Transmembrane protein 47

Overview
NameTransmembrane protein 47
Smed IDSMED30027229
Length (bp)1258
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 47 (SMED30027229) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 47 (SMED30027229) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 47 (SMED30027229) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 47 (SMED30027229) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027229

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027229SMESG000055359.1 SMESG000029557.1 dd_Smed_v4_20712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027229SMESG000055359.1 SMESG000029557.1 dd_Smed_v4_20712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027229SMESG000055359.1 SMESG000029557.1 dd_Smed_v4_20712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 47 vs. TrEMBL
Match: A0A183ND70 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS56 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.164e-18
Identity = 70/219 (31.96%), Postives = 99/219 (45.21%), Query Frame = 3
Query:  447 LPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAI----QTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEI 1091
            + Q PQ         S  G +   +      L  SEIQ   EYWDH  F  +R   +C   ++    + SVC+STW+Y G      HSG W +CN  N+TC + +    +   W     F+ ++  L   L      +G  V  LPK+LYY+HSG E   VA+      +LI+ +  K          +G AY + W    L + A ILL LDE I E+
Sbjct:   94 IKQSPQTTTRHTTTMSSSGILKVSV-----HLGESEIQEFAEYWDHSIFSGARITAVCLAGVASVCLVCSVCASTWLYQGYANNITHSGFWKRCNYFNQTCEIMLPFITKHEGWQDGAFFILVLAILLGFLGLSLSVAGHLVYALPKRLYYFHSGGEAHVVAAFVTALSVLIYHITIKLHLRTEGPVNFGEAYGISWFACFLHILAAILLLLDEIINEL 307          
BLAST of Transmembrane protein 47 vs. TrEMBL
Match: A0A5K4F0X2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.013e-18
Identity = 68/200 (34.00%), Postives = 96/200 (48.00%), Query Frame = 3
Query:  519 IPSS-----TAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAI----QTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEI 1091
            +PSS     +  L  SEIQ   EYWDH  F  +R   +C   ++    + SVC+STW+Y G      HSG W +CN  N+TC + +    +   W     F+ ++  L   L      +G  V  LPK+LYY+HSG E   VA+      +LI+ +  K          +G AY + W    L + A ILL LDE I E+
Sbjct:  877 VPSSGILKVSVHLGESEIQEFAEYWDHSIFSGARITAVCLAGVASVCLVCSVCASTWLYQGYANNITHSGFWKRCNYFNQTCEIMLPFITKHEGWQDGAFFILVLAILLGFLGLSLSVAGHLVYALPKRLYYFHSGGEAHVVAAFVTALSVLIYHITIKLHLRTEGPMNFGEAYGISWFACFLHILAAILLLLDEIINEL 1076          
BLAST of Transmembrane protein 47 vs. TrEMBL
Match: A0A1I8HVH0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.478e-18
Identity = 80/310 (25.81%), Postives = 131/310 (42.26%), Query Frame = 3
Query:  222 EKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAP-------EIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYY--GEKEIPNHSGLWLKCNMRNRTCSLAIQTP-------NWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPI 1103
            ++E      +  SAW +WS++RR    ++       AR     D IT +   P P +  R  S  LVA         ++ + LP   Q+++              +   +   LT ++   L  +W H  F ++R   +     +L + + SV    W  +   +      SGLW  C   N TC  A   P       +W KSV FL +   L  ++ +     G +V +LP+K+YY+HS  E F V ++      +I+  +S  +F   +   YGY Y LGW    L   A   + LD  ++E +RP+
Sbjct:   27 QEEVGAGLVNGNSAWLRWSRERRASIVRQSQR---KAR-----DSITAIRELPPP-LNGRPNSDPLVATGDGYGGESLLPSTLPPPRQRQQPMQPAQRGGQRRRGRHQVTETDLTMNQWSRLLAFWQHPVFNRARIVAMLCVGAALVVGVTSVSCRAWSTHRMSDNVTLAASGLWDTCFTANDTCISAFDLPTTNSDASDWQKSVAFLLVSSVLLTVIGSVVALCGFWVSYLPRKIYYFHSSGEIFFVCAMLSTISAVIYP-YSLQRFLLHS-IVYGYGYFLGWATSGLQCLAAFCMMLDLLVRESSRPL 325          
BLAST of Transmembrane protein 47 vs. TrEMBL
