouse
Match: Ttc30a2 (tetratricopeptide repeat domain 30A2 [Source:MGI Symbol;Acc:MGI:3700200])

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 441/653 (67.53%), Postives = 544/653 (83.31%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQC----------PPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            QI +GEFT+ +Y  I++ +Y EA+ +L+ +L+    SRA LSLL YCY+++Q F  A++CYEQLSQ+HP++++Y+LY AQ+LYKA L+  A +V   +DN  F ++VL+LQAAIKY E DL GARSLVEQ             +DPD  +N+GCLL+KEG+YEA+C+KF  A+Q   ++P ++YN+ L  Y  + YAPALKHIA++IE+GIR+HPELGVGMTTEGI+VRSVGNT+ L +TAL+E FNLKAAIEY LRN+  A EALTDMPPR+EEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LD +A   TEQLR+LTK VQEAR N DD+ V K V EYDE LE+YIPVLM QAKIYW+LENY  VEKIFRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKKN+DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y DP+KK+YHLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KH I  +D+V+ +C+QFLEHCE++GR++ A IEQPLEEE++H GKNTVTYE+R +K+L+ +++
Sbjct:    8 QIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPTFYSRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFFAALQASGYQPDVSYNLALACYSNRHYAPALKHIANIIERGIRQHPELGVGMTTEGIDVRSVGNTVVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEVVIKAVNEYDETLEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCEIFGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALIYEII 660          
BLAST of Tetratricopeptide repeat protein 30A vs. UniProt/SwissProt
Match: sp|Q6INU8|TT30A_XENLA (Tetratricopeptide repeat protein 30A OS=Xenopus laevis OX=8355 GN=ttc30a PE=2 SV=1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 468/642 (72.90%), Postives = 562/642 (87.54%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            QI++GE+T+TIY  IKE +Y EAI VL+ +L+    SRA LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +DN+A+++K+LKLQA++KYGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L++NI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DNIL +SA VLANLCV+YIMTSQNEEAEELMRKIEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+++CIQFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:    5 QIKDGEYTATIYRLIKEARYGEAIQVLSNELQKQYRSRAGLSLLGYCYYQIQDFVNAADCYEQLIQISPEVEEYKLYYAQSLYKACMYPEAMKATFALDNAAYQSKMLKLQASVKYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSFNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYSKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFLKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDNILNVSAAVLANLCVSYIMTSQNEEAEELMRKIEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIVECIQFLEHCEIYGRNILAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 646          
BLAST of Tetratricopeptide repeat protein 30A vs. UniProt/SwissProt
Match: sp|A4IHR1|TT30A_XENTR (Tetratricopeptide repeat protein 30A OS=Xenopus tropicalis OX=8364 GN=ttc30a PE=2 SV=1)

HSP 1 Score: 937.176 bits (2421), Expect = 0.000e+0
Identity = 467/642 (72.74%), Postives = 561/642 (87.38%), Query Frame = 2
Query:   98 QIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            QI++GE+T+TIY  IKE +Y EAI +L+ +L+    SRA LSLLGYCY+Q+Q+FV A+DCYEQL Q+ P+V+EYKLY+AQSLYKA ++  AMK T  +D+SA+++K+LKLQA+I+YGE+D+ GA+SLVEQ P +DP++ IN+GCLL+KEG+YE +C KF  AMQV+ ++  L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPELGVGMTTEGIEVRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LDE+A   TEQ+RKLTK VQEAR N DD++VKK V EYDE LE+YIPVLM QAKIYW++ENY+ VEKIFRKSVEFCNEH+ WKLNVAHVLFMQDNKYKEAIGFYEPIVKK++DNIL +SA VLANLCV+YIMTSQNEEAEELMRKIEKEEE +AYE+P+KK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTW++AKRCFLSL+ENM+KHMI  +D V+ +C+QFLEHCE+YGR++ A IEQPLEEE++H GKNTVTYE+R +K+LL ++
Sbjct:    5 QIKDGEYTATIYKLIKEARYGEAIQILSNELQKQYRSRAGLSLLGYCYYQIQDFVNAADCYEQLIQITPEVEEYKLYYAQSLYKACMYPEAMKATFALDSSAYQSKMLKLQASIRYGEEDISGAKSLVEQMPSEDPESEINMGCLLYKEGHYEEACKKFITAMQVMGYKQDLSYNIALCYYSMKQYAPALKHIADIIERGIREHPELGVGMTTEGIEVRSVGNTLVLHETALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFFKLDELAGMLTEQMRKLTKQVQEARHNRDDEAVKKAVNEYDETLEKYIPVLMAQAKIYWNMENYQMVEKIFRKSVEFCNEHDIWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYDNILNVSAAVLANLCVSYIMTSQNEEAEELMRKIEKEEEQIAYENPDKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYHAKRCFLSLLENMSKHMIMLRDDVIAECLQFLEHCEIYGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALLYEI 646          
BLAST of Tetratricopeptide repeat protein 30A vs. UniProt/SwissProt
Match: sp|A7YE96|TT30A_DANRE (Tetratricopeptide repeat protein 30A OS=Danio rerio OX=7955 GN=ttc30a PE=2 SV=2)

