SMED30027226

Overview
NameSMED30027226
Smed IDSMED30027226
Length (bp)3848
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027226 (SMED30027226) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027226 (SMED30027226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027226 (SMED30027226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027226 (SMED30027226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027226h1SMcG0000827 dd_Smed_v4_10733_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027226h1SMcG0000827 dd_Smed_v4_10733_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027226h1SMcG0000827 dd_Smed_v4_10733_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30027226 vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 230.72 bits (587), Expect = 3.089e-75
Identity = 138/336 (41.07%), Postives = 190/336 (56.55%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK--KFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFF-----SKMKFHASLTDENLESQLRCAT 2431
               AM+  N G V      + AT    +E+  I C+IH ++LCAQ L M+HVM VV+K+VN+I S  L H +F   L EL S+YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+   W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF   + +V E LQME+I+LQCN  LK+ +      E Y  Y+    YP  K    KI+S FGSTY+CE  F     SK K+ + L D   +S L  AT
Sbjct:  782 GTPAMVDANNGLVTKLKSRV-ATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGLNYIP---KIAELQTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYK-YLWGS-YPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT 1111          

HSP 2 Score: 73.9442 bits (180), Expect = 3.089e-75
Identity = 37/120 (30.83%), Postives = 70/120 (58.33%), Query Frame = -1
Query: 2406 PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVYPVIL*I*RIFMDCFCFCYDW*K 2765
            P++ ++ ++ S + ++  + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F              R+      FC DW K
Sbjct:  668 PEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFS-------------RVEKSLKNFCIDWSK 774          
BLAST of SMED30027226 vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 231.106 bits (588), Expect = 3.144e-75
Identity = 138/336 (41.07%), Postives = 190/336 (56.55%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK--KFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFF-----SKMKFHASLTDENLESQLRCAT 2431
               AM+  N G V      + AT    +E+  I C+IH ++LCAQ L M+HVM VV+K+VN+I S  L H +F   L EL S+YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+   W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF   + +V E LQME+I+LQCN  LK+ +      E Y  Y+    YP  K    KI+S FGSTY+CE  F     SK K+ + L D   +S L  AT
Sbjct:  620 GTPAMVDANNGLVTKLKSRV-ATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGLNYIP---KIAELQTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYK-YLWGS-YPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT 949          

HSP 2 Score: 73.9442 bits (180), Expect = 3.144e-75
Identity = 37/120 (30.83%), Postives = 70/120 (58.33%), Query Frame = -1
Query: 2406 PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVYPVIL*I*RIFMDCFCFCYDW*K 2765
            P++ ++ ++ S + ++  + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F              R+      FC DW K
Sbjct:  506 PEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFS-------------RVEKSLKNFCIDWSK 612          
BLAST of SMED30027226 vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 231.106 bits (588), Expect = 1.167e-74
Identity = 138/336 (41.07%), Postives = 190/336 (56.55%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK--KFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFF-----SKMKFHASLTDENLESQLRCAT 2431
               AM+  N G V      + AT    +E+  I C+IH ++LCAQ L M+HVM VV+K+VN+I S  L H +F   L EL S+YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+   W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF   + +V E LQME+I+LQCN  LK+ +      E Y  Y+    YP  K    KI+S FGSTY+CE  F     SK K+ + L D   +S L  AT
Sbjct:  620 GTPAMVDANNGLVTKLKSRV-ATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLVSRNESDGLNYIP---KIAELKTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYK-YLWGS-YPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT 949          

HSP 2 Score: 71.633 bits (174), Expect = 1.167e-74
Identity = 31/91 (34.07%), Postives = 63/91 (69.23%), Query Frame = -1
Query: 2493 PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2765
            P++ ++ ++ S + ++  + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F
Sbjct:  506 PEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 596          
BLAST of SMED30027226 vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 231.106 bits (588), Expect = 1.387e-74
Identity = 138/336 (41.07%), Postives = 190/336 (56.55%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK--KFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFF-----SKMKFHASLTDENLESQLRCAT 2431
               AM+  N G V      + AT    +E+  I C+IH ++LCAQ L M+HVM VV+K+VN+I S  L H +F   L EL S+YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+   W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF   + +V E LQME+I+LQCN  LK+ +      E Y  Y+    YP  K    KI+S FGSTY+CE  F     SK K+ + L D   +S L  AT
Sbjct:  787 GTPAMVDANNGLVTKLKSRV-ATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLVSRNESDGLNYIP---KIAELKTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYK-YLWGS-YPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT 1116          