Match: A0A4Z2DJS1 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000300 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.161e-17
Identity = 63/191 (32.98%), Postives = 93/191 (48.69%), Query Frame = 3
Query:  531 TAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAI----QTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEI 1091
            + +L  +EIQ   EYWDH  F  +R   +C   ++    + SVC+STW+Y G      HSG W +CN  N+TC + +    +   W     F+ ++  L   L      +G  V  LPK+LYY+HSG E   VA+      +L++ +  K          +G AY + W    L + A ILL LDE I E+
Sbjct:  901 SVQLGENEIQEFAEYWDHSIFSGARVTAVCLAGVASVCLVCSVCASTWLYQGYANNITHSGFWKRCNYFNQTCEIMLPFITKHDGWQDGAFFILVLAILLGFLGLSLSVAGHLVYALPKRLYYFHSGGEAHVVAAFVTALSVLVYHITIKLHLRTEGPVSFGEAYGITWFACFLHILAAILLLLDEIINEL 1091          
BLAST of Transmembrane protein 47 vs. TrEMBL
Match: A0A1I8IFH3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.472e-17
Identity = 80/311 (25.72%), Postives = 131/311 (42.12%), Query Frame = 3
Query:  222 EKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAP-------EIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYY--GEKEIPNHSGLWLKCNMRNRTCSLAIQTP-------NWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIE 1106
            ++E      +  SAW +WS++RR    ++       AR     D IT +   P P +  R  S  LVA         ++ + LP   Q+++              +   +   LT ++   L  +W H  F ++R   +     +L + + SV    W  +   +      SGLW  C   N TC  A   P       +W KSV FL +   L  ++ +     G +V +LP+K+YY+HS  E F V ++      +I+  +S  +F   +   YGY Y LGW    L   A   + LD  ++E +RP+ 
Sbjct:   59 QEEVGAGLVNGNSAWLRWSRERRASIVRQSQR---KAR-----DSITAIRELPPP-LNGRPNSDPLVATGDGYGGESLLPSTLPPPRQRQQPMQPAQRGGQRRRGRHQVTETDLTMNQWSRLLAFWQHPVFNRARIVAMLCVGAALVVGVTSVSCRAWSTHRMSDNVTLAASGLWDTCFTANDTCISAFDLPTTNSDASDWQKSVAFLLVSSVLLTVIGSVVALCGFWVSYLPRKIYYFHSSGEIFFVCAMLSTISAVIYP-YSLQRFLLHS-IVYGYGYFLGWATSGLQCLAAFCMMLDLLVRESSRPLP 358          
BLAST of Transmembrane protein 47 vs. Planmine SMEST
Match: SMESG000029557.1 (SMESG000029557.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 401/401 (100.00%), Postives = 401/401 (100.00%), Query Frame = 3
Query:   30 MKNLSKSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRFSLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNWKQLANVQEWS 1232
            MKNLSKSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRFSLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWGLCTGLLSLGLQLFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNWKQLANVQEWS
Sbjct:    1 MKNLSKSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRFSLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWGLCTGLLSLGLQLFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNWKQLANVQEWS 401          
BLAST of Transmembrane protein 47 vs. Planmine SMEST
Match: SMESG000055359.1 (SMESG000055359.1)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 399/401 (99.50%), Postives = 400/401 (99.75%), Query Frame = 3
Query:   30 MKNLSKSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRFSLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNWKQLANVQEWS 1232
            MKNL KSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRFSLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWGLCTGLLSLGLQLFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEF+CVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNWKQLANVQEWS
Sbjct:    1 MKNLRKSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRFSLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWGLCTGLLSLGLQLFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFYCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNWKQLANVQEWS 401          
BLAST of Transmembrane protein 47 vs. Planmine SMEST
Match: SMESG000061681.1 (SMESG000061681.1)

HSP 1 Score: 105.145 bits (261), Expect = 4.785e-24
Identity = 66/187 (35.29%), Postives = 106/187 (56.68%), Query Frame = 3
Query:  537 KLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAI----QTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQ 1085
            +LT+ +I  L EYWDH  F++ R W LC  LL++ LQ+F   S +W ++G+   PN+SGLW  C  RN TC+ A         +  S++ L  + S+ ++  +   F+G+ V  L +KLYYYHS  E F V+ ++    + ++++  +  F KF   RYGY + L W+   L + + + L +DE IQ
Sbjct:  443 RLTHEQIHYLVEYWDHDIFVRLRSWALCFSLLAVALQIFVGLSGSWSFFGDSHHPNYSGLWQTCIPRNHTCTFAFPFTRAKNGYRDSILCLIAVSSIFSIGGSGLSFTGLCVTALARKLYYYHSAGEIFFVSGMTMTLAVSLYSITVEFHF-KFHKHRYGYTFWLAWLSAALLLLSALNLLMDELIQ 628          
BLAST of Transmembrane protein 47 vs. Planmine SMEST
Match: SMESG000061681.1 (SMESG000061681.1)

HSP 1 Score: 105.145 bits (261), Expect = 5.034e-24
Identity = 66/187 (35.29%), Postives = 106/187 (56.68%), Query Frame = 3
Query:  537 KLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCSLAI----QTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQ 1085
            +LT+ +I  L EYWDH  F++ R W LC  LL++ LQ+F   S +W ++G+   PN+SGLW  C  RN TC+ A         +  S++ L  + S+ ++  +   F+G+ V  L +KLYYYHS  E F V+ ++    + ++++  +  F KF   RYGY + L W+   L + + + L +DE IQ
Sbjct:  466 RLTHEQIHYLVEYWDHDIFVRLRSWALCFSLLAVALQIFVGLSGSWSFFGDSHHPNYSGLWQTCIPRNHTCTFAFPFTRAKNGYRDSILCLIAVSSIFSIGGSGLSFTGLCVTALARKLYYYHSAGEIFFVSGMTMTLAVSLYSITVEFHF-KFHKHRYGYTFWLAWLSAALLLLSALNLLMDELIQ 651          
BLAST of Transmembrane protein 47 vs. Planmine SMEST
Match: SMESG000074883.1 (SMESG000074883.1)

HSP 1 Score: 92.4337 bits (228), Expect = 6.329e-21
Identity = 79/288 (27.43%), Postives = 134/288 (46.53%), Query Frame = 3
Query:  246 RSSQSAWTKWSQDRRVMTTKRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLPQEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKSRKWXXXXXXXXXXXXXFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTC----SLAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKN--QFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEFIQEI 1091
            +S++  W KW+++ R        N   SA       +  +  +   PI++AREESKHL+  ++    L  + +K ++    G+R+  I+ +  S    +   E +  T + +++ F+ SR WG    +++L   ++ + S  W   G++  P ++GL + C   N +C    S  +  PNW K +I    + SL  L        G   K + K++YYYHS  EF  +A      GLLIF +  +   +FN F     G ++ +      L   AFILL +DE    I
Sbjct:    3 QSTRLTWAKWAKNVR-------ENNKLSAEQLAKKTEKDKETKLSIPILRAREESKHLMLSKLD---LRSDDEKLEA----GNRKTEITARTKSRNFSVYLDENED-TSFLENQMFVMSRTWGTTFTIVALVFNVYVLISPYWFSMGDRYHPTNAGLLMICGSHNDSCIQLYSHWMDIPNWTKLLIGFICLSSLTGLCGLIVAILGCIHKPIHKQMYYYHSSGEFSVIAFAMIMVGLLIFFISDRRTLKFNSF-----GLSFWMCLACGFLYFLAFILLTVDEIYSRI 270          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 47 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183ND701.164e-1831.96Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A5K4F0X22.013e-1834.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1I8HVH06.478e-1825.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Z2DJS11.161e-1732.98Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A1I8IFH31.472e-1725.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 47 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029557.10.000e+0100.00SMESG000029557.1[more]
SMESG000055359.10.000e+099.50SMESG000055359.1[more]
SMESG000061681.14.785e-2435.29SMESG000061681.1[more]
SMESG000061681.15.034e-2435.29SMESG000061681.1[more]
SMESG000074883.16.329e-2127.43SMESG000074883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027229 ID=SMED30027229|Name=Transmembrane protein 47|organism=Schmidtea mediterranea sexual|type=transcript|length=1258bp
CCGTAATACAAAAAAAAAAAACAATAACAATGAAAAATCTTAGCAAATCG
GATGGTAAGTTTTATGTTAGTGAATTTGAAGTCATTGAAAATCGCTACGC
TTTGGAGAGTGAGGATAAATTGAGCTTAGATTTTGATAAAGATCCTCGGT
TCTCTCTTAGCAACGAATCTCGGAGGATATGCTTCAGTGACCTGGACAAT
AACAATGATGAGCAACAATTCGAAAAAGAAAATGATAAAAATCGTAGGTC
GTCACAATCAGCGTGGACAAAATGGTCACAGGACAGGAGAGTAATGACAA
CAAAAAGGCAAACTAATTGCAGTAGTAGTGCAAGAATCGGTACATTATTT
GATCAGATCACTCAAGTCAACCGAACTCCAACTCCAATAATGAAAGCTAG
AGAGGAATCTAAACATTTGGTAGCTCCAGAAATTGTTCAAAACTATCTAC
CCCAAGAACCCCAAAAACGAAAATCAAGTTGCATTAAAGGCAGTCGGAGG
GGTGCCATAAGTTACCAGATCCCATCTTCTACCGCAAAACTGACATATAG
TGAAATTCAGTTATTGACAGAATATTGGGATCATAAAAATTTTATCAAGT
CAAGAAAATGGGGTCTGTGCACCGGCTTGTTGTCCCTTGGGTTGCAGTTG
TTTAGTGTTTGCAGTTCTACATGGATATATTACGGAGAAAAGGAAATACC
GAATCACTCAGGACTGTGGCTGAAATGCAATATGCGAAATAGAACTTGTT
CTTTAGCTATTCAAACTCCAAATTGGCTTAAATCCGTAATATTTCTTTCA
ATAATTGGGTCATTGTGCAATTTGTTGGCAACGTTTTTCGGATTCAGTGG
AGTCTTCGTCAAACATCTTCCAAAGAAACTCTATTACTATCATTCTGGAT
CAGAATTCTTTTGTGTTGCAAGTTTATCGTATGGAAGTGGTCTGCTAATA
TTTACTTTATTTTCGAAGAATCAATTCAACAAATTTACCTGGTTTCGGTA
TGGCTATGCCTATACGCTTGGTTGGATTGGAGTTCTATTGTCTATGACAG
CCTTTATTTTGTTGAAATTGGATGAATTTATCCAAGAGATTAATCGACCT
ATCGAATGGAAATCTGGATTATATAAAGTTAGAATTCCATGTCTCCAAAA
AGAGGATAGTTTCTCGGATTTTCCCAGTACTTCTCTTATTACTCAAAACT
GGAAACAATTAGCAAATGTTCAAGAATGGTCTTGATTAAATTTATTTTGA
TTTATGAG
back to top

protein sequence of SMED30027229-orf-1

>SMED30027229-orf-1 ID=SMED30027229-orf-1|Name=SMED30027229-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
VIQKKKTITMKNLSKSDGKFYVSEFEVIENRYALESEDKLSLDFDKDPRF
SLSNESRRICFSDLDNNNDEQQFEKENDKNRRSSQSAWTKWSQDRRVMTT
KRQTNCSSSARIGTLFDQITQVNRTPTPIMKAREESKHLVAPEIVQNYLP
QEPQKRKSSCIKGSRRGAISYQIPSSTAKLTYSEIQLLTEYWDHKNFIKS
RKWGLCTGLLSLGLQLFSVCSSTWIYYGEKEIPNHSGLWLKCNMRNRTCS
LAIQTPNWLKSVIFLSIIGSLCNLLATFFGFSGVFVKHLPKKLYYYHSGS
EFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTA
FILLKLDEFIQEINRPIEWKSGLYKVRIPCLQKEDSFSDFPSTSLITQNW
KQLANVQEWS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0000272polysaccharide catabolic process
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0030245cellulose catabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008810cellulase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 195..358
e-value: 1.0E-8
score: 36.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 68..90
NoneNo IPR availablePANTHERPTHR10671EPITHELIAL MEMBRANE PROTEIN-RELATEDcoord: 197..349
NoneNo IPR availablePANTHERPTHR10671:SF81coord: 197..349
NoneNo IPR availableTMHMMTMhelixcoord: 259..281
NoneNo IPR availableTMHMMTMhelixcoord: 201..223
NoneNo IPR availableTMHMMTMhelixcoord: 331..350
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
IPR004031PMP-22/EMP/MP20/Claudin superfamilyPFAMPF00822PMP22_Claudincoord: 207..345
e-value: 1.2E-10
score: 41.5