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 455/643 (70.76%), Postives = 550/643 (85.54%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQL 2023
            M I++GE+T+T+Y  IKE +Y +AI +L+ + + +  SRAALSLLGYCY+ MQ+F  A++CYEQL+QLHP+V++YKLY+AQSLY A  F  AMK T  +DN+    K++KLQAAIKYGE+D  GA++LVEQ P +DPD  ++LGCLL+KEG +E +C KF  +M VL ++P LAYNI LC Y +KQYA ALK+IA++IE+GIREHPEL +GMTTEGI+VRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD +P  GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y ++FL+++I  QTAPEEA+R+ DE A K TEQLRK+TK VQEAR N DD+S+KK V +YDEVLE+YIPVLM QAKIYW+ ENY  VEKIF KS+EFCNEH+TWKLNVAHVLFMQDNKYKEAIGFYEPIVKK+++NIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y+DP+KK++HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFYAKRCFLSL+ENMAKHMI  +D+V+ +CIQFLEHCELYG+DV A IEQPLEE+++H GKNTVTYE+R+IK+L  ++
Sbjct:    4 MTIKDGEYTATVYKMIKEGRYGDAIHILSKEHQKHTKSRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRKVTKQVQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLLENMAKHMIMLRDSVVQECIQFLEHCELYGKDVLAIIEQPLEEDRMHIGKNTVTYESRLIKALFYEV 646          
BLAST of Tetratricopeptide repeat protein 30A vs. UniProt/SwissProt
Match: sp|B2RYD6|TT30B_RAT (Tetratricopeptide repeat protein 30B OS=Rattus norvegicus OX=10116 GN=Ttc30b PE=2 SV=1)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 443/655 (67.63%), Postives = 546/655 (83.36%), Query Frame = 2
Query:   92 SMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQC----------PPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            S QI +GEFT+ +Y  I++ +Y EA+ +L+ +L+  P SRA LSLL YCY+++Q F  A++CYEQLSQ+HP++++Y+LY AQ+LYKA L+  A +V   +DN  ++ +VL+LQAAIKY E DL GARSLVEQ             +D D  INLGCLL+KEG+YEA+C+KF  A+Q   ++P ++YN+ L  Y  +QYAPALKHIAD+IE+GIR+HPELGVGMTTEGI+VRSVGNT+ L +TAL+E FNLKAAIEY LRN+  A EALTDMPPR+EEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LD +A   TEQLR+LT  VQ+AR + DD+S KK V +YDE LE+YIPVLM QAKIYW+LENY  VEKIFRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKKN+DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y+DP+KK+YHLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KH I  +D+V+ +C+QFLEHCELYGR + A IEQPLEEE++H GKNTVTYE+R +++L+ +++
Sbjct:    6 SSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQGSPRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPTYQTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEGAEDSGGENDYDGQINLGCLLYKEGHYEAACSKFLAALQASGYQPDISYNLALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGNTIVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTIQVQDARHSRDDESAKKAVNDYDETLEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELYGRSIPAIIEQPLEEERMHTGKNTVTYESRKLRALIYEII 660          
BLAST of Tetratricopeptide repeat protein 30A vs. UniProt/SwissProt
Match: sp|Q99J38|T30A1_MOUSE (Tetratricopeptide repeat protein 30A1 OS=Mus musculus OX=10090 GN=Ttc30a1 PE=1 SV=1)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 446/657 (67.88%), Postives = 549/657 (83.56%), Query Frame = 2
Query:   86 QMSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQC----------PPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            Q S ++ +GEFT+ +Y  I++ +Y EA+ +L+ +L+    SRA LSLL YCY+++Q F  A++CYEQLSQ+HP++++Y+LY AQ+LYKA L+  A +VT  +DN A++ +VL+LQAAIKY E DL GARSLVEQ             +DPD  +N+GCLL+KEG+YEA+C+KF  A+Q   ++P L+YN+ L  Y  +QYAPALKHIAD+IE+GIR+HPELGVGMTTEGI+VRSVGNT+ L +TALIE FNLKAAIEY LRN+  A E LTDMPPR+EEELD VTLHNQALM+MD +P  GF+KLQFLLQQ+ FPPETF NLLLLY KY+Y+DLAADVLAEN  L YK+L+ Y +DFL+++I  QTAPEEA+ +LD +A   TEQLR+LTK VQEAR N DD+ +KK + EYDE LE+YIPVLM QAKIYW+LENY  VEKIFRKSVEFCN+H+ WKLNVAHVLFMQ+NKYKEAIGFYEPIVKKN+DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE L+Y DP+KK+YHLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTW+YAKRCFLSL+ENM+KHMI   D V+ +C+QFLE+CELYGR++ A +EQPLEEE+IH GKNTVTYE+R++K+L+ +++
Sbjct:    4 QSSSKVPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVTFLLDNPAYQTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGNTVVLHQTALIEAFNLKAAIEYQLRNFEVAQETLTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEIIKKAMNEYDETLEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHMIVLCDGVVQECVQFLEYCELYGRNIPAVLEQPLEEERIHTGKNTVTYESRLLKALIYEVI 660          
BLAST of Tetratricopeptide repeat protein 30A vs. TrEMBL
Match: A0A074ZVF7 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02356 PE=4 SV=1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 500/646 (77.40%), Postives = 584/646 (90.40%), Query Frame = 2
Query:   89 MSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            +++QIREGEFTSTIYG IKEQKYKEA+ +LN QL ++P SRAALSLLGYC++QMQ FV ASDCYEQL+QL+P+V+EYKL FAQSLYK+ LF  AMK+  QI++  ++ KV+KLQAAI+YGE DL GARSLVEQ   DDP++ +NLGCL ++EGNYE +C  FQ+A+Q L F+P+LAYNI LC Y +KQYA ALKHIADVIE+GIR+HPELGVGMTTEG+EVRSVGNTLTL+ETAL+ETFNLKAAIEYNL+N   A+EALTDMPPR+EEELDH+TLHNQALM+MD EPA GFQKLQFLLQQ+TFP ETFANLLLLYIKY+Y+DLAADVLAEN  L Y+YLS   +DF+E+VI+RQ+AP++AY RLD+MA K TEQLR+LTK+VQEARQ  DD++VKK V +YD  LERYIPVLMQQAKIYWD+ENY+QVEKIFRKSVEFCN+H  WKLNVAHVLFMQ+NKYKEA GFYEPIVKK+FDNILG+SA++LANLCV YIMTSQNE+AEELMRKIEKEEEA+ YEDPE+KV+HLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLG+DTW+YAKRCFLSLIEN+AKHMI  +DAVLLDCIQFLEHCELYGRDVKAFIEQPL+  K+HPG+NTVTYEAR++KSLL++++
Sbjct:  199 IAVQIREGEFTSTIYGAIKEQKYKEAVAILNQQLLTHPGSRAALSLLGYCFYQMQEFVNASDCYEQLTQLYPEVEEYKLLFAQSLYKSDLFPAAMKMAVQIEDPKYREKVVKLQAAIRYGEGDLAGARSLVEQSLTDDPESIVNLGCLFYREGNYEQACQHFQQAIQTLGFQPTLAYNIALCYYQLKQYAQALKHIADVIERGIRDHPELGVGMTTEGLEVRSVGNTLTLRETALVETFNLKAAIEYNLKNPTAASEALTDMPPRTEEELDHITLHNQALMNMDNEPAAGFQKLQFLLQQETFPAETFANLLLLYIKYEYFDLAADVLAENAPLAYEYLSPELYDFIEAVILRQSAPQDAYNRLDQMAAKHTEQLRRLTKAVQEARQAQDDEAVKKAVCDYDSALERYIPVLMQQAKIYWDMENYQQVEKIFRKSVEFCNDHRVWKLNVAHVLFMQENKYKEASGFYEPIVKKHFDNILGVSAVILANLCVTYIMTSQNEDAEELMRKIEKEEEAITYEDPERKVFHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGSDTWYYAKRCFLSLIENLAKHMILVRDAVLLDCIQFLEHCELYGRDVKAFIEQPLDSVKVHPGQNTVTYEARLLKSLLLEII 844          
BLAST of Tetratricopeptide repeat protein 30A vs. TrEMBL
Match: A0A210QYA4 (Tetratricopeptide repeat protein 30A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05103 PE=4 SV=1)

HSP 1 Score: 1008.44 bits (2606), Expect = 0.000e+0
Identity = 498/644 (77.33%), Postives = 575/644 (89.29%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            +Q++EGEFTSTIYG I+EQ+Y EA+ VLN QL+S+  SRAALSLLGYC+FQMQ+FV ASDCYEQLS +HP+V+EYKLY+AQSLYKA LF  AMKV CQIDN  ++ ++ KLQAAIKYGE+DL G++SLVEQCP DDPDT INLGCLLFK+  +E +C KF  AMQ++ +RP L+YNI LC Y MKQYAPALKHIAD+IEKGIREHPEL VGMTTEGI+VRSVGNTL L ETALIE FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+M++ P  GF+K+QFLLQQ+ FPPETF NLLLLY+K++YYDLAADVLAEN  L YKYL+ Y +DFLE+VI RQT+PEEAYR+LDEMA  QTE LRKLTK VQEARQNHDD++VK+ V +YDE LERYIPVLMQQAKIYWD+ENY+QVEKIFRKSVEFCNEH+ WKLNVAHVLFMQ+NKYKE+ GFYEPIVKKN+DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE +AY+DPEKK++HLCIVNLVIGTLYCAKGNYEFGI+RVIKSLEPYQKKLGTDTW+YAKRCFLSLIENM+KHMI  +D+V+ +C+ FLE CE+YGRDVKA IEQPLE E +HPGKNTVTYEAR++K+LL+QL+
Sbjct:    4 LQVKEGEFTSTIYGMIREQRYNEAVQVLNNQLQSHQKSRAALSLLGYCHFQMQDFVNASDCYEQLSYMHPEVEEYKLYYAQSLYKACLFTEAMKVACQIDNPQYQGQITKLQAAIKYGEEDLPGSKSLVEQCPADDPDTEINLGCLLFKDNRFEEACQKFTTAMQIIGYRPDLSYNIALCHYQMKQYAPALKHIADIIEKGIREHPELSVGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNFEAACEALTDMPPRSEEELDAVTLHNQALMNMELTPTKGFEKMQFLLQQNPFPPETFGNLLLLYVKFEYYDLAADVLAENAHLTYKYLTPYMYDFLEAVITRQTSPEEAYRKLDEMATSQTETLRKLTKQVQEARQNHDDEAVKRAVNDYDEALERYIPVLMQQAKIYWDMENYQQVEKIFRKSVEFCNEHDIWKLNVAHVLFMQENKYKESSGFYEPIVKKNYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQVAYDDPEKKIFHLCIVNLVIGTLYCAKGNYEFGITRVIKSLEPYQKKLGTDTWYYAKRCFLSLIENMSKHMIMLRDSVVQECVAFLECCEMYGRDVKAMIEQPLEAEPMHPGKNTVTYEARILKNLLLQLV 647          
BLAST of Tetratricopeptide repeat protein 30A vs. TrEMBL
Match: G7YJ98 (Tetratricopeptide repeat protein 30A OS=Clonorchis sinensis OX=79923 GN=CLF_109373 PE=4 SV=1)

