Protein FAM166B

Overview
NameProtein FAM166B
Smed IDSMED30027228
Uniprot Best hitUncharacterized protein C10orf82 homolog OS=Mus musculus OX=10090 PE=1 SV=2 (E=2.709e-11)
Length (bp)1356
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein FAM166B (SMED30027228) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein FAM166B (SMED30027228) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein FAM166B (SMED30027228) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein FAM166B (SMED30027228) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027228

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027228SMESG000069725.1 SmedASXL_007874SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027228SMESG000069725.1 dd_Smed_v4_5010_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30027228SMESG000069725.1 dd_Smed_v4_5010_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30027228SMESG000069725.1 dd_Smed_v4_5010_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027228SMESG000069725.1 dd_Smed_v6_5010_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30027228SMESG000069725.1 OX_Smed_1.0.18417ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30027228SMESG000069725.1 Contig41863uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027228SMESG000069725.1 Contig41863newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027228SMESG000069725.1 Contig39511uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027228SMESG000069725.1 Contig39511newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30027228SMESG000069725.1 dd_Smed_v4_5010_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30027228SMESG000069725.1 dd_Smed_v4_5010_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30027228SMESG000069725.1 dd_Smed_v4_5010_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein FAM166B vs. Ensembl Human
Match: C10orf82 (chromosome 10 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:28500])

HSP 1 Score: 63.1586 bits (152), Expect = 1.026e-10
Identity = 48/175 (27.43%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  379 MMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDR---RSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEKNYKVENGIYTVANQKPLALQS--PSEPKFS 876
            + PGYSG +P  ++  G +     + CV+ F    +R K +  +L       PKL+P++ +  V   ++ +  NL    ++   +   + L EPP+PG++GY+PR   TE G   RY        + F +   R    H + YE+ Y V +   +  + K L  +   P  P FS
Sbjct:   13 ITPGYSGFVP-FLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQY--NLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEEIYGVSSTKTSAPSPKVLQHEELLPKYPDFS 184          
BLAST of Protein FAM166B vs. Ensembl Human
Match: C10orf82 (chromosome 10 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:28500])

HSP 1 Score: 60.077 bits (144), Expect = 2.731e-10
Identity = 40/145 (27.59%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  379 MMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDR---RSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEK 792
            + PGYSG +P  ++  G +     + CV+ F    +R K +  +L       PKL+P++ +  V   ++ +  NL    ++   +   + L EPP+PG++GY+PR   TE G   RY        + F +   R    H + YE+
Sbjct:   13 ITPGYSGFVP-FLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQY--NLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE 154          
BLAST of Protein FAM166B vs. Ensembl Human
Match: FAM166B (family with sequence similarity 166 member B [Source:HGNC Symbol;Acc:HGNC:34242])

HSP 1 Score: 53.5286 bits (127), Expect = 2.602e-7
Identity = 65/282 (23.05%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLM----KSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSE-PKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVG 963
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I   +S         EV    LP+  G  + +  M+PGY+G +PR+   F      +  E + +F   +E+  ++  +L K +    K R  +   +V +      +  +    ++S  + D R   +  M G++GY+P          AR+    G S     ++  + F +                  P + Q P   P   R      G++P+Y G++   K   G+T G
Sbjct:   18 YIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRT--LLPPIRPPRS--------PEVPRESLPVRRGQERLSSSMIPGYTGFVPRAQFIFAKNCSQVWAEALSDFTHLHEKQGSE--ELPKEA----KGRKDTEKDQVPEPEGQLEEPTLEVVEQASPYSMDDRDPRKFFMSGFTGYVP---------CARF--LFGSSFPVLTNQALQEFGQ---------------KHSPGSAQDPKHLPPLPRTYPQNLGLLPNYGGYVPGYKFQFGHTFG 257          
BLAST of Protein FAM166B vs. Ensembl Human
Match: FAM166B (family with sequence similarity 166 member B [Source:HGNC Symbol;Acc:HGNC:34242])

HSP 1 Score: 52.7582 bits (125), Expect = 3.842e-7
Identity = 34/124 (27.42%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQ 504
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I   +S         EV    LP+  G  + +  M+PGY+G +PR+   F      +  E + +F   +E+  +++
Sbjct:   18 YIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRT--LLPPIRPPRS--------PEVPRESLPVRRGQERLSSSMIPGYTGFVPRAQFIFAKNCSQVWAEALSDFTHLHEKQGSEE 131          
BLAST of Protein FAM166B vs. Ensembl Human
Match: FAM166B (family with sequence similarity 166 member B [Source:HGNC Symbol;Acc:HGNC:34242])

HSP 1 Score: 51.9878 bits (123), Expect = 4.440e-7
Identity = 34/124 (27.42%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQ 504
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I   +S         EV    LP+  G  + +  M+PGY+G +PR+   F      +  E + +F   +E+  +++
Sbjct:   18 YIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRT--LLPPIRPPRS--------PEVPRESLPVRRGQERLSSSMIPGYTGFVPRAQFIFAKNCSQVWAEALSDFTHLHEKQGSEE 131          
BLAST of Protein FAM166B vs. Ensembl Zebrafish
Match: fam166b (family with sequence similarity 166 member B [Source:NCBI gene;Acc:100009651])