HSP 2 Score: 71.633 bits (174), Expect = 1.387e-74
Identity = 31/91 (34.07%), Postives = 63/91 (69.23%), Query Frame = -1
Query: 2493 PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2765
            P++ ++ ++ S + ++  + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F
Sbjct:  673 PEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 763          
BLAST of SMED30027226 vs. Ensembl Human
Match: EPM2AIP1 (EPM2A interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:19735])

HSP 1 Score: 136.732 bits (343), Expect = 8.546e-46
Identity = 105/346 (30.35%), Postives = 170/346 (49.13%), Query Frame = -2
Query: 1433 MIGKNKGTVKLFMYELEATSVNPSEIFVIH--CLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVR-WLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNS---SQTINFAKCADE------I*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKID 2419
            MIG+N G V  +M E    +V+P+   VIH    +H + L +  + +N ++  + + +  I++  ++  +F+  L E  SE+G+ V    +  WL RG  LK  F LR E+E F+        + +D+ WL D  FLV+I E +  L++EL+        A +HI  F+ KL LF+  +   NL  FP L++       Q     K  D       I +L  EF   F +L    K  E+FS+PF       P ++++E+  LQ N  L + ++     + Y   ++AE YP +K    K+ S F S  +CE  FS +          LTDE+L++  R ATT+++
Sbjct:  252 MIGENSGLVS-YMRE---KAVSPNCWNVIHYSGFLHLELLSSYDVDVNQIINTISEWIVLIKTRGVRRPEFQTLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEMEAFLVSVGATTVHFSDKQWLCDFGFLVDIMEHLRELSEELRVSKVFAAAAFDHICTFEVKLNLFQRHIEEKNLTDFPALREVVDELKQQNKEDEKIFDPDRYQMVICRLQKEFERHFKDLRFIKKDLELFSNPFNFKPEYAPISVRVELTKLQANTNLWNEYRIKDLGQFY-AGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEME 592          

HSP 2 Score: 69.707 bits (169), Expect = 8.546e-46
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = -1
Query: 2523 SSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNL 2900
            +S        +A   +  L+A K + + +G+FV +C+  ++ +V+P+   ++  + LS     + I +I   +   L  R + FKAYSLA D+   ++  + L VFIRGV     V +D+L ++NL
Sbjct:   89 ASFTPEERAARAGLGLCRLLALKGRGWGEGDFVYQCMEVLLREVLPEHVSVLQGVDLSPDITRQRILSIDRNLRNQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGPELEVQEDLLTIINL 214          
BLAST of SMED30027226 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 199.904 bits (507), Expect = 3.470e-70
Identity = 127/366 (34.70%), Postives = 202/366 (55.19%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEY-GDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQT----INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEAL-------QMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKFHAS-----LTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A AM+G  +G V L     +A    P+  +  HC+IH ++  ++ L+++H+M  V++ VN++R+HAL HR+FK  +DEL  +   D+++   VRWLSRG  L  FFEL   ++ F+AE+      L+D  W+ DL FLV++   +N LN +LQG+  +       + AF  KL LF++ L+  +  HFP L K +  +      + A+ A  +  L   F  RFS L +  +      +PF  +   +   L       Q+E+I L  +++LKSV +  + +E +   +  ERYPN+K    K++S FGSTYVCE+ FS +K   S     LTD +++  LR ATT+ + DLK + + KE Q+ H
Sbjct:  258 GAPAMLGSERGLVGL----CKADDRFPA-FWTFHCIIHQEHWVSKKLNLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAEKHKEYPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKASGQKAEVVKGSTARYATLLENLEQSFEERFSNLQQKRQQITFLINPFTAESGCLKAPLVEDEAASQLEMIELSEDDRLKSVLREGT-VEFWKI-VPVERYPNVKQAALKLLSMFGSTYVCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIVETKECQVSH 616          