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 499/646 (77.24%), Postives = 583/646 (90.25%), Query Frame = 2
Query:   89 MSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            +++QIREGEFTSTIYG IKEQKYKEA+ +LN QL ++P +RAALSLLGYC++QMQ FV ASDCYEQL+QL+P+++EYKL FAQSLYK+ LF  AMK+  QI++  ++ KV+KLQAAI+YGE DL GARSLVEQ   DDP++  NLGCL ++EGNYE +C  FQ+A+Q L F+P+LAYNI LC Y +KQYA ALKHIADVIE+GIR+HPELGVGMTTEG+EVRSVGNTLTL+ETAL+ETFNLKAAIEYNL+N   A+EALTDMPPR+EEELDH+TLHNQALM+MD EPA GFQKLQFLLQQ+TFP ETFANLLLLYIKY+Y+DLAADVLAEN  L Y+YLS   +DF+E+VI+RQ+AP++AY RLD+MA K TEQLR+LTK+VQEARQ  DD++VKK V +YD  LERYIPVLMQQAKIYWD+ENY+QVEKIFRKSVEFCN+H  WKLNVAHVLFMQ+NKYKEA GFYEPIVKK+FDNILG+SA++LANLCV YIMTSQNE+AEELMRKIEKEEEA+ YEDPE+KV+HLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLG+DTW+YAKRCFLSLIEN+AKHMI  +DAVLLDCIQFLEHCELYGRDVKAFIEQPL+  K+HPG+NTVTYEAR++KSLL+++M
Sbjct:    2 IAVQIREGEFTSTIYGAIKEQKYKEAVSILNQQLLTHPGNRAALSLLGYCFYQMQEFVNASDCYEQLTQLYPEIEEYKLLFAQSLYKSDLFPAAMKMAVQIEDPKYREKVVKLQAAIRYGEGDLAGARSLVEQSLADDPESIANLGCLFYREGNYEQACHYFQQAIQTLGFQPTLAYNIALCYYQLKQYAQALKHIADVIERGIRDHPELGVGMTTEGLEVRSVGNTLTLRETALVETFNLKAAIEYNLKNPTAASEALTDMPPRTEEELDHITLHNQALMNMDNEPAAGFQKLQFLLQQETFPAETFANLLLLYIKYEYFDLAADVLAENAPLAYEYLSPELYDFIEAVILRQSAPQDAYNRLDQMAAKHTEQLRRLTKAVQEARQAQDDEAVKKAVCDYDSALERYIPVLMQQAKIYWDMENYQQVEKIFRKSVEFCNDHRVWKLNVAHVLFMQENKYKEASGFYEPIVKKHFDNILGVSAVILANLCVTYIMTSQNEDAEELMRKIEKEEEAITYEDPERKVFHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGSDTWYYAKRCFLSLIENLAKHMILVRDAVLLDCIQFLEHCELYGRDVKAFIEQPLDSVKVHPGQNTVTYEARLLKSLLLEIM 647          
BLAST of Tetratricopeptide repeat protein 30A vs. TrEMBL
Match: A0A4S2LVK2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005759 PE=4 SV=1)

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 497/646 (76.93%), Postives = 584/646 (90.40%), Query Frame = 2
Query:   89 MSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            +++QIREGEFTSTIYG IKEQKYKEA+ +LN QL ++P +RAALSLLGYC++QMQ FV ASDCYEQL+QL+P+++EYKL FAQSLYK+ LF  AMK+  QI++  ++ KV+KLQAAI+YGE DL GARSLVEQ   DD ++ +NLGCLL++EGNYE +C  FQ+A+Q L F+P+LAYNI LC Y ++QYA ALKHIADVIE+GIR+HPELGVGMTTEG+EVRSVGNTLTL+ETAL+ETFNLKAAIEYNL+N   A+EALTDMPPR+EEELDH+TLHNQALM+MD EPA GFQKLQFLLQQ+TFP ETFANLLLLYIKY+Y+DLAADVLAEN  L Y+YLS   +DF+E+VI+RQ+AP++AY RLD+MA K TEQLR+LTK+VQEARQ  DD++VKK V +YD  LERYIPVLMQQAKIYWD+ENY+QVEKIFRKSVEFCN+H  WKLNVAHVLFMQ+NKYKEA GFYEPIVKK+FDNILG+SA++LANLCV YIMTSQNE+AEELMRKIEKEEEA+ YEDP++KV+HLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLG+DTW+YAKRCFLSLIEN+AKHMI  +DAVLLDCIQFLEHCELYGRDVKAFIEQPL+  K+HPG+NTVTYEAR++KSLL+++M
Sbjct:    3 VAVQIREGEFTSTIYGAIKEQKYKEAVAMLNQQLLTHPGNRAALSLLGYCFYQMQEFVNASDCYEQLTQLYPEIEEYKLLFAQSLYKSDLFPAAMKMAVQIEDPKYREKVVKLQAAIRYGEGDLAGARSLVEQSLADDSESIVNLGCLLYREGNYEQACQHFQQAIQTLGFQPTLAYNIALCYYQLRQYAQALKHIADVIERGIRDHPELGVGMTTEGLEVRSVGNTLTLRETALVETFNLKAAIEYNLKNPTAASEALTDMPPRTEEELDHITLHNQALMNMDNEPAAGFQKLQFLLQQETFPAETFANLLLLYIKYEYFDLAADVLAENAPLAYEYLSPELYDFIEAVILRQSAPQDAYNRLDQMAAKHTEQLRRLTKAVQEARQAQDDEAVKKAVCDYDSALERYIPVLMQQAKIYWDMENYQQVEKIFRKSVEFCNDHRVWKLNVAHVLFMQENKYKEASGFYEPIVKKHFDNILGVSAVILANLCVTYIMTSQNEDAEELMRKIEKEEEAITYEDPDRKVFHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGSDTWYYAKRCFLSLIENLAKHMILVRDAVLLDCIQFLEHCELYGRDVKAFIEQPLDSVKVHPGQNTVTYEARLLKSLLLEIM 648          
BLAST of Tetratricopeptide repeat protein 30A vs. TrEMBL
Match: A0A2T7PYT7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01184 PE=4 SV=1)

HSP 1 Score: 998.038 bits (2579), Expect = 0.000e+0
Identity = 498/634 (78.55%), Postives = 564/634 (88.96%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEAR 1996
            +Q++EGE+TSTIYG IK+Q+Y EA+ +LN QL+S+P SRAALS+L YCY+QMQ+FV ASDCYEQL+ LHP+V+EY+LY+AQSLYKA LF+ AMKVTCQID   ++ ++ KLQAAIKYGE+DL  A+SLVEQCP DDPDT IN GCLLFKE  Y+ +C KF +AMQV+ ++P L+YNI LC Y MKQYAPALKHIAD+IE+GIREHPEL VGMTTEGI+VRSVGN+LTL ETAL+E FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+M+ EP  GFQKLQFLLQQ+ FPPETF NLLLLYIKY+YYDLAADVLAEN  L YK L  Y +DFLE+VI RQT+PEEAYRRLDEMA KQTE LRKLTK VQEARQNHDD++VK+ V EYDE LERYIPVLMQQAKIYWD+ENY+QVEKIFRKSVEFCNEH+ WKLNVAHVLFMQ+NKYKEA GFY+PIVKKN+D++L +SAIVLANLCV+ IMTSQNEEAEELMRKIEKEEE LAYEDPEKK+YHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPY KKLGTDTWFYAKRCFLSLIENMAKHMI  +D+V+ +CIQFLE CELYGRDVKA IEQPLEEE +HPG+NTV YEAR
Sbjct:    4 LQMKEGEYTSTIYGLIKDQRYNEAMQILNHQLQSHPRSRAALSVLAYCYYQMQDFVNASDCYEQLASLHPEVEEYRLYYAQSLYKACLFQEAMKVTCQIDQPHYQGQITKLQAAIKYGEEDLPAAKSLVEQCPSDDPDTEINFGCLLFKEARYDEACQKFTQAMQVVGYKPDLSYNIALCHYTMKQYAPALKHIADIIERGIREHPELSVGMTTEGIDVRSVGNSLTLHETALVEAFNLKAAIEYQLKNYEAACEALTDMPPRSEEELDAVTLHNQALMNMEAEPTRGFQKLQFLLQQNPFPPETFGNLLLLYIKYEYYDLAADVLAENAHLTYKLLIPYLYDFLEAVITRQTSPEEAYRRLDEMATKQTETLRKLTKQVQEARQNHDDEAVKRTVNEYDEALERYIPVLMQQAKIYWDMENYQQVEKIFRKSVEFCNEHDIWKLNVAHVLFMQENKYKEAAGFYDPIVKKNYDSLLSVSAIVLANLCVSCIMTSQNEEAEELMRKIEKEEEQLAYEDPEKKIYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLIENMAKHMIMIRDSVITECIQFLECCELYGRDVKATIEQPLEEEPMHPGRNTVAYEAR 637          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Cavefish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 450/638 (70.53%), Postives = 540/638 (84.64%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLL 2014
            I++GE+T+T+Y  IK+ +Y +AI +L+ +L+    SRAALSLLGYCY+ MQ+F  A++CYEQL QLHP+V++YKLY+AQSLY A  F+ AMK T  +DN     K++KLQAAIKYGE+D   A +LVEQ   DDPDT ++ GCLL+K G YE +C KF  AMQVL ++P LAYNI LC Y +KQYA ALK+I ++IE+G+REHPELGVGMTTEGIEV+SVGNTL L ETALIE FNLKAAIEY L+    A EALTDMPPRSEEELD VTLHNQALM+MD +P+ GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADV+AEN  L YK+LS Y ++FL++++  QT+PEEA+R+LDE+A + TEQLRK+TK VQE+R+  DD+ +KK + +YD++LE YIPVLM QAKIYW+ ENY  VEKIFRKSVEFCNEH+TWKLNVAHVLFMQ+NKYKEAIGFYEPIVKK++DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y DP+KKV+HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFY KRCFLSL+ENMAKHMI  +D V+ DC+QFLE+CELYGR+V A IEQPLEEE++H GKNTVTYEARMIK+L 
Sbjct:    6 IKDGEYTATVYKMIKDGRYGDAIHILSNELQKQMKSRAALSLLGYCYYHMQDFTNAAECYEQLIQLHPEVEDYKLYYAQSLYGACAFQEAMKATFTLDNPTSHTKMIKLQAAIKYGEEDFPAAMALVEQLTVDDPDTDVDQGCLLYKLGEYEKACVKFVTAMQVLGYQPDLAYNIALCHYSLKQYAAALKYIGEIIERGMREHPELGVGMTTEGIEVKSVGNTLVLHETALIEAFNLKAAIEYQLKKHDAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPSEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVMAENAHLTYKFLSTYLYEFLDAMLTSQTSPEEAFRKLDEIAARLTEQLRKVTKQVQESRRTRDDEGLKKSLEDYDQLLEEYIPVLMAQAKIYWNRENYNMVEKIFRKSVEFCNEHDTWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQVSYNDPDKKVFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYIKRCFLSLLENMAKHMIMLRDTVVQDCVQFLENCELYGRNVPAVIEQPLEEERMHIGKNTVTYEARMIKALF 643          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Cavefish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 865.529 bits (2235), Expect = 0.000e+0
Identity = 450/658 (68.39%), Postives = 543/658 (82.52%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDN----------------ILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            I++GE+T+T+Y  IK+ +Y +AI +L+ +L+    SRAALSLLGYCY+ MQ+F  A++CYEQL QLHP+V++YKLY+AQSLY A  F+ AMK T  +DN     K++KLQAAIKYGE+D   A +LVEQ   DDPDT ++ GCLL+K G YE +C KF  AMQVL ++P LAYNI LC Y +KQYA ALK+I ++IE+G+REHPELGVGMTTEGIEV+SVGNTL L ETALIE FNLKAAIEY L+    A EALTDMPPRSEEELD VTLHNQALM+MD +P+ GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADV+AEN  L YK+LS Y ++FL++++  QT+PEEA+R+LDE+A + TEQLRK+TK VQE+R+  DD+ +KK + +YD++LE YIPVLM QAKIYW+ ENY  VEKIFRKSVEFCNEH+TWKLNVAHVLFMQ+NKYKEAIGFYEPIVKK++DN                IL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y DP+KKV+HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFY KRCFLSL+ENMAKHMI  +D V+ DC+QFLE+CELYGR+V A IEQPLEEE++H GKNTVTYEARMIK+L  +++
Sbjct:    6 IKDGEYTATVYKMIKDGRYGDAIHILSNELQKQMKSRAALSLLGYCYYHMQDFTNAAECYEQLIQLHPEVEDYKLYYAQSLYGACAFQEAMKATFTLDNPTSHTKMIKLQAAIKYGEEDFPAAMALVEQLTVDDPDTDVDQGCLLYKLGEYEKACVKFVTAMQVLGYQPDLAYNIALCHYSLKQYAAALKYIGEIIERGMREHPELGVGMTTEGIEVKSVGNTLVLHETALIEAFNLKAAIEYQLKKHDAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPSEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVMAENAHLTYKFLSTYLYEFLDAMLTSQTSPEEAFRKLDEIAARLTEQLRKVTKQVQESRRTRDDEGLKKSLEDYDQLLEEYIPVLMAQAKIYWNRENYNMVEKIFRKSVEFCNEHDTWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNLEQCNIQECPCKRKPSILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQVSYNDPDKKVFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYIKRCFLSLLENMAKHMIMLRDTVVQDCVQFLENCELYGRNVPAVIEQPLEEERMHIGKNTVTYEARMIKALFYEVI 663          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Cavefish
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 423/622 (68.01%), Postives = 501/622 (80.55%), Query Frame = 2
Query:  161 EAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            +AI +L+ +L+    SRAALSLLGYCY+ MQ+F  A++CYEQL QLHP+V++YKLY+AQSLY A  F+ AMK T  +DN     K++KLQAAIKYGE+D   A +LVEQ   DDPDT ++ GCLL+K G YE +C KF  AMQVL ++P LAYNI LC Y +KQYA ALK+I ++IE+G+REHPELGVGMTTEGIEV+SVGNTL L ETALIE FNLKAAIEY L+    A EALTDMPPRSEEELD VTLHNQALM+MD +P+ GF+KL FLLQQ+ FPP TF NLLLLY KY+Y+DLAADV+AEN  L YK+LS           +R       Y     + N+    L+     VQE+R+  DD+ +KK + +YD++LE YIPVLM QAKIYW+ ENY  VEKIFRKSVEFCNEH+TWKLNVAHVLFMQ+NKYKEAIGFYEPIVKK++DNIL +SAIVLANLCV+YIMTSQNEEAEELMRKIEKEEE ++Y DP+KKV+HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFY KRCFLSL+ENMAKHMI  +D V+ DC+QFLE+CELYGR+V A IEQPLEEE++H GKNTVTYEARMIK+L  +++
Sbjct:    1 DAIHILSNELQKQMKSRAALSLLGYCYYHMQDFTNAAECYEQLIQLHPEVEDYKLYYAQSLYGACAFQEAMKATFTLDNPTSHTKMIKLQAAIKYGEEDFPAAMALVEQLTVDDPDTDVDQGCLLYKLGEYEKACVKFVTAMQVLGYQPDLAYNIALCHYSLKQYAAALKYIGEIIERGMREHPELGVGMTTEGIEVKSVGNTLVLHETALIEAFNLKAAIEYQLKKHDAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPSEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVMAENAHLTYKFLS----------TVRDAVFNSTY-----LENRFVSSLK-----VQESRRTRDDEGLKKSLEDYDQLLEEYIPVLMAQAKIYWNRENYNMVEKIFRKSVEFCNEHDTWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQVSYNDPDKKVFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYIKRCFLSLLENMAKHMIMLRDTVVQDCVQFLENCELYGRNVPAVIEQPLEEERMHIGKNTVTYEARMIKALFYEVI 602          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Sea Lamprey
Match: flr (fleer [Source:NCBI gene;Acc:797829])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 337/501 (67.27%), Postives = 402/501 (80.24%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQL---HPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTK-SVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQN 1585
            + +  GE    +Y  IK+ +Y EAI +LN +L+  P SR ALSLL YC FQMQ+F  A++CYE L+Q      +  EY+L  AQSLY+A  +  A+K T  ++  A++AKVLKLQAAIKYGEDDL GA+SLVEQC  DDPDT  NLGCLL+KEG+++ +C +F  AMQ+  +RP L+YN+ LC Y MKQYAPALKHIAD+IEKGIR HPEL VGMTTEGIEVRSVGNT  L ETAL+E FNLKAAIEY L+N+  A EALTDMPPRSEEELD VTLHNQALM+MD  P+ GF+KLQFLLQQ+TFPPETF NLLLLY K++YYDLAADVLAEN  L YK L+ Y + FL+++I  QTAPEEA+ + DEMA+K TEQLRKLTK  VQ+AR N DDD VKK V +YDEVLER++PVLM QA+IYW+ E+Y  VE++FRKSVEFC+EH+ WKLNVAHVLFMQ+ KYKEA GFYEPIVKKN+ NILG+SAIVLANLCV+YIMTSQN
Sbjct:    4 LSLEVGEIVIYMYRQIKDGRYGEAIEILNNELQKQPKSRPALSLLAYCSFQMQDFAVAAECYESLAQQAGPGDEGAEYRLRHAQSLYRASAYAEALKATLAMEGPAYQAKVLKLQAAIKYGEDDLTGAKSLVEQCAADDPDTENNLGCLLYKEGHFDEACLRFTTAMQLASYRPDLSYNLALCYYSMKQYAPALKHIADIIEKGIRTHPELSVGMTTEGIEVRSVGNTQVLHETALVEAFNLKAAIEYQLKNFEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTRPSEGFEKLQFLLQQETFPPETFGNLLLLYCKHEYYDLAADVLAENAHLTYKLLTPYLYQFLDAMITCQTAPEEAFHKFDEMASKLTEQLRKLTKQQVQDARANRDDDGVKKAVNDYDEVLERFVPVLMAQARIYWERESYAAVERLFRKSVEFCSEHDVWKLNVAHVLFMQEGKYKEATGFYEPIVKKNYGNILGVSAIVLANLCVSYIMTSQN 504          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Nematostella
Match: EDO48384 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJI3])