HSP 1 Score: 59.3066 bits (142), Expect = 2.333e-9
Identity = 70/291 (24.05%), Postives = 119/291 (40.89%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITD-YERNKAKQADLT-KMSTLFPKLRP---------ISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVS---RHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVG 963
            +IPGY GY PQLKY  G+T+G+ T   A+ L     P+      L  +     S ++++    ++   +     G ++  E M+PGY+G +P   N    TY   C + + EF  +  +R     ADL+  +    P  RP         +S DP      + W       S    +  S  +  + G++GY+P+           Y   T ++L  F+ E+       Q+Y    +  + +  +    P                +K G++PSYTGH+   +   G+T G
Sbjct:   19 YIPGYAGYCPQLKYHVGQTYGQLT---AKLL---TSPEVSHSQRLVLQTSPLSSTEKETASRSQIWWSR----HGASRNLETMIPGYTGFVPLRQNYICKTYAETCRDALSEFNQEQAKRLHNASADLSFPVINSVPDFRPRRSNSPLIALSKDPAPYKAPDPWKP---PGSPYFMEDSSPHKYFISGFTGYVPK---ARFLFGTGYPTITNKALIQFSKEMKAGPASLQKYSLQEEDSSNLPLIPTIYP----------------SKTGLLPSYTGHIPGYRFQYGHTFG 277          
BLAST of Protein FAM166B vs. Ensembl Mouse
Match: 1700019N19Rik (RIKEN cDNA 1700019N19 gene [Source:MGI Symbol;Acc:MGI:1914757])

HSP 1 Score: 66.6254 bits (161), Expect = 3.873e-12
Identity = 55/189 (29.10%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  331 VRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSV-LATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEKNYKVENGIYTVANQKPLALQ--SPSEPKFS 876
            +RKLPI            PGY G IP    +   +   + + CV+ F    +R K  Q  L       P L+PI  +  V   ++ ++      ++    +++ L EPP+PG++GY+PR   TE G A RY     +  + F D V +      + YE+ Y V        + K L LQ  SP+ P+FS
Sbjct:    8 MRKLPI-----------TPGYCGFIPWLSCQESSSEDRM-NPCVKAFQERTQRYKEDQQGLNCSVANTPPLKPICSEDTVLWVLHEYAKKYHPLTLECKNEKKPLQEPPIPGWAGYLPRARVTEFGYATRYTIMAKKCYKDFLDLVEQAKRAQLKPYEQTYDVRAAQPLSPSSKILQLQGLSPAFPEFS 184          
BLAST of Protein FAM166B vs. Ensembl Mouse
Match: 1700019N19Rik (RIKEN cDNA 1700019N19 gene [Source:MGI Symbol;Acc:MGI:1914757])

HSP 1 Score: 66.6254 bits (161), Expect = 5.203e-12
Identity = 55/189 (29.10%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  331 VRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSV-LATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEKNYKVENGIYTVANQKPLALQ--SPSEPKFS 876
            +RKLPI            PGY G IP    +   +   + + CV+ F    +R K  Q  L       P L+PI  +  V   ++ ++      ++    +++ L EPP+PG++GY+PR   TE G A RY     +  + F D V +      + YE+ Y V        + K L LQ  SP+ P+FS
Sbjct:   16 MRKLPI-----------TPGYCGFIPWLSCQESSSEDRM-NPCVKAFQERTQRYKEDQQGLNCSVANTPPLKPICSEDTVLWVLHEYAKKYHPLTLECKNEKKPLQEPPIPGWAGYLPRARVTEFGYATRYTIMAKKCYKDFLDLVEQAKRAQLKPYEQTYDVRAAQPLSPSSKILQLQGLSPAFPEFS 192          
BLAST of Protein FAM166B vs. Ensembl Mouse
Match: Fam166b (family with sequence similarity 166, member B [Source:MGI Symbol;Acc:MGI:2445194])

HSP 1 Score: 54.6842 bits (130), Expect = 8.111e-8
Identity = 67/278 (24.10%), Postives = 108/278 (38.85%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQ-ADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVG 963
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I S +S          ++  +LP   G  + +  ++PGY+G IPR+   F      +  E + EF   +   ++ Q  D  K        R +  D             L  +S  + D     +  M G++GY+PR         + +   T ++L+ F    SR   R  K            + KPL+          R  F   G++P Y G++   K   G T G
Sbjct:   18 YIPGYTGHCPLLRFSMGQTYGQVTGQLLRGPPGLAWPPAHRT--LLPPIQSPRSPV--------ISKGRLPPRRGHERLSSSIIPGYTGFIPRAQFIFAKNCNQVWAEAMSEFTRRHGEQESHQLPDGAKGE------REVEEDQLREAEEPPLKQELAHASPYSMDDTDPHKFFMSGFTGYVPR---ARFLFGSSFPVLTNQALQEFGQMCSR--GRAHK------------DPKPLS-------PLPRPTFQNLGLLPHYGGYVPGYKFQFGGTFG 255          
BLAST of Protein FAM166B vs. Ensembl Mouse
Match: Fam166b (family with sequence similarity 166, member B [Source:MGI Symbol;Acc:MGI:2445194])