HSP 2 Score: 87.4261 bits (215), Expect = 3.470e-70
Identity = 45/142 (31.69%), Postives = 83/142 (58.45%), Query Frame = -1
Query: 2496 KMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKM---ISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDV 2912
            ++F    + S  +  ASY +A  IA+  KP+ +GEFVK+CL+  +  + P+   +   +  + LS  T+ + I+ I + +   L   +Q+ + +S+A DES D+ D  Q A+F+R V +   + +++L+++ LKD TRG D+
Sbjct:   92 QLFRKFSKHSETVTLASYQLAWNIARAKKPYLEGEFVKKCLSDAVAILCPENENLKRSVKDLQLSRHTVEQRISDIDNSVETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVPLKDRTRGIDL 233          
BLAST of SMED30027226 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 155.606 bits (392), Expect = 5.652e-47
Identity = 117/395 (29.62%), Postives = 185/395 (46.84%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNH--VMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSS---QTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVD---VFTVPEALQ----MEIINL-----------QCNNKLKSVHKTTSKIE-----------------IYNTY-ITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A +M G  +G V L    L+        +   HC++H + LCAQ        VM +VI+ VN I + AL HR+F+A LDE+ SEY D++   KVRWLS+   L+ F      ++ F+  +      L D  WL  L F+V++T  +N LN+ LQ + N  +     + +F+ KL +F   ++   L HFP L++F  S    TIN     + I  +   F  RF E  K   T     +P ++D   + T P  +Q    ME+ ++           +   +L+ V +  +++                  IY+T+    + Y N+K +   ++S FGSTY+CE  FS M     K+   LT E+L+S ++   T    D++ LS    KQ  H
Sbjct:  251 GAPSMRGSKRGFVTLLQKALDRN------LLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKDLIYPQLEDTEWLEKLHFMVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSLREFKESHQDHTINGDYLHNAIVDMQTAFESRFCEFRKEKMTLSFPVTPLEIDPSLLSTFPGIIQADLEMEMADISDKDLWVSKFKRLTAELEDVTRQKAQLAQSHKWSEMEGLPVPEKLIYDTWNALPDCYKNMKTYAFGVLSIFGSTYLCEQIFSNMNYIKSKYRTRLTHESLQSCVKIKVTSYMPDVEKLSSDVRKQKSH 639          

HSP 2 Score: 54.299 bits (129), Expect = 5.652e-47
Identity = 43/150 (28.67%), Postives = 72/150 (48.00%), Query Frame = -1
Query: 2484 KKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPD-KHKM-----ISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2915
            K  F   +   ++   AS+     I K+ KPF+DG+++KE    + E +  D K+K      I  + LS++T+      +   I     + I    AYS+A DES D       A+  R V +S G  ++++ L+ LK  TRG+D+   +
Sbjct:   88 KNKFKKWIASPNSTTAASFVATREIIKRGKPFTDGDYMKESFINISEHLFSDFKNKTEIIQKIKDMPLSAKTVKERAIKMAGNITEQQIKDINSAPAYSIACDESCDT------ALLCRYV-NSDGPQEEIIKLIPLKGQTRGEDICEAV 230          
BLAST of SMED30027226 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 2.453e-71
Identity = 122/354 (34.46%), Postives = 186/354 (52.54%), Query Frame = -2
Query: 1415 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRS--HALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAE---ERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHF----PLLKKFNSSQTI-NFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTL 2431
             A AM+G+N+G       E         +  + HC++H + LC   L M  +M VV K  N IR    +L HR+FK +L+EL + YGD++  T VRWLS G CL  FF LR EI  ++++   +   + +L D  +L  L FL +IT+ +N LN  LQG+D       +HI AF+ KL L +S L  N+L HF     L ++   +  I NF++   ++  L  EF  RF +    + +F++F++P   D+        ME+  LQ +  L   H  + K   +   ++ E+YP L+ FG ++ S FGSTY+CE  FS M     K+  S+ D  L+  +R +TT I  D+  L
Sbjct:  260 GARAMVGRNQGLAGRLRKE-------GIDCHMFHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDFEGMEASFKLFNNPINTDIAAQDTKYHMELCELQGDQFL---HSCSEKGVAFFKLLSQEQYPILRDFGMRMASMFGSTYICEKAFSDMGFIKSKYRNSICDSTLQQIIRISTTSISADIDEL 603          

HSP 2 Score: 100.908 bits (250), Expect = 2.453e-71
Identity = 55/146 (37.67%), Postives = 86/146 (58.90%), Query Frame = -1
Query: 2481 KKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDK-HKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2915
            K +FS+        VKAS+ VA  IAK+  PFS G  VK C   + E    +   K + SISLS QT+ RHI  I   +   L+  ++    +S+A DESTDI+DT QL +F+R V   F +++++L ++ L  +T+G+D+++ +K
Sbjct:   96 KNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSGTLVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVK 241          
BLAST of SMED30027226 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 163.31 bits (412), Expect = 4.182e-63
Identity = 114/354 (32.20%), Postives = 172/354 (48.59%), Query Frame = -2
Query: 1415 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRS--HALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAE---ERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFP----LLKKFNSSQTI-NFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTL 2431
             A AM+G+N+G       E         +  + HC++H + LC   L M  +M VV K  N IR    +L HR+FK +L+EL + YGD++  T VRWLS G CL  FF LR EI  ++++   +   + +L D  +L  L FL +IT+ +N LN  LQG+D       +HI AF+ KL L +S L  N+L HF     L ++   +  I NF++   ++  L  EF  RF +                                 + N   + +H  + K   +   ++ E+YP L+ FG ++ S FGSTY+CE  FS M     K+  S+ D  L+  +R +TT I  D+  L
Sbjct:  260 GARAMVGRNQGLAGRLRKE-------GIDCHMFHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDF--------------------------------EGNGGNQFLHSCSEKGVAFFKLLSQEQYPILRDFGMRMASMFGSTYICEKAFSDMGFIKSKYRNSICDSTLQQIIRISTTSISADIDEL 574          

HSP 2 Score: 100.908 bits (250), Expect = 4.182e-63
Identity = 55/146 (37.67%), Postives = 86/146 (58.90%), Query Frame = -1
Query: 2481 KKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDK-HKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2915
            K +FS+        VKAS+ VA  IAK+  PFS G  VK C   + E    +   K + SISLS QT+ RHI  I   +   L+  ++    +S+A DESTDI+DT QL +F+R V   F +++++L ++ L  +T+G+D+++ +K
Sbjct:   96 KNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSGTLVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVK 241          
BLAST of SMED30027226 vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 129.798 bits (325), Expect = 3.518e-43
Identity = 103/358 (28.77%), Postives = 179/358 (50.00%), Query Frame = -2
Query: 1415 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSH-----ALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEER-NPV--SNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHF----PLLKKFNSSQT-INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEI-YNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFS-----KMKFHASLTDENLESQLRCATTKIDVDLKTL 2431
             + +M  K+ G   L   E        ++  V+HC++H + L   +L M+ VM VV+K  N+I        A+  +KFK +LDELS+ YGD        W S G CL  FF LR EI  F+ +   +P+   +L +E +L  L FL ++T  ++ L K ++ +D L      H+  F  KL+L +  L +N+L +F     L +++      ++F+K  ++I  L   F  RF + +K +  F+++++P   D+ +      ME+ +LQ +        T  ++ + +   +  E+Y NL+    K+ S FGSTY+CE  FS     K  +  S+++  L+  L  + T I+++   L
Sbjct:  249 GSKSMTAKSLGLSALLRKE-------GADCVVLHCIMHEEMLIGTLLKMSDVMEVVVKISNFILEKRGFITAVTKKKFKTFLDELSAAYGDFDSHKNAYWSSAGQCLFRFFSLRKEIYLFLKDTNYDPILTESLCNEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLITQLYTHVSVFSNKLMLLKLNLISNDLTYFESCNELYREYEECNIFLDFSKFVEKIEVLIENFNLRFQDFSKINSCFKLYNNPLTTDIISERMEYHMELCDLQAD----LFFATREELGVPFFRLLPKEKYRNLRDLALKMTSMFGSTYICERAFSELNHLKSNYRNSISNRTLQEILHLSITNINLNFDEL 595          

HSP 2 Score: 67.781 bits (164), Expect = 3.518e-43
Identity = 42/134 (31.34%), Postives = 73/134 (54.48%), Query Frame = -1
Query: 2478 VKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKH--KMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKN 2873
            +KAS+ +   I K+ + F   + VKEC A  +  V  ++       SISL  QT+ R ++A+  +I   L   ++    +SLA DE+TD   T  L +FIR + D F +++D+L  ++L  T + +D+ +  K+
Sbjct:   99 LKASFIICEEIVKRKQAFDSVDVVKEC-AVKMARVFGNEEMAAKFDSISLQPQTVARRVSAMHQQITQKLHAILKNCCYFSLALDETTDSCGTDLLVIFIRAIDDGFNISEDILKCVSLPKTAKEEDLLNEAKS 231          
BLAST of SMED30027226 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 212.231 bits (539), Expect = 8.996e-68
Identity = 117/311 (37.62%), Postives = 175/311 (56.27%), Query Frame = -2
Query: 1496 AMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQT--INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKF 2422
            AM+  N G V        A+    +++  + C+IH + LCAQ L M HVM VV+ +VN+I S  L H  F   L EL S+YG ++Y T ++WL RG  L+ FFE   EI++FM+    PV  L+   W+LDL FLV++T  +N L+  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK  + S++  +N+     +I +L AEF  R S+    +    +FSSPF   + +V E LQME+I+LQCN  L++ +      + Y    ++  YP  +    +++S F ST++CE  FS +K 
Sbjct:  617 AMMDANSGLVTKLRAR-AASCCKGADLKSVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESDGLNYIP---KIVELKAEFQRRLSDFKSCESELTLFSSPFSTTIDSVREELQMEVIDLQCNTVLRTKYDKVGVPDFYKHLWSS--YPKYRSHCARMLSMFSSTHICEQLFSILKL 921          

HSP 2 Score: 67.3958 bits (163), Expect = 8.996e-68
Identity = 29/60 (48.33%), Postives = 47/60 (78.33%), Query Frame = -1
Query: 2493 LRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2672
            LR++I+ F AYS+A DE TDI+DT+QLA+FIRGV D+F V++++L+ + +     G+++F
Sbjct:  531 LRQKIRSFVAYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIF 590          
BLAST of SMED30027226 vs. Ensembl Mouse
Match: Epm2aip1 (EPM2A (laforin) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1925031])

HSP 1 Score: 127.872 bits (320), Expect = 4.355e-44
Identity = 100/346 (28.90%), Postives = 167/346 (48.27%), Query Frame = -2
Query: 1433 MIGKNKGTVKLFMYELEATSVNPSEIFVIH--CLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVR-WLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFP--------LLKKFNSSQTI-NFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKID 2419
            MIG+N G V  +M E    +V+P+   VIH    +H + L +  + +N ++  + + V  I++  ++  +F+  L E  SE+G+ V    +  WL RG  LK  F LR EIE F+        + +D+ WL D  FLV+I + +  +++ELQ        A   I  F+ KL   +  +   NL  FP        L ++F   Q I +  +    I +L  +F   F +L    K  E+FS+PF       P ++++E+  LQ N  L + ++     + Y   ++ E YP +K    K+ S F S  +C+  F+ +          LTDE+L++  R ATT++D
Sbjct:  253 MIGENSGLVS-YMRE---KAVSPNCWNVIHYSGFLHLELLSSYDVDINQIINTISEWVVMIKTRGVRRPEFQPLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEIEAFLVSVGATTVHFSDKQWLCDFGFLVDIMDYLREISEELQISKVFAAAAFERICTFEGKLSSLQRHMEEVNLTDFPAFSIIVDELKQQFKEDQKIFDPDRYQMVISRLQKDFERHFKDLRFIKKDLELFSNPFSFKPEYAPISVRVELTKLQANTDLWNEYRVKDLGQFