SAM domain-containing protein

Overview
NameSAM domain-containing protein
Smed IDSMED30027236
Length (bp)590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SAM domain-containing protein (SMED30027236) t-SNE clustered cells

Violin plots show distribution of expression levels for SAM domain-containing protein (SMED30027236) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SAM domain-containing protein (SMED30027236) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SAM domain-containing protein (SMED30027236) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027236

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027236SMESG000044180.1 SmedASXL_019582SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30027236SMESG000044180.1 dd_Smed_v4_7783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027236SMESG000044180.1 dd_Smed_v4_7783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027236SMESG000044180.1 dd_Smed_v6_7783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027236SMESG000044180.1 dd_Smed_v4_7783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: SAMD15 (sterile alpha motif domain containing 15 [Source:HGNC Symbol;Acc:HGNC:18631])

HSP 1 Score: 99.3673 bits (246), Expect = 9.515e-24
Identity = 49/105 (46.67%), Postives = 67/105 (63.81%), Query Frame = 2
Query:  107 LYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            L W  EEVA +I + GF  Y++CF+ NFI GRKL  +N SNLP++GI+ +ED+K I+R  +  L +E   F R I LP  + +G+YLE K  TG K D +   EF
Sbjct:  543 LNWDPEEVAEWISQLGFPQYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEF 647          
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: SAMD15 (sterile alpha motif domain containing 15 [Source:HGNC Symbol;Acc:HGNC:18631])

HSP 1 Score: 48.521 bits (114), Expect = 2.377e-7
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 2
Query:  239 IGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            +GI+ +ED+K I+R  +  L +E   F R I LP  + +G+YLE K  TG K D +   EF
Sbjct:    1 MGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEF 61          
BLAST of SAM domain-containing protein vs. Ensembl Fly
Match: CG15625 (gene:FBgn0031644 transcript:FBtr0077390)

HSP 1 Score: 58.151 bits (139), Expect = 5.389e-10
Identity = 33/104 (31.73%), Postives = 53/104 (50.96%), Query Frame = 2
Query:   95 VPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEI 406
            +PS   W   ++  +I+  G+  Y + F  N I GRKL L++ S L  + I  ++ I+ I+  +R+  H E + F   I LP      +YL   T+TG   DE+
Sbjct:   73 LPSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCAMNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEV 176          
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Match: smg8 (SMG8 nonsense mediated mRNA decay factor [Source:Xenbase;Acc:XB-GENE-965595])

HSP 1 Score: 97.8265 bits (242), Expect = 7.236e-26
Identity = 41/108 (37.96%), Postives = 69/108 (63.89%), Query Frame = 2
Query:   98 PSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            P CL W+C EV  ++  KGF  Y  CF +N+I GRKL  +N S LP+IG++ ++ +K I+RL+R  L++    + R + LP  + +G++LE K++TG   + + + +F
Sbjct:   19 PDCLRWSCREVGGWLRFKGFPQYEACFTQNYISGRKLIHVNCSTLPQIGVTDFQHMKEISRLIRDLLNITEPLWTRSVSLPHRDNMGLFLEKKSQTGLNTESLTYSQF 126          
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Match: Samd15 (sterile alpha motif domain containing 15 [Source:MGI Symbol;Acc:MGI:2685109])

HSP 1 Score: 89.7373 bits (221), Expect = 1.163e-20
Identity = 44/107 (41.12%), Postives = 67/107 (62.62%), Query Frame = 2
Query:  107 LYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKE 427
            L W+ E VA +I + GF  Y++CF +NFI+G+KL  +N SNLP++GI+ +ED+K I+   R+ L +E   F R I LP  +  G++ E K  +G K D +   +F E
Sbjct:  478 LTWSPERVAEWISDLGFPQYKECFTENFINGQKLIHVNCSNLPQMGITDFEDMKAISYHTRVLLGIEEPLFSRSISLPYRDNKGLFFEQKGHSGVKSDSLTLAKFVE 584          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P1V8|SAM15_HUMAN (Sterile alpha motif domain-containing protein 15 OS=Homo sapiens OX=9606 GN=SAMD15 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 4.569e-23
Identity = 49/105 (46.67%), Postives = 67/105 (63.81%), Query Frame = 2
Query:  107 LYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            L W  EEVA +I + GF  Y++CF+ NFI GRKL  +N SNLP++GI+ +ED+K I+R  +  L +E   F R I LP  + +G+YLE K  TG K D +   EF
Sbjct:  543 LNWDPEEVAEWISQLGFPQYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEF 647          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95JY5|SAM15_MACFA (Sterile alpha motif domain-containing protein 15 OS=Macaca fascicularis OX=9541 GN=SAMD15 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 6.955e-23
Identity = 49/105 (46.67%), Postives = 66/105 (62.86%), Query Frame = 2
Query:  107 LYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            L W  E+VA +I + GF  Y+ CF+ NFI GRKL  +N SNLP++GI+ +ED+K I+R  R  L +E   F R I LP  + +G+YLE K  TG K D +   EF
Sbjct:  536 LNWDPEKVAEWISQLGFPQYKGCFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTRELLEIEEPLFKRSISLPHRDIIGLYLEQKGHTGIKSDALTLSEF 640          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|F6XZJ7|SAM15_MOUSE (Sterile alpha motif domain-containing protein 15 OS=Mus musculus OX=10090 GN=Samd15 PE=4 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 8.133e-20
Identity = 44/107 (41.12%), Postives = 67/107 (62.62%), Query Frame = 2
Query:  107 LYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKE 427
            L W+ E VA +I + GF  Y++CF +NFI+G+KL  +N SNLP++GI+ +ED+K I+   R+ L +E   F R I LP  +  G++ E K  +G K D +   +F E
Sbjct:  478 LTWSPERVAEWISDLGFPQYKECFTENFINGQKLIHVNCSNLPQMGITDFEDMKAISYHTRVLLGIEEPLFSRSISLPYRDNKGLFFEQKGHSGVKSDSLTLAKFVE 584          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A267DH85 (SAM domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029199g1 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.922e-43
Identity = 63/141 (44.68%), Postives = 100/141 (70.92%), Query Frame = 2
Query:   62 QVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAILMP 484
            + ++ D +  EVP CLYW+ E+VA+++   G   YRDCFL N I+GR+L L++ SNLPKIG+ +++ ++ ++  +R  L +E+  + R+IYLPP + LGMYLE K++TGK +DE+ +D+F  KF    W+PP+AN  +L+P
Sbjct:   10 ESEIADLQNPEVPQCLYWSAEQVADWVSSLGLGQYRDCFLTNGINGRRLVLVDASNLPKIGVHEFQHVQALSGAVRDLLKIESPRWDRRIYLPPRDNLGMYLEMKSKTGKSLDELTYDKFNAKFSNAKWRPPVANMCLLLP 150          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A267DFE1 (SAM domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031519g6 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.774e-43
Identity = 63/141 (44.68%), Postives = 100/141 (70.92%), Query Frame = 2
Query:   62 QVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAILMP 484
            + ++ D +  EVP CLYW+ E+VA+++   G   YRDCFL N I+GR+L L++ SNLPKIG+ +++ ++ ++  +R  L +E+  + R+IYLPP + LGMYLE K++TGK +DE+ +D+F  KF    W+PP+AN  +L+P
Sbjct:   10 ESEIADLQNPEVPQCLYWSAEQVADWVSSLGLGQYRDCFLTNGINGRRLVLVDASNLPKIGVHEFQHVQALSGAVRDLLKIESPRWDRRIYLPPRDNLGMYLEMKSKTGKSLDELTYDKFNAKFSDAKWRPPVANMCLLLP 150          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A2T7PQW6 (SAM domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02744 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.186e-40
Identity = 67/141 (47.52%), Postives = 93/141 (65.96%), Query Frame = 2
Query:   71 LNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAILMPR*R 493
            + D K + VP  LYWT E+VA +I+E GF +Y+ CF  NFIDGR+L  +  S LP+IGI  +E IK IA+ +R  L VE  D+ R I +PP ++LGMYLE K+  GK +D   F++F + +    WQPPLAN  +++PR R
Sbjct:   10 IEDLKDERVPPALYWTTEQVAEWIEELGFPHYKSCFTTNFIDGRRLMRIEASALPRIGIVDFEHIKIIAKSIRDLLRVEEPDWTRSISIPPRSDLGMYLEMKSNRGKYMDTTTFEQFLQDYPNPKWQPPLANVGLILPRIR 150          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A210R5N8 (Sterile alpha motif domain-containing protein 15 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14414 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.614e-40
Identity = 66/148 (44.59%), Postives = 97/148 (65.54%), Query Frame = 2
Query:   44 MTNKIEQVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAILMPR 487
            MT+ +E     D K ++VP CLYWT ++V ++ID  GF  Y+ CF  N I+GRKL  +    LP IGI+ +E IK IA+ +R  L++E  D+ R I LPP N++GMY+E K+ TGK +D + F++F + F    W+PPLAN  +++PR
Sbjct:    4 MTSTVE-----DLKNEQVPQCLYWTVDQVVDWIDNLGFPYYKACFATNMINGRKLVTIEAKALPSIGITDFEHIKIIAKSIRDMLNLEEPDWTRSISLPPRNDIGMYVERKSGTGKNIDSLTFNKFLQDFKDAKWRPPLANHCLILPR 146          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A1I8FG85 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 6.248e-40
Identity = 63/141 (44.68%), Postives = 100/141 (70.92%), Query Frame = 2
Query:   62 QVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAILMP 484
            + ++ D +  EVP CLYW+ E+VA+++   G   YRDCFL N I+GR+L L++ SNLPKIG+ +++ ++ ++  +R  L +E+  + R+IYLPP + LGMYLE K++TGK +DE+ +D+F  KF    W+PP+AN  +L+P
Sbjct:   48 ESEIADLQNPEVPQCLYWSAEQVADWVSSLGLGQYRDCFLTNGINGRRLVLVDASNLPKIGVHEFQHVQALSGAVRDLLKIESPRWDRRIYLPPRDNLGMYLEMKSKTGKSLDELTYDKFNAKFSNAKWRPPVANMCLLLP 188          
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040150.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:46330990:46335498:-1 gene:ENSAMXG00000031813.1 transcript:ENSAMXT00000040150.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 5.812e-15
Identity = 36/109 (33.03%), Postives = 59/109 (54.13%), Query Frame = 2
Query:   95 VPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            +PSC        A  +  K     + CF +N I GRKL  +N   LP++G++ ++ +K I+  +R  L V    + R I  PP + +GM+LE K+RTG + D + + +F
Sbjct:    3 MPSC-------SAILVWVKPVHCLQACFTENLITGRKLIYVNCRYLPRLGMTDFQHMKAISAHVRELLGVSEPLWSRSIADPPRDNMGMFLEIKSRTGNRADSLTYKQF 104          
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009092.1 (pep scaffold:Pmarinus_7.0:GL478018:122811:144435:1 gene:ENSPMAG00000008227.1 transcript:ENSPMAT00000009092.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 3.396e-6
Identity = 19/54 (35.19%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  113 WTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTI 274
            W  EEV  +++  G   YRD F +N I G +L  +++ +L  +G++K   IK I
Sbjct:  355 WCAEEVGGWLERLGLDEYRDAFARNDIRGPELLQLDRRDLKDLGVTKIGHIKRI 408          
BLAST of SAM domain-containing protein vs. Ensembl Nematostella
Match: EDO37353 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG04])

HSP 1 Score: 102.834 bits (255), Expect = 1.733e-28
Identity = 47/114 (41.23%), Postives = 74/114 (64.91%), Query Frame = 2
Query:   80 FKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            F+ D  PSC+ WT E+VA +I+  GF  YR  F  N ++GR+L  ++ S LP++G++ +E IK I++ +R  L +E+  + R I LP    LGMYLE K++TG + D + F+E+
Sbjct:    3 FEADGTPSCIKWTIEDVAEWIEYLGFKQYRRPFSDNLVNGRRLIQVDASTLPRMGVTDFEHIKFISKKIREALGIEDPYWNRSISLPHREVLGMYLEKKSKTGAEADILTFEEY 116          
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045480.1 (sterile alpha motif domain containing 15 [Source:NCBI gene;Acc:101158569])

HSP 1 Score: 93.2041 bits (230), Expect = 3.591e-24
Identity = 40/105 (38.10%), Postives = 67/105 (63.81%), Query Frame = 2
Query:  107 LYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEF 421
            L W C  VAN+I+  G+  Y+ CF +N I+GRKL  +N SNLPK+GI  ++D++ I+  +R  L +  + +   I  PP + + ++LE K+RTG++ D + + +F
Sbjct:   18 LQWDCVSVANWIESLGYPQYKACFTENQINGRKLIFVNCSNLPKLGIVDFKDMQVISARVRELLGITETPWSHSIADPPRDAMALFLERKSRTGERADSLTYQQF 122          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000044180.1 (SMESG000044180.1)

HSP 1 Score: 158.303 bits (399), Expect = 3.845e-50
Identity = 76/84 (90.48%), Postives = 79/84 (94.05%), Query Frame = 2
Query:   44 MTNKIEQVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIE 295
            MTNKIEQVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIK    L+ ++
Sbjct:    1 MTNKIEQVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKVELLLIYVD 84          

HSP 2 Score: 65.855 bits (159), Expect = 5.523e-14
Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 3
Query:  258 RILRQLPDCSELSSMWKIQIFSEKFICHLSMN 353
             I+RQLPDCSELSSMWKIQIFSEKFICHLSMN
Sbjct:   85 NIIRQLPDCSELSSMWKIQIFSEKFICHLSMN 116          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000041461.1 (SMESG000041461.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.006e-35
Identity = 56/127 (44.09%), Postives = 80/127 (62.99%), Query Frame = 2
Query:   95 VPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFIDGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPPFNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAI 475
            VP  L+W+ E+ ANF+ + GF  Y +    N IDG++L  M  SNL K+GI  ++ IK I   +R  L +E  D+ R+IYLPP N++GMYLE K  +G+K D+  +  F ++  G IWQPPL NE +
Sbjct:   32 VPVALFWSVEDAANFMKDIGFPQYMNAIYANRIDGKRLIFMEASNLVKMGIKDFDHIKAITAAVRERLTIEEPDYGRRIYLPPRNKMGMYLELKAHSGRKSDKSSYAIFTDETEGKIWQPPLTNEGM 158          
The following BLAST results are available for this feature:
BLAST of SAM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SAMD159.515e-2446.67sterile alpha motif domain containing 15 [Source:H... [more]
SAMD152.377e-740.98sterile alpha motif domain containing 15 [Source:H... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG156255.389e-1031.73gene:FBgn0031644 transcript:FBtr0077390[more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smg87.236e-2637.96SMG8 nonsense mediated mRNA decay factor [Source:X... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Samd151.163e-2041.12sterile alpha motif domain containing 15 [Source:M... [more]
back to top
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9P1V8|SAM15_HUMAN4.569e-2346.67Sterile alpha motif domain-containing protein 15 O... [more]
sp|Q95JY5|SAM15_MACFA6.955e-2346.67Sterile alpha motif domain-containing protein 15 O... [more]
sp|F6XZJ7|SAM15_MOUSE8.133e-2041.12Sterile alpha motif domain-containing protein 15 O... [more]
back to top
BLAST of SAM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DH855.922e-4344.68SAM domain-containing protein (Fragment) OS=Macros... [more]
A0A267DFE17.774e-4344.68SAM domain-containing protein (Fragment) OS=Macros... [more]
A0A2T7PQW61.186e-4047.52SAM domain-containing protein OS=Pomacea canalicul... [more]
A0A210R5N82.614e-4044.59Sterile alpha motif domain-containing protein 15 O... [more]
A0A1I8FG856.248e-4044.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000040150.15.812e-1533.03pep primary_assembly:Astyanax_mexicanus-2.0:3:4633... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009092.13.396e-635.19pep scaffold:Pmarinus_7.0:GL478018:122811:144435:1... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO373531.733e-2841.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000045480.13.591e-2438.10sterile alpha motif domain containing 15 [Source:N... [more]
back to top
BLAST of SAM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000044180.13.845e-5090.48SMESG000044180.1[more]
SMESG000041461.11.006e-3544.09SMESG000041461.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027236 ID=SMED30027236|Name=SAM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=590bp
CTCTTCCGATCTGCTATTAGTTACTTAATTAATTACTTTTAAAATGACAA
ATAAAATTGAGCAAGTAAAATTAAATGATTTTAAATGTGATGAAGTTCCA
AGTTGCTTATATTGGACTTGTGAGGAGGTAGCAAATTTTATTGATGAAAA
AGGATTTTCTAATTATCGAGATTGTTTTTTGAAAAATTTTATTGATGGAA
GAAAATTATTTTTAATGAATCAATCAAATCTTCCGAAAATCGGAATCAGT
AAATATGAGGATATTAAGACAATTGCCCGATTGCTCAGAATTGAGCTCCA
TGTGGAAAATTCAGATTTTTTCAGAAAAATTTATTTGCCACCTTTCAATG
AATTAGGAATGTATTTGGAACATAAAACACGGACTGGTAAAAAGGTTGAT
GAGATTTGCTTTGACGAATTTAAGGAAAAGTTTATTGGTGGGATTTGGCA
ACCCCCGCTAGCCAATGAGGCTATTTTAATGCCGAGATGAAGAAATTTTC
ATTTTTAATCTGATGAAATATATAATTTAAATGACTAACAATTGCAGGGC
TTTACTGGAAATTTGGTTCAAGGAAAATTATGACTTTAAG
back to top

protein sequence of SMED30027236-orf-1

>SMED30027236-orf-1 ID=SMED30027236-orf-1|Name=SMED30027236-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MTNKIEQVKLNDFKCDEVPSCLYWTCEEVANFIDEKGFSNYRDCFLKNFI
DGRKLFLMNQSNLPKIGISKYEDIKTIARLLRIELHVENSDFFRKIYLPP
FNELGMYLEHKTRTGKKVDEICFDEFKEKFIGGIWQPPLANEAILMPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042554SAMD15
IPR001660SAM
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0000027ribosomal large subunit assembly
GO:0006364rRNA processing
Vocabulary: cellular component
TermDefinition
GO:0030687preribosome, large subunit precursor
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 21..87
e-value: 1.2E-6
score: 38.1
IPR001660Sterile alpha motif domainPFAMPF00536SAM_1coord: 23..81
e-value: 2.9E-11
score: 43.6
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 24..69
score: 11.801
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 22..86
e-value: 2.7E-12
score: 48.9
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 20..81
IPR042554Sterile alpha motif domain-containing protein 15PANTHERPTHR46829FAMILY NOT NAMEDcoord: 16..128