HSP 1 Score: 51.9878 bits (123), Expect = 4.620e-7
Identity = 63/266 (23.68%), Postives = 104/266 (39.10%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQ-ADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHL 927
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I S +S          ++  +LP   G  + +  ++PGY+G IPR+   F      +  E + EF   +   ++ Q  D  K        R +  D             L  +S  + D     +  M G++GY+PR         + +   T ++L+ F    SR   R  K            + KPL+          R  F   G++P Y G++
Sbjct:   18 YIPGYTGHCPLLRFSMGQTYGQVTGQLLRGPPGLAWPPAHRT--LLPPIQSPRSPV--------ISKGRLPPRRGHERLSSSIIPGYTGFIPRAQFIFAKNCNQVWAEAMSEFTRRHGEQESHQLPDGAKGE------REVEEDQLREAEEPPLKQELAHASPYSMDDTDPHKFFMSGFTGYVPR---ARFLFGSSFPVLTNQALQEFGQMCSR--GRAHK------------DPKPLS-------PLPRPTFQNLGLLPHYGGYV 243          
BLAST of Protein FAM166B vs. UniProt
Match: sp|Q9CQT6|CJ082_MOUSE (Uncharacterized protein C10orf82 homolog OS=Mus musculus OX=10090 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 2.709e-11
Identity = 55/189 (29.10%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  331 VRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSV-LATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEKNYKVENGIYTVANQKPLALQ--SPSEPKFS 876
            +RKLPI            PGY G IP    +   +   + + CV+ F    +R K  Q  L       P L+PI  +  V   ++ ++      ++    +++ L EPP+PG++GY+PR   TE G A RY     +  + F D V +      + YE+ Y V        + K L LQ  SP+ P+FS
Sbjct:    8 MRKLPI-----------TPGYCGFIPWLSCQESSSEDRM-NPCVKAFQERTQRYKEDQQGLNCSVANTPPLKPICSEDTVLWVLHEYAKKYHPLTLECKNEKKPLQEPPIPGWAGYLPRARVTEFGYATRYTIMAKKCYKDFLDLVEQAKRAQLKPYEQTYDVRAAQPLSPSSKILQLQGLSPAFPEFS 184          
BLAST of Protein FAM166B vs. UniProt
Match: sp|Q8WW14|CJ082_HUMAN (Uncharacterized protein C10orf82 OS=Homo sapiens OX=9606 GN=C10orf82 PE=1 SV=3)