HSP 1 Score: 967.992 bits (2501), Expect = 0.000e+0
Identity = 483/645 (74.88%), Postives = 559/645 (86.67%), Query Frame = 2
Query:   92 SMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLM 2026
            +  I+EGE+T+TIYG IK Q++ EAI +LN +L ++P SRAALSLLGYCYFQ+QNF  +SDCY QL ++HP+V EYKLY+AQSL+KA  +  A K T QI+N  F +KVLKLQAAIKY EDDL GA+S+VEQC  +DPDT +NLGCLLFKE  Y  +C KFQ AM V  ++P L+YNI LC Y MKQYAPALKHIAD+IEKGIREHPEL VGMTTEGIEVRSVGNT  LQ+TALIE FNLKAAIEY L+N+  A EALTDMPPR+EEELD V+LHNQALM+M+  P  GF+KLQFLLQQ+ FPPETF NLLLLYIKY YYDLAADVLAEN +L YK+L  Y +DFL+++I +QT+PEEAYR+ D+MA KQTE LRKLTK VQEARQNHDD+SVKK V EYDE LERYIPVLM QAKIYWDLENY QVEKIFRKSVEFCNEHE WKLNVAHVLFMQ+NKYKEA+GFYEPIVKK++DNIL +SAIVLANLCV+YIMTS NEEAEELMRKIEKEEE +AY+DPEKK+YHLCIVNLVIGTLYCAKGNYEFGISR++KSLEPY KKLGTDTWFY+KRCFLSLIENM+KHMI  +D V+ + IQF+EHCE+YG++V A +EQPLEEE++HPGKNTVTYEAR++KSL M+L+
Sbjct:    3 TFNIKEGEYTTTIYGMIKAQRFNEAIQILNHELGNHPKSRAALSLLGYCYFQVQNFESSSDCYAQLIEIHPEVDEYKLYYAQSLFKACQYAEATKATFQIENPTFNSKVLKLQAAIKYEEDDLQGAKSMVEQCSNEDPDTEVNLGCLLFKEKQYSEACQKFQTAMNVKGYQPDLSYNIALCYYSMKQYAPALKHIADIIEKGIREHPELSVGMTTEGIEVRSVGNTKVLQQTALIEAFNLKAAIEYQLKNYEAAQEALTDMPPRAEEELDAVSLHNQALMNMETAPTQGFEKLQFLLQQNPFPPETFGNLLLLYIKYQYYDLAADVLAENAQLTYKFLQPYMYDFLDAMITQQTSPEEAYRKFDDMATKQTETLRKLTKLVQEARQNHDDESVKKAVNEYDEALERYIPVLMAQAKIYWDLENYAQVEKIFRKSVEFCNEHEVWKLNVAHVLFMQENKYKEAVGFYEPIVKKHYDNILSVSAIVLANLCVSYIMTSANEEAEELMRKIEKEEEQVAYDDPEKKIYHLCIVNLVIGTLYCAKGNYEFGISRIMKSLEPYNKKLGTDTWFYSKRCFLSLIENMSKHMIMLRDNVVQEIIQFMEHCEMYGKNVPALVEQPLEEERMHPGKNTVTYEARLLKSLFMRLV 647          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Nematostella
Match: EDO26427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC17])

HSP 1 Score: 121.709 bits (304), Expect = 8.050e-32
Identity = 58/88 (65.91%), Postives = 70/88 (79.55%), Query Frame = 2
Query:  278 YEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFK 541
            Y QL ++HP+V EYKLY+AQSL+KA  +  A K T QI+N  F +KVLKLQAAIKY EDDL GA+S+VEQC  +DPDT +NLGCLLFK
Sbjct:    1 YAQLIEIHPEVDEYKLYYAQSLFKACQYAEATKATFQIENPTFNSKVLKLQAAIKYEEDDLQGAKSMVEQCSNEDPDTEVNLGCLLFK 88          

HSP 2 Score: 85.1149 bits (209), Expect = 4.430e-19
Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = 2
Query:  890 EELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYL 1105
            +ELD V+LHNQALM+M+  P  GF+KLQFLLQQ+ FPPETF NLLLLYIKY YYDLAADVLAEN +L YK+L
Sbjct:  111 KELDAVSLHNQALMNMETAPTQGFEKLQFLLQQNPFPPETFGNLLLLYIKYQYYDLAADVLAENAQLTYKFL 182          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Nematostella
Match: EDO29767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2P8])

HSP 1 Score: 98.5969 bits (244), Expect = 5.456e-22
Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 2
Query: 1634 LAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKK 1774
            +AY+DPEKK+YHLCIVNLVIGTLYCAKGNYEFGISR++KSLEPY KK
Sbjct:   88 VAYDDPEKKIYHLCIVNLVIGTLYCAKGNYEFGISRIMKSLEPYNKK 134          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Medaka
Match: flr (tetratricopeptide repeat protein 30A [Source:NCBI gene;Acc:101171914])

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 411/638 (64.42%), Postives = 518/638 (81.19%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLL 2014
            I++G++T+T+Y  I++ +Y EA  +LN QL  +  SRAALSLLG+CY+ +Q+F  A++CYEQL+QLHP+V+EYKLY+AQSLYKAG +  A K +  +DN A   K++KLQA IKY E+D   A+SL+E  P +D D   N GCLL++EG YE +C  F  A+QVL F P+L YN+ L  Y +K Y  ALK+IA++IE+GI+EHPEL VG++TEG +V SVGNTL L ++ALIE FNLKAAIE+ L+N   A EALTDMPPRSEEELD VTLHNQALM+MD  P+ GF+KL FL+QQ  FPP  F NLLLLY K +Y+DLAADVLAEN  L YK+LS Y +++L++ +  QTAPEEA R+ +EM+ K TEQ RKLTK VQ+AR + D+++ KK + EYD ++ERYI VLM QAKIYW+ EN++ VEK+FR S++ C + +TWKLNVAHVLFMQ NKYKEAIGFYEPIVKK++DNIL +SA+VLANLCV+YIMT+QNEEAEELMRKIEKEEE ++Y+DP+KKV+HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFYAKRCFLSL+ENM+K M+  +DA++ +C+QFLEHCE YG++V A IEQPLEE  +H GKNTVTYEAR++K+L 
Sbjct:    4 IKDGDYTATVYKLIQDCQYGEACHILNTQLHKHNKSRAALSLLGFCYYHLQDFPAAAECYEQLTQLHPEVEEYKLYYAQSLYKAGAYAEATKASFALDNPASHLKMVKLQACIKYCEEDHAAAKSLLELLPQEDSDYVYNTGCLLYQEGKYEDACRSFMSAVQVLGFVPALYYNVALTFYSLKNYPQALKYIAEIIERGIKEHPELSVGVSTEGADVHSVGNTLLLHQSALIEAFNLKAAIEFQLKNLKAAQEALTDMPPRSEEELDPVTLHNQALMNMDPRPSEGFEKLSFLVQQPAFPPVCFGNLLLLYCKNEYFDLAADVLAENAHLTYKFLSPYMYEYLDASLTSQTAPEEALRKFEEMSGKLTEQHRKLTKQVQDARLSRDEEAQKKALQEYDLMVERYIVVLMGQAKIYWNHENFQMVEKLFRGSLDACKDCDTWKLNVAHVLFMQ-NKYKEAIGFYEPIVKKHYDNILSVSAVVLANLCVSYIMTNQNEEAEELMRKIEKEEEQISYDDPDKKVFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYSKKLGTDTWFYAKRCFLSLLENMSKDMVPLRDAMVQECVQFLEHCETYGKEVPALIEQPLEENPVHLGKNTVTYEARVLKALF 640          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Medaka
Match: flr (tetratricopeptide repeat protein 30A [Source:NCBI gene;Acc:101171914])

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 412/643 (64.07%), Postives = 518/643 (80.56%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRP-----SLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLL 2014
            I++G++T+T+Y  I++ +Y EA  +LN QL  +  SRAALSLLG+CY+ +Q+F  A++CYEQL+QLHP+V+EYKLY+AQSLYKAG +  A K +  +DN A   K++KLQA IKY E+D   A+SL+E  P +D D   N GCLL++EG YE +C  F  A+QVL F P     SL YN+ L  Y +K Y  ALK+IA++IE+GI+EHPEL VG++TEG +V SVGNTL L ++ALIE FNLKAAIE+ L+N   A EALTDMPPRSEEELD VTLHNQALM+MD  P+ GF+KL FL+QQ  FPP  F NLLLLY K +Y+DLAADVLAEN  L YK+LS Y +++L++ +  QTAPEEA R+ +EM+ K TEQ RKLTK VQ+AR + D+++ KK + EYD ++ERYI VLM QAKIYW+ EN++ VEK+FR S++ C + +TWKLNVAHVLFMQ NKYKEAIGFYEPIVKK++DNIL +SA+VLANLCV+YIMT+QNEEAEELMRKIEKEEE ++Y+DP+KKV+HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KKLGTDTWFYAKRCFLSL+ENM+K M+  +DA++ +C+QFLEHCE YG++V A IEQPLEE  +H GKNTVTYEAR++K+L 
Sbjct:    4 IKDGDYTATVYKLIQDCQYGEACHILNTQLHKHNKSRAALSLLGFCYYHLQDFPAAAECYEQLTQLHPEVEEYKLYYAQSLYKAGAYAEATKASFALDNPASHLKMVKLQACIKYCEEDHAAAKSLLELLPQEDSDYVYNTGCLLYQEGKYEDACRSFMSAVQVLGFVPGKARLSLYYNVALTFYSLKNYPQALKYIAEIIERGIKEHPELSVGVSTEGADVHSVGNTLLLHQSALIEAFNLKAAIEFQLKNLKAAQEALTDMPPRSEEELDPVTLHNQALMNMDPRPSEGFEKLSFLVQQPAFPPVCFGNLLLLYCKNEYFDLAADVLAENAHLTYKFLSPYMYEYLDASLTSQTAPEEALRKFEEMSGKLTEQHRKLTKQVQDARLSRDEEAQKKALQEYDLMVERYIVVLMGQAKIYWNHENFQMVEKLFRGSLDACKDCDTWKLNVAHVLFMQ-NKYKEAIGFYEPIVKKHYDNILSVSAVVLANLCVSYIMTNQNEEAEELMRKIEKEEEQISYDDPDKKVFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYSKKLGTDTWFYAKRCFLSLLENMSKDMVPLRDAMVQECVQFLEHCETYGKEVPALIEQPLEENPVHLGKNTVTYEARVLKALF 645          
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Medaka
Match: flr (tetratricopeptide repeat protein 30A [Source:NCBI gene;Acc:101171914])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 370/644 (57.45%), Postives = 477/644 (74.07%), Query Frame = 2
Query:  101 IREGEFTSTIYGFIKEQKYKEAIIVLNP----QLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCF--LSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLL 2014
            I++G++T+T+Y           ++VL         S   SRAALSLLG+CY+ +Q+F  A++CYEQL+QLHP+V+EYKLY+AQSLYKAG +  A K +  +DN A     LKLQA IKY E+D   A+SL+E  P +D D   N GCLL++EG YE +C  F  A+QVL F P+L YN+ L  Y +K Y  ALK+IA++IE+GI+EHPEL VG++TEG +V SVGNTL L ++ALIE FNLKAAIE+ L+N  +   A T + P   +ELD VTLHNQALM+MD  P+ GF+KL FL+QQ  FPP  F NLLLLY K +Y+DLAADVLAEN  L YK+LS Y +++L++ +  QTAPEEA R+ +EM+ K TEQ RKLTK VQ+AR + D+++ KK + EYD ++ERYI VLM QAKIYW+ EN++ VEK+FR S++ C + +TWKLNVAHVLFMQ NKYKEAIGFYEPIVKK++DNIL +SA+VLANLCV+YIMT+QNEEAEELMRKIEKEEE ++Y+DP+KKV+HLCIVNLVIGTLYCAKGNY+FGISRVIKSLEPY KK+G      ++     L  +++ +      +D  L    + LE+   + R+V A IEQPLEE  +H GKNTVTYEAR++K+L 
Sbjct:    9 IKDGDYTATVYKLCLRVSVAWLVVVLMEVTLGSASSSVQSRAALSLLGFCYYHLQDFPAAAECYEQLTQLHPEVEEYKLYYAQSLYKAGAYAEATKASFALDNPASH---LKLQACIKYCEEDHAAAKSLLELLPQEDSDYVYNTGCLLYQEGKYEDACRSFMSAVQVLGFVPALYYNVALTFYSLKNYPQALKYIAEIIERGIKEHPELSVGVSTEGADVHSVGNTLLLHQSALIEAFNLKAAIEFQLKN--RKISACTVVSP--PQELDPVTLHNQALMNMDPRPSEGFEKLSFLVQQPAFPPVCFGNLLLLYCKNEYFDLAADVLAENAHLTYKFLSPYMYEYLDASLTSQTAPEEALRKFEEMSGKLTEQHRKLTKQVQDARLSRDEEAQKKALQEYDLMVERYIVVLMGQAKIYWNHENFQMVEKLFRGSLDACKDCDTWKLNVAHVLFMQ-NKYKEAIGFYEPIVKKHYDNILSVSAVVLANLCVSYIMTNQNEEAEELMRKIEKEEEQISYDDPDKKVFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYSKKVGNRLGGGSEHAHRRLRFLQSSSFGPETVRDLCLKLKSKNLENLSFF-REVPALIEQPLEENPVHLGKNTVTYEARVLKALF 643          
BLAST of Tetratricopeptide repeat protein 30A vs. Planmine SMEST
Match: SMESG000024323.1 (SMESG000024323.1)

HSP 1 Score: 1277.31 bits (3304), Expect = 0.000e+0
Identity = 646/647 (99.85%), Postives = 646/647 (99.85%), Query Frame = 2
Query:   89 MSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM 2029
            MSMQIREGEFTSTIYGFIKEQKYKEAI VLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANLLLLYIKYDYYDLAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNEEAEELMRKIEKEEEALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM
Sbjct:    1 MSMQIREGEFTSTIYGFIKEQKYKEAITVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANLLLLYIKYDYYDLAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNEEAEELMRKIEKEEEALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM 647          
BLAST of Tetratricopeptide repeat protein 30A vs. Planmine SMEST
Match: SMESG000024323.1 (SMESG000024323.1)

HSP 1 Score: 1272.69 bits (3292), Expect = 0.000e+0
Identity = 644/645 (99.84%), Postives = 644/645 (99.84%), Query Frame = 2
Query:   95 MQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANXXXXXXXXXXXXXAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNXXXXXXXXXXXXXXXALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM 2029
            MQIREGEFTSTIYGFIKEQKYKEAI VLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANLLLLYIKYDYYDLAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNEEAEELMRKIEKEEEALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM
Sbjct:    1 MQIREGEFTSTIYGFIKEQKYKEAITVLNPQLESYPTSRAALSLLGYCYFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQIDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLFKEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVIEKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLRNWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQDTFPPETFANLLLLYIKYDYYDLAADVLAENTELGYKYLSQYFFDFLESVIIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGEYDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVAHVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNEEAEELMRKIEKEEEALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQFLEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM 645          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TTC30B0.000e+067.89tetratricopeptide repeat domain 30B [Source:HGNC S... [more]
TTC30A0.000e+066.82tetratricopeptide repeat domain 30A [Source:HGNC S... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dyf-10.000e+049.00Tetratricopeptide repeat protein 30 homolog [Sour... [more]
dyf-11.492e-17648.40Tetratricopeptide repeat protein 30 homolog [Sour... [more]
dyf-11.492e-17648.40Tetratricopeptide repeat protein 30 homolog [Sour... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ttc307.288e-17046.24gene:FBgn0032470 transcript:FBtr0301366[more]
Ttc307.288e-17046.24gene:FBgn0032470 transcript:FBtr0336855[more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
flr0.000e+070.76fleer [Source:NCBI gene;Acc:797829][more]
flr0.000e+069.04fleer [Source:NCBI gene;Acc:797829][more]
flr0.000e+069.67fleer [Source:NCBI gene;Acc:797829][more]
flr0.000e+068.91fleer [Source:NCBI gene;Acc:797829][more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc30a0.000e+072.74tetratricopeptide repeat domain 30a [Source:NCBI g... [more]
ttc30a0.000e+074.17tetratricopeptide repeat domain 30a [Source:NCBI g... [more]
ttc30a0.000e+073.53tetratricopeptide repeat domain 30a [Source:NCBI g... [more]
ttc30a0.000e+069.31tetratricopeptide repeat domain 30a [Source:NCBI g... [more]
ttc30a0.000e+072.33tetratricopeptide repeat domain 30a [Source:NCBI g... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ttc30a10.000e+067.88tetratricopeptide repeat domain 30A1 [Source:MGI S... [more]
Ttc30b0.000e+067.79tetratricopeptide repeat domain 30B [Source:MGI Sy... [more]
Ttc30a20.000e+067.53tetratricopeptide repeat domain 30A2 [Source:MGI S... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6INU8|TT30A_XENLA0.000e+072.90Tetratricopeptide repeat protein 30A OS=Xenopus la... [more]
sp|A4IHR1|TT30A_XENTR0.000e+072.74Tetratricopeptide repeat protein 30A OS=Xenopus tr... [more]
sp|A7YE96|TT30A_DANRE0.000e+070.76Tetratricopeptide repeat protein 30A OS=Danio reri... [more]
sp|B2RYD6|TT30B_RAT0.000e+067.63Tetratricopeptide repeat protein 30B OS=Rattus nor... [more]
sp|Q99J38|T30A1_MOUSE0.000e+067.88Tetratricopeptide repeat protein 30A1 OS=Mus muscu... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZVF70.000e+077.40Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A210QYA40.000e+077.33Tetratricopeptide repeat protein 30A OS=Mizuhopect... [more]
G7YJ980.000e+077.24Tetratricopeptide repeat protein 30A OS=Clonorchis... [more]
A0A4S2LVK20.000e+076.93Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A2T7PYT70.000e+078.55Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
flr0.000e+070.53fleer [Source:NCBI gene;Acc:797829][more]
flr0.000e+068.39fleer [Source:NCBI gene;Acc:797829][more]
flr0.000e+068.01fleer [Source:NCBI gene;Acc:797829][more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
flr0.000e+067.27fleer [Source:NCBI gene;Acc:797829][more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO483840.000e+074.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264278.050e-3265.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297675.456e-2287.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
flr0.000e+064.42tetratricopeptide repeat protein 30A [Source:NCBI ... [more]
flr0.000e+064.07tetratricopeptide repeat protein 30A [Source:NCBI ... [more]
flr0.000e+057.45tetratricopeptide repeat protein 30A [Source:NCBI ... [more]
back to top
BLAST of Tetratricopeptide repeat protein 30A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024323.10.000e+099.85SMESG000024323.1[more]
SMESG000024323.10.000e+099.84SMESG000024323.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027239 ID=SMED30027239|Name=Tetratricopeptide repeat protein 30A|organism=Schmidtea mediterranea sexual|type=transcript|length=2032bp
CAAGTTTAAGTTTAAATTAAAAATTGAAATATTGAATTAAACATTTTAAT
TTGGAATTTAAATTATTGTTTTTAAATAGCTTTAACAAATGAGTATGCAA
ATAAGAGAAGGAGAATTTACCTCAACCATTTATGGATTTATTAAAGAACA
AAAATATAAGGAAGCGATCATTGTTTTAAATCCACAGTTAGAAAGTTATC
CAACATCAAGAGCTGCTCTTTCTTTATTAGGATACTGTTATTTTCAAATG
CAAAATTTTGTACAAGCTTCTGATTGTTATGAACAACTTTCTCAATTGCA
TCCTGATGTCAAAGAATATAAACTGTATTTTGCTCAATCTCTGTATAAAG
CAGGACTTTTCGAACCAGCTATGAAAGTGACTTGTCAAATTGATAACTCT
GCTTTCAAAGCAAAAGTTCTTAAATTACAAGCTGCAATAAAATATGGAGA
AGACGATTTGATTGGTGCTCGTTCATTGGTTGAGCAGTGTCCACCCGATG
ATCCTGATACTCATATCAATTTGGGTTGTTTGCTTTTTAAAGAAGGCAAT
TATGAAGCATCGTGTGCTAAATTCCAGAAAGCTATGCAAGTTTTGGAATT
CCGTCCGAGTTTGGCTTACAACATCGGGTTATGTCGTTACATGATGAAAC
AGTATGCGCCGGCATTGAAACATATTGCCGATGTCATTGAAAAAGGAATT
AGAGAACACCCAGAACTCGGTGTCGGGATGACGACTGAAGGCATCGAAGT
TCGAAGTGTTGGTAACACATTAACATTGCAAGAAACGGCACTCATTGAGA
CCTTCAATCTAAAAGCTGCTATTGAATACAATCTCCGAAATTGGATACAA
GCTACAGAAGCTCTTACTGACATGCCTCCGAGATCTGAAGAAGAATTGGA
TCATGTAACCTTGCATAATCAAGCACTGATGCACATGGACATTGAACCTG
CACCTGGATTTCAAAAATTGCAATTCCTTTTACAACAGGACACTTTTCCT
CCCGAAACATTCGCCAATTTGCTTTTATTGTACATAAAATATGATTATTA
TGATCTGGCTGCGGATGTGTTGGCTGAAAATACCGAGTTGGGATACAAAT
ATCTTTCTCAGTATTTTTTCGATTTTTTAGAATCGGTAATTATCAGACAA
ACTGCACCCGAAGAAGCATATAGACGACTTGATGAAATGGCTAATAAACA
AACCGAGCAACTGAGAAAACTGACCAAATCCGTTCAGGAAGCGCGACAAA
ATCATGATGATGACAGCGTCAAAAAATTAGTTGGGGAATACGATGAAGTT
TTGGAACGCTACATTCCAGTTTTGATGCAGCAAGCGAAAATATACTGGGA
TTTGGAAAATTACAAACAAGTGGAAAAAATCTTCCGGAAATCTGTCGAAT
TTTGCAATGAGCACGAAACATGGAAATTGAATGTGGCTCACGTGTTGTTC
ATGCAGGACAATAAATACAAGGAAGCAATCGGTTTCTACGAGCCGATTGT
CAAGAAAAACTTCGACAATATACTCGGTATCAGTGCTATTGTGCTGGCGA
ATCTTTGCGTCGCCTATATCATGACGAGTCAGAATGAGGAAGCGGAAGAA
TTGATGAGGAAAATTGAAAAGGAAGAAGAAGCATTGGCTTATGAAGACCC
AGAGAAAAAAGTTTATCATCTTTGTATAGTAAACCTGGTAATAGGAACAC
TTTACTGTGCAAAAGGCAATTATGAGTTCGGAATATCTCGAGTCATCAAG
AGTTTGGAGCCATATCAAAAGAAATTGGGCACGGATACATGGTTTTACGC
AAAACGTTGTTTCCTTTCACTGATTGAAAACATGGCCAAGCATATGATTC
AGCCTAAAGATGCAGTTCTTTTGGATTGTATTCAGTTTCTTGAACACTGC
GAATTATATGGGCGAGATGTCAAGGCATTTATTGAACAACCGTTGGAAGA
GGAAAAGATACACCCGGGGAAAAATACCGTCACATATGAAGCAAGAATGA
TTAAGTCACTTCTTATGCAGTTAATGATGTAA
back to top

protein sequence of SMED30027239-orf-1

>SMED30027239-orf-1 ID=SMED30027239-orf-1|Name=SMED30027239-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MSMQIREGEFTSTIYGFIKEQKYKEAIIVLNPQLESYPTSRAALSLLGYC
YFQMQNFVQASDCYEQLSQLHPDVKEYKLYFAQSLYKAGLFEPAMKVTCQ
IDNSAFKAKVLKLQAAIKYGEDDLIGARSLVEQCPPDDPDTHINLGCLLF
KEGNYEASCAKFQKAMQVLEFRPSLAYNIGLCRYMMKQYAPALKHIADVI
EKGIREHPELGVGMTTEGIEVRSVGNTLTLQETALIETFNLKAAIEYNLR
NWIQATEALTDMPPRSEEELDHVTLHNQALMHMDIEPAPGFQKLQFLLQQ
DTFPPETFANLLLLYIKYDYYDLAADVLAENTELGYKYLSQYFFDFLESV
IIRQTAPEEAYRRLDEMANKQTEQLRKLTKSVQEARQNHDDDSVKKLVGE
YDEVLERYIPVLMQQAKIYWDLENYKQVEKIFRKSVEFCNEHETWKLNVA
HVLFMQDNKYKEAIGFYEPIVKKNFDNILGISAIVLANLCVAYIMTSQNE
EAEELMRKIEKEEEALAYEDPEKKVYHLCIVNLVIGTLYCAKGNYEFGIS
RVIKSLEPYQKKLGTDTWFYAKRCFLSLIENMAKHMIQPKDAVLLDCIQF
LEHCELYGRDVKAFIEQPLEEEKIHPGKNTVTYEARMIKSLLMQLMM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039941TT30
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005215transporter activity
Vocabulary: cellular component
TermDefinition
GO:0005879axonemal microtubule
GO:0005929cilium
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0018095protein polyglutamylation
GO:0030030cell projection organization
GO:0042073intraciliary transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 495..519
NoneNo IPR availableCOILSCoilCoilcoord: 361..388
NoneNo IPR availablePFAMPF12895ANAPC3coord: 21..94
e-value: 2.6E-6
score: 27.6
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 41..74
e-value: 0.0041
score: 26.4
coord: 173..206
e-value: 110.0
score: 5.8
coord: 409..442
e-value: 12.0
score: 14.2
coord: 139..172
e-value: 0.92
score: 18.5
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 410..439
e-value: 0.092
score: 13.0
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 139..172
score: 7.788
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 41..74
score: 8.791
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 409..442
score: 5.9
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 15..107
e-value: 3.9E-10
score: 41.5
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 336..573
e-value: 4.3E-12
score: 47.6
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 108..261
e-value: 4.7E-12
score: 48.1
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 18..201
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 406..512
IPR039941Tetratricopeptide repeat protein 30PANTHERPTHR20931UNCHARACTERIZEDcoord: 2..646
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 139..206
score: 10.743
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 17..74
score: 10.17
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 409..477
score: 8.486