HSP 1 Score: 63.1586 bits (152), Expect = 4.927e-10
Identity = 48/175 (27.43%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  379 MMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDR---RSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEKNYKVENGIYTVANQKPLALQS--PSEPKFS 876
            + PGYSG +P  ++  G +     + CV+ F    +R K +  +L       PKL+P++ +  V   ++ +  NL    ++   +   + L EPP+PG++GY+PR   TE G   RY        + F +   R    H + YE+ Y V +   +  + K L  +   P  P FS
Sbjct:   13 ITPGYSGFVP-FLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQY--NLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEEIYGVSSTKTSAPSPKVLQHEELLPKYPDFS 184          
BLAST of Protein FAM166B vs. UniProt
Match: sp|A6QPC0|CJ082_BOVIN (Uncharacterized protein C10orf82 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.561e-9
Identity = 42/149 (28.19%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  379 MMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATD-RRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSR----HFQRYEKNYKVEN 810
            + PGYSG +P  ++  G +       C++ F  +  R K +  +        PKL+P+  +  V   ++ +       S+   + ++ L EPP+PG++GY+PR   TELG + RY          F D + R    H + YEK Y V++
Sbjct:   13 ITPGYSGFVP-YLSCQGTSSEDNMANCLKIFQENTRRCKDQLEEFHCSVATAPKLKPVRSEGTVLRTLHQYYRQYHPLSLECKNIKKPLHEPPIPGWAGYLPRARVTELGCSTRYTVMARNCYRDFLDLMERAKQAHLKPYEKIYGVKS 160          
BLAST of Protein FAM166B vs. UniProt
Match: sp|A2AIP0|F166B_MOUSE (Protein FAM166B OS=Mus musculus OX=10090 GN=Fam166b PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 5.673e-7
Identity = 67/278 (24.10%), Postives = 108/278 (38.85%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQ-ADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVG 963
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I S +S          ++  +LP   G  + +  ++PGY+G IPR+   F      +  E + EF   +   ++ Q  D  K        R +  D             L  +S  + D     +  M G++GY+PR         + +   T ++L+ F    SR   R  K            + KPL+          R  F   G++P Y G++   K   G T G
Sbjct:   18 YIPGYTGHCPLLRFSMGQTYGQVTGQLLRGPPGLAWPPAHRT--LLPPIQSPRSPV--------ISKGRLPPRRGHERLSSSIIPGYTGFIPRAQFIFAKNCNQVWAEAMSEFTRRHGEQESHQLPDGAKGE------REVEEDQLREAEEPPLKQELAHASPYSMDDTDPHKFFMSGFTGYVPR---ARFLFGSSFPVLTNQALQEFGQMCSR--GRAHK------------DPKPLS-------PLPRPTFQNLGLLPHYGGYVPGYKFQFGGTFG 255          
BLAST of Protein FAM166B vs. UniProt
Match: sp|A8MTA8|F166B_HUMAN (Protein FAM166B OS=Homo sapiens OX=9606 GN=FAM166B PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.249e-6
Identity = 65/282 (23.05%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLM----KSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSE-PKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVG 963
            +IPGY G+ P L++S G+T+G+ T    R       P   +   L P I   +S         EV    LP+  G  + +  M+PGY+G +PR+   F      +  E + +F   +E+  ++  +L K +    K R  +   +V +      +  +    ++S  + D R   +  M G++GY+P          AR+    G S     ++  + F +                  P + Q P   P   R      G++P+Y G++   K   G+T G
Sbjct:   18 YIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRT--LLPPIRPPRS--------PEVPRESLPVRRGQERLSSSMIPGYTGFVPRAQFIFAKNCSQVWAEALSDFTHLHEKQGSE--ELPKEA----KGRKDTEKDQVPEPEGQLEEPTLEVVEQASPYSMDDRDPRKFFMSGFTGYVP---------CARF--LFGSSFPVLTNQALQEFGQ---------------KHSPGSAQDPKHLPPLPRTYPQNLGLLPNYGGYVPGYKFQFGHTFG 257          
BLAST of Protein FAM166B vs. TrEMBL
Match: gnl|BL_ORD_ID|20718234 (tr|A0A504YZT8|A0A504YZT8_FASGI Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_08686 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 6.552e-109
Identity = 165/328 (50.30%), Postives = 215/328 (65.55%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLA 1041
            MVSI+YGGGPTLEQR +FCNL  G HIPGY G+ PQL Y  G ++G+ T + A  L+YYNGP+ QK HHL P +   K+   +S+F DEV  R LP  TGDNKY   M+PGYSGD+P    +FG TYR   DECV+EF+ +Y+ ++AK+ +L ++S LFP LR +S DPRVR+H+N+WSD L K++      R  T+PP+PGY G+IPRM  TE GLA RYH+   +SLE F  +   HF R  +     +    V ++ P   Q PS+   S RIF K+GMIP Y GH+H  K  +G   G+ +R L+VC H F  YGDYV+ KDLA
Sbjct:    1 MVSIEYGGGPTLEQRREFCNLEEGGHIPGYMGFCPQLNYQCGNSYGKTTAEIAANLSYYNGPQTQKPHHLRPTVSDDKNASVRSVFRDEVPGRMLPESTGDNKYIAGMIPGYSGDVPHLAFKFGTTYRETTDECVDEFVREYKCHEAKREELREISGLFPTLRAVSNDPRVRNHMNIWSDELRKNNATVRPIRGPTDPPIPGYQGFIPRMQTTEAGLAKRYHEGAHQSLEAFRAQTQGHFDRLAQPITSIDTSPVVDSKSP---QIPSDKYVSSRIFRKEGMIPDYNGHVHGLKFQVGKNFGNITRDLEVCAHPFPSYGDYVREKDLA 325          
BLAST of Protein FAM166B vs. TrEMBL
Match: gnl|BL_ORD_ID|21477552 (tr|A0A075A3B0|A0A075A3B0_9TREM Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01217 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.443e-105
Identity = 165/332 (49.70%), Postives = 221/332 (66.57%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLA----LQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLA 1041
            M SI+YGGGP+LEQR KFCNL  G+ IPGY G+ PQLKY +G T+GRET D A++L YYNGP+ QK HHLYP +G  K    +S F DEV  + LP PTGDNKY   M+PGYSGD+P    +FG TYR   DECV+EF+  Y+  + K+ +L +++ +FP LRPI+ DPRVR+H+NLW+D+L K +  A+  R  T+PP+PGY G++P M+ TE GLA R+H+A    LETF  E   H+ R  +         T  N +P+     ++ P+E   S RIF ++GMIP Y GH+H  K  +G   G+T+R L+VC H F  YGDYV+ +D+A
Sbjct:    1 MTSIEYGGGPSLEQRRKFCNLPEGAQIPGYMGFCPQLKYRSGHTYGRETADIAQELPYYNGPQIQKPHHLYPVVGDYKDATARSAFRDEVPGKMLPQPTGDNKYIAGMIPGYSGDVPHMPFKFGATYRQTADECVDEFVRKYKCEEKKREELREVAGIFPALRPIALDPRVRNHLNLWADDLSKKNTTASAVRGPTDPPIPGYMGFVPCMDTTEAGLAKRFHEAAKSGLETFRTENQAHWDRLAEP-------TTTVNTEPVVKDTFVRQPNELFNSSRIFRQEGMIPEYKGHIHGYKFHVGKNFGNTTRDLEVCAHPFPSYGDYVKERDIA 325          
BLAST of Protein FAM166B vs. TrEMBL
Match: gnl|BL_ORD_ID|19108780 (tr|A0A4E0R8U7|A0A4E0R8U7_FASHE Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_007135 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 5.007e-105
Identity = 166/342 (48.54%), Postives = 217/342 (63.45%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRET------------HDC--ARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLA 1041
            MVSI+YGGGPTLEQR +FCNL  G HIPGY G+ PQL Y  G ++G+ T             DC  ++ L+YYNGP+ QK HHL P +   K+   +S+F DEV  R LP  TGDNKY   M+PGYSGD+P    +FG TYR   DECV+EF+ +Y+ ++AK+ +L ++S LFP LR +S DPRVR+H+N+WSD L K++      R  T+PP+PGY G+IPRM  TE GLA RYH+   +SLE F  +   HF R  +     +    V ++ P   Q PS+   S RIF K+GMIP Y GH+H  K  +G   G+ +R L+VC H F  YGDYV+ KDLA
Sbjct:    1 MVSIEYGGGPTLEQRREFCNLEEGGHIPGYMGFCPQLNYQCGNSYGKTTAEIAAVSCNHRNDDCNLSQNLSYYNGPQTQKPHHLRPTVSDDKNASVRSVFRDEVPGRMLPESTGDNKYIAGMIPGYSGDVPHLAFKFGTTYRETTDECVDEFVREYKCHEAKREELREISGLFPTLRAVSNDPRVRNHMNIWSDELRKNNATVRPIRGPTDPPIPGYQGFIPRMQTTEAGLAKRYHEGAHQSLEVFRAQTQGHFDRLAQPITSIDTSPIVDSKPP---QIPSDKYVSSRIFRKEGMIPDYNGHVHGLKFQVGKNFGNITRDLEVCAHPFPSYGDYVREKDLA 339          
BLAST of Protein FAM166B vs. TrEMBL
Match: gnl|BL_ORD_ID|22917001 (tr|A0A4S2M5Y2|A0A4S2M5Y2_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002492 PE=4 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 7.113e-105
Identity = 163/332 (49.10%), Postives = 223/332 (67.17%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLA----LQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLA 1041
            M SI+YGGGP+LEQR KFCN+  G+ IPGY G+ PQLKY +G T+GRET D A++L YYNGP+ QK HHLYP +G  K    +S+F DEV  + LP PTGDNKY   M+PGYSGD+P    +FG TYR   DECV+EF+  Y+  + K+ +L +++ +FP LRPI+ DPRVR+H+NLW+D+L K +  A+  R  ++PP+PGY G++P M+ TE GLA R+H+A    LETF  E   H+ R  ++        T  N +P+     ++ P+E   S RIF ++GMIP Y GH+H  K  +G   G+T+R L+VC H F  YGDYV+ +D+A
Sbjct:    1 MTSIEYGGGPSLEQRRKFCNVPDGAQIPGYMGFCPQLKYRSGHTYGRETADIAQELPYYNGPQIQKPHHLYPIVGDDKDATVRSVFRDEVPGKMLPQPTGDNKYIAGMIPGYSGDVPHMPFKFGATYRQTADECVDEFVRKYKCEEKKREELREVAGIFPALRPIALDPRVRNHLNLWADDLSKKNTTASAVRGPSDPPIPGYMGFVPCMDTTEAGLAKRFHEAAKSGLETFRTENQAHWDRLAEH-------TTTVNTEPVVRDTFVRRPNELFNSSRIFRQEGMIPEYKGHIHGYKFHVGKNFGNTTRDLEVCAHPFPSYGDYVKERDIA 325          
BLAST of Protein FAM166B vs. TrEMBL
Match: gnl|BL_ORD_ID|22675280 (tr|A0A094ZT67|A0A094ZT67_SCHHA Protein FAM166B OS=Schistosoma haematobium OX=6185 GN=MS3_04561 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.132e-93
Identity = 149/329 (45.29%), Postives = 208/329 (63.22%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYP-EIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLA 1041
            M +I+YGGGP+LEQR  F NL  G H+PGY G+ PQ KY  G TFG+ET D A+ L YY+GP+ Q+    YP    +SK    +S F D V+ R LP  TGDNKYT +M+PGYSGDIP+   +FGGTYR++ +ECV++ + +Y+  + K+  L + S L   L PI+ DP V++H+N+W+D++MK +      +  TEPP+PGY G+IPRM+ TE GLA R+H+A   SLETF  E   HF   +        + T +  +      P    +S RIF++ GMIP Y GH+H  +  +G   G+T+R L+VC H + CYG+YV+ KDL 
Sbjct:    1 MTTIEYGGGPSLEQRRAFANLESGGHVPGYMGFCPQFKYRYGHTFGKETSDIAKDLPYYSGPRIQEPLRFYPVSDENSKFETLRSNFNDHVSERMLPKATGDNKYTGEMIPGYSGDIPQMNFKFGGTYRTLSEECVDQLVREYKSAEMKRNKLKESSNLLTNLHPIAHDPLVKNHLNIWADDMMKRNSGVYSNKRTTEPPIPGYKGFIPRMDTTEHGLAKRFHEAAQSSLETFRAECKNHFDHIDMPV---TRLDTCSRPRTSIPYKPKSNYYSARIFHQGGMIPDYEGHIHGYQYHVGKNFGNTTRDLEVCAHPYSCYGEYVKIKDLT 326          
BLAST of Protein FAM166B vs. Ensembl Cavefish
Match: fam166b (family with sequence similarity 166 member B [Source:NCBI gene;Acc:103046180])

HSP 1 Score: 60.8474 bits (146), Expect = 5.266e-10
Identity = 78/295 (26.44%), Postives = 123/295 (41.69%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKV----HHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERN-KAKQAD-LTKMSTLFPKLRP---------ISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTS 972
            +IPGY GY PQLKY  GK + + T   AR L+  +   +Q++     HL P                E   R     +G  ++ E++ PGY+G +PRS N F  TY  +C + + EF +D +R  +   +D L  ++   P  RP         IS DP      N W    + S     D  S  +  + G++GY+P+         +R+   TG  + T     ++   ++ K  K  N          L     + P  +       G+IPS+TGH+   +   G T G  +
Sbjct:   19 YIPGYAGYCPQLKYHMGKPYAQLT---ARLLSAPDVAHSQRLVLQSGHLPPTQTDP----------GEGPSRSW---SGPGRHRERI-PGYTGFVPRSQNYFSRTYTEVCRDALYEFESDIKRRIQLTSSDHLPAVNYSLPDFRPPKLNTPLTAISKDPAPFRPANPWKP--LGSPYFMPD-SSPYKYFISGFTGYVPK---------SRFLIGTGYPITT-----NQALIQFGKQMKAGNSAIA------LKEDDSNLPSINTIYSRHHGIIPSFTGHVPGYRFQYGQTFGQLT 273          
BLAST of Protein FAM166B vs. Ensembl Sea Lamprey
Match: fam166b (family with sequence similarity 166 member B [Source:NCBI gene;Acc:100009651])

HSP 1 Score: 55.0694 bits (131), Expect = 1.004e-8
Identity = 81/308 (26.30%), Postives = 124/308 (40.26%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGD-NKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVR------DHINLWSDN-----------LMKSS----VLATDRRSLTEPP----MPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSP-SEPKFSRRIFNKD-GMIPSYTGHLHRAKEVMGYTVGDTS 972
            +IPGY GY PQ KY+ G T+G++T    R  A  +  K      L                   ++ R+   P  D  K T  M+PGY+G IPR+   F  TY   C + +  F  + E+  A +  L   S        + G+  +R       H+ L   +           L +SS    VL +     ++ P    M GY+GY+PR       + A Y   T R+L        R F  +E   K    +  +    P  +Q   ++P     I+  D G+IP+YTG++   K   G+T G  +
Sbjct:   21 YIPGYRGYCPQYKYNVGSTYGQQTGQLLRDPAVAHSDKLV----LQSGQPIQPRPPPGPPGHQRMSQRR---PVSDVQKLTASMVPGYTGFIPRAECFFSHTYADTCRDALRLF--EKEQRVATKRHLQTTS--------LDGETGLRARTYASGHLLLMIPSRPLTCLAKEVPLYRSSPALRVLNSPYNMDSDDPYKWFMSGYTGYVPR---ERFLIGAGYPVTTNRAL--------REFSHHEG--KAVATLTALPGHLPDIVQHKGAQPPSRNVIYAPDMGLIPNYTGYVPGYKFQYGHTYGQLT 298          
BLAST of Protein FAM166B vs. Ensembl Nematostella
Match: EDO48739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM2])

HSP 1 Score: 93.9745 bits (232), Expect = 1.417e-21
Identity = 88/298 (29.53%), Postives = 134/298 (44.97%), Query Frame = 1
Query:  127 GSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHI--NLWSDNLMK--SSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKD------GMIPSYTGHLHRAKEVMGYTVGDTSRSLDVC 990
             S++PGY GY PQLKY  G T+G  T     +       +N+K+                 L   +   + LP P G NK T  M  GY+G IP     +G  YR   D+ + +F+   E+ + +  DL K      KL+P +      DH   +++ D   +       ++ R  TE P+PGY+GY+PR    +LG+  RY      S   F++ +       E   K EN    +A Q+    + P EP  +  + ++       GM P YTG++ + +   G T GDT+RSL VC
Sbjct:   12 ASNLPGYRGYCPQLKYECGHTYGIATDKLTTRHM-----RNEKL-------------ITTRLPDPKEREQFLPQPNGVNKLTANMKLGYTGYIPTMRYLYGSRYREATDQAISDFMQKDEKYRNESDDLKKTVYSTKKLQPRA------DHKEPSMYPDLRPRYGKDYFPSEHREFTEAPLPGYTGYVPRRRAHDLGM--RYGTW---SQAGFSNSL-------EMRNKQEN----LATQRIDVTKYP-EPTVTAELTSQGTLYKLMGMKPKYTGYIPQRRFRYGNTYGDTTRSLPVC 268          
BLAST of Protein FAM166B vs. Ensembl Nematostella
Match: EDO30910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZG1])

HSP 1 Score: 73.1738 bits (178), Expect = 1.996e-14
Identity = 75/304 (24.67%), Postives = 134/304 (44.08%), Query Frame = 1
Query:  133 HIPGYYGYVPQLKYSNGKTFGRETHDCA---RKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTL------FPKLRPISGDPRVRDHINL------------WSDNLMKSSV--LATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSR 975
            HIPGY GY PQ KY  G+TFGR T  C      +AY   P    +  + P++      +      D +  R + +  GD K T++M+PGY+G IP++ + +G +Y       + +F  +  +++ K  +L  ++ +       P+L  I+ D R      +            +S    + S+  LA    +  +    GYSG++PR       +   Y   T ++L  F+  +       E   K+++   T+  ++P      + P + +   N  G++P +TGH+   K   G T G ++R
Sbjct:   15 HIPGYCGYCPQFKYQIGETFGRTT-SCLLTDNSVAYSGKP---VLSDIEPQVPPKADTRR-----DTIKNRAISL--GDQKLTDQMVPGYTGYIPKAEHYYGNSYAETSRSAIADFHQNQLKHRQKAINLRTITEIQRGKQVLPEL--ITSDTRTLSKFQVPLKAIADKPKMYYSKKAPQHSLSPLALSNDNPKKHHKSGYSGFVPRYRGL---MGEGYPVLTNKALIAFSSNM-------ENMKKIKDLPVTI--ERPEVRLVDTRPIYPK---NNTGLVPHFTGHVPGEKFRYGMTFGYSTR 290          
BLAST of Protein FAM166B vs. Planmine SMEST
Match: SMESG000069725.1 (SMESG000069725.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 326/330 (98.79%), Postives = 326/330 (98.79%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLAVN 1047
            MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIGSSKSGKEKSLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVEN    VANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLAVN
Sbjct:    1 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIGSSKSGKEKSLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVEN----VANQKPLALQSPSEPKFSRRIFNKDGMIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLAVN 326          
BLAST of Protein FAM166B vs. Planmine SMEST
Match: SMESG000019955.1 (SMESG000019955.1)

HSP 1 Score: 357.066 bits (915), Expect = 3.490e-122
Identity = 168/264 (63.64%), Postives = 203/264 (76.89%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPLAL 849
            MVSIQYGGGPT+EQ+  FCN   GSHIPGY G++PQ K+  GKTF RE+HD ARKL YYNGP+N  V H YPE+G +K  + +S+F DE    KLPIPTGDNKYTEKMMPGYSGDIP    +FGGTYRSICDE V EFITDYERN+AK  D+ KM+++FPKLRPI  D RV+DH+NLWSDNL K S LA+DRR + EPP+PGY+G++PR +NTE+GL  RYH+A     E+F  E SRHFQ+ E+  KV+N  YTV +QK L +
Sbjct:    1 MVSIQYGGGPTIEQQRAFCNPPEGSHIPGYLGFIPQAKFEVGKTFARESHDVARKLPYYNGPRNASVKHFYPEVGKTKDCENRSIFQDEFPKNKLPIPTGDNKYTEKMMPGYSGDIPHWNYKFGGTYRSICDEAVNEFITDYERNEAKMNDIKKMASMFPKLRPICSDLRVKDHMNLWSDNLTKMSTLASDRRHILEPPIPGYTGFVPRKDNTEVGLGNRYHEAAKHCFESFVTENSRHFQKLEEPMKVKNNTYTVQDQKSLVV 264          
BLAST of Protein FAM166B vs. Planmine SMEST
Match: SMESG000019955.1 (SMESG000019955.1)

HSP 1 Score: 355.525 bits (911), Expect = 1.174e-121
Identity = 168/262 (64.12%), Postives = 202/262 (77.10%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQKPL 843
            MVSIQYGGGPT+EQ+  FCN   GSHIPGY G++PQ K+  GKTF RE+HD ARKL YYNGP+N  V H YPE+G +K  + +S+F DE    KLPIPTGDNKYTEKMMPGYSGDIP    +FGGTYRSICDE V EFITDYERN+AK  D+ KM+++FPKLRPI  D RV+DH+NLWSDNL K S LA+DRR + EPP+PGY+G++PR +NTE+GL  RYH+A     E+F  E SRHFQ+ E+  KV+N  YTV +QK L
Sbjct:    1 MVSIQYGGGPTIEQQRAFCNPPEGSHIPGYLGFIPQAKFEVGKTFARESHDVARKLPYYNGPRNASVKHFYPEVGKTKDCENRSIFQDEFPKNKLPIPTGDNKYTEKMMPGYSGDIPHWNYKFGGTYRSICDEAVNEFITDYERNEAKMNDIKKMASMFPKLRPICSDLRVKDHMNLWSDNLTKMSTLASDRRHILEPPIPGYTGFVPRKDNTEVGLGNRYHEAAKHCFESFVTENSRHFQKLEEPMKVKNNTYTVQDQKSL 262          
BLAST of Protein FAM166B vs. Planmine SMEST
Match: SMESG000019955.1 (SMESG000019955.1)

HSP 1 Score: 353.984 bits (907), Expect = 6.514e-121
Identity = 167/260 (64.23%), Postives = 201/260 (77.31%), Query Frame = 1
Query:   58 MVSIQYGGGPTLEQREKFCNLRPGSHIPGYYGYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIXXXXXXXXXXLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSICDECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDNLMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLETFADEVSRHFQRYEKNYKVENGIYTVANQK 837
            MVSIQYGGGPT+EQ+  FCN   GSHIPGY G++PQ K+  GKTF RE+HD ARKL YYNGP+N  V H YPE+G +K  + +S+F DE    KLPIPTGDNKYTEKMMPGYSGDIP    +FGGTYRSICDE V EFITDYERN+AK  D+ KM+++FPKLRPI  D RV+DH+NLWSDNL K S LA+DRR + EPP+PGY+G++PR +NTE+GL  RYH+A     E+F  E SRHFQ+ E+  KV+N  YTV +QK
Sbjct:    1 MVSIQYGGGPTIEQQRAFCNPPEGSHIPGYLGFIPQAKFEVGKTFARESHDVARKLPYYNGPRNASVKHFYPEVGKTKDCENRSIFQDEFPKNKLPIPTGDNKYTEKMMPGYSGDIPHWNYKFGGTYRSICDEAVNEFITDYERNEAKMNDIKKMASMFPKLRPICSDLRVKDHMNLWSDNLTKMSTLASDRRHILEPPIPGYTGFVPRKDNTEVGLGNRYHEAAKHCFESFVTENSRHFQKLEEPMKVKNNTYTVQDQK 260          
The following BLAST results are available for this feature:
BLAST of Protein FAM166B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C10orf821.026e-1027.43chromosome 10 open reading frame 82 [Source:HGNC S... [more]
C10orf822.731e-1027.59chromosome 10 open reading frame 82 [Source:HGNC S... [more]
FAM166B2.602e-723.05family with sequence similarity 166 member B [Sour... [more]
FAM166B3.842e-727.42family with sequence similarity 166 member B [Sour... [more]
FAM166B4.440e-727.42family with sequence similarity 166 member B [Sour... [more]
back to top
BLAST of Protein FAM166B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM166B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM166B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam166b2.333e-924.05family with sequence similarity 166 member B [Sour... [more]
back to top
BLAST of Protein FAM166B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM166B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
1700019N19Rik3.873e-1229.10RIKEN cDNA 1700019N19 gene [Source:MGI Symbol;Acc:... [more]
1700019N19Rik5.203e-1229.10RIKEN cDNA 1700019N19 gene [Source:MGI Symbol;Acc:... [more]
Fam166b8.111e-824.10family with sequence similarity 166, member B [Sou... [more]
Fam166b4.620e-723.68family with sequence similarity 166, member B [Sou... [more]
back to top
BLAST of Protein FAM166B vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CQT6|CJ082_MOUSE2.709e-1129.10Uncharacterized protein C10orf82 homolog OS=Mus mu... [more]
sp|Q8WW14|CJ082_HUMAN4.927e-1027.43Uncharacterized protein C10orf82 OS=Homo sapiens O... [more]
sp|A6QPC0|CJ082_BOVIN3.561e-928.19Uncharacterized protein C10orf82 homolog OS=Bos ta... [more]
sp|A2AIP0|F166B_MOUSE5.673e-724.10Protein FAM166B OS=Mus musculus OX=10090 GN=Fam166... [more]
sp|A8MTA8|F166B_HUMAN1.249e-623.05Protein FAM166B OS=Homo sapiens OX=9606 GN=FAM166B... [more]
back to top
BLAST of Protein FAM166B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|207182346.552e-10950.30tr|A0A504YZT8|A0A504YZT8_FASGI Uncharacterized pro... [more]
gnl|BL_ORD_ID|214775521.443e-10549.70tr|A0A075A3B0|A0A075A3B0_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|191087805.007e-10548.54tr|A0A4E0R8U7|A0A4E0R8U7_FASHE Uncharacterized pro... [more]
gnl|BL_ORD_ID|229170017.113e-10549.10tr|A0A4S2M5Y2|A0A4S2M5Y2_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|226752801.132e-9345.29tr|A0A094ZT67|A0A094ZT67_SCHHA Protein FAM166B OS=... [more]
back to top
BLAST of Protein FAM166B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam166b5.266e-1026.44family with sequence similarity 166 member B [Sour... [more]
back to top
BLAST of Protein FAM166B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam166b1.004e-826.30family with sequence similarity 166 member B [Sour... [more]
back to top
BLAST of Protein FAM166B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM166B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO487391.417e-2129.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309101.996e-1424.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein FAM166B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM166B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000069725.10.000e+098.79SMESG000069725.1[more]
SMESG000019955.13.490e-12263.64SMESG000019955.1[more]
SMESG000019955.11.174e-12164.12SMESG000019955.1[more]
SMESG000019955.16.514e-12164.23SMESG000019955.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027228 ID=SMED30027228|Name=Protein FAM166B|organism=Schmidtea mediterranea sexual|type=transcript|length=1356bp
TTACATTGTTTTAATAATTATTACTATAGAAACTTTTCGAGTTATAATAA
TTTAAATATGGTATCGATTCAATACGGCGGTGGTCCTACATTAGAACAAA
GAGAAAAATTTTGCAATTTAAGGCCTGGAAGTCATATCCCTGGTTATTAT
GGTTACGTCCCACAATTAAAATATAGTAATGGCAAGACATTCGGACGTGA
AACACATGACTGTGCCAGAAAACTTGCTTACTACAATGGACCTAAGAATC
AGAAAGTTCATCATCTTTATCCGGAAATTGGATCTTCAAAATCAGGCAAA
GAAAAATCGTTATTTGTCGACGAAGTTGCCGTTAGAAAACTTCCAATTCC
TACAGGTGACAATAAATATACTGAAAAAATGATGCCTGGTTATTCTGGTG
ATATACCGAGATCAATAAACAGATTTGGTGGTACTTATCGCAGCATTTGC
GACGAGTGCGTCGAAGAGTTTATCACTGATTATGAAAGAAACAAAGCCAA
ACAAGCGGACCTGACGAAAATGTCGACTTTATTTCCAAAATTGCGTCCAA
TTTCCGGTGATCCTCGAGTTAGAGATCACATTAATCTTTGGTCGGACAAT
TTGATGAAAAGCTCAGTTTTGGCAACAGATCGCCGGAGTCTTACAGAACC
ACCAATGCCGGGCTATTCCGGATACATTCCAAGAATGAACAATACAGAAT
TAGGACTCGCTGCTCGATACCACCAGGCTACGGGAAGAAGTCTTGAGACA
TTCGCAGATGAAGTATCTCGTCATTTTCAACGATATGAAAAAAATTATAA
AGTGGAAAATGGCATCTACACCGTAGCCAATCAAAAACCGTTAGCTTTGC
AATCTCCGTCTGAACCGAAGTTTTCCCGACGAATATTTAATAAAGACGGA
ATGATCCCGTCGTACACTGGGCATCTCCACCGTGCCAAAGAGGTGATGGG
GTACACAGTTGGAGATACGTCGCGATCTCTTGATGTTTGCAAGCATGACT
TTCGCTGTTATGGGGATTATGTGCAGAATAAGGACTTGGCTGTCAATTAG
GACCGCCGACACCATTTGCACTAGCGTGACATCATTGACATTTATAGTAT
TGTAATCAGTATTTCCTATATCTGCTGACGCTTTTGTTCTCATGCCGACA
TTTTCTGACTTTCATATCTTAGGTTTTATCTTTATTTGCCGAGTCTCTAT
CTCTCTCTCTCTCTCTTTATCCATATATCCATATATATGGCTGTCTGTAC
CGTTCCTGTTGACATGGTACCAAAAATCGCGATGTTTATTTGGCATAAAT
TGCCATGGAAATATTTAATTAAATACATTTTATGTCGAATGGACTTTTGA
AAAAAA
back to top

protein sequence of SMED30027228-orf-1

>SMED30027228-orf-1 ID=SMED30027228-orf-1|Name=SMED30027228-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
LHCFNNYYYRNFSSYNNLNMVSIQYGGGPTLEQREKFCNLRPGSHIPGYY
GYVPQLKYSNGKTFGRETHDCARKLAYYNGPKNQKVHHLYPEIGSSKSGK
EKSLFVDEVAVRKLPIPTGDNKYTEKMMPGYSGDIPRSINRFGGTYRSIC
DECVEEFITDYERNKAKQADLTKMSTLFPKLRPISGDPRVRDHINLWSDN
LMKSSVLATDRRSLTEPPMPGYSGYIPRMNNTELGLAARYHQATGRSLET
FADEVSRHFQRYEKNYKVENGIYTVANQKPLALQSPSEPKFSRRIFNKDG
MIPSYTGHLHRAKEVMGYTVGDTSRSLDVCKHDFRCYGDYVQNKDLAVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR018902FAM166/UPF0605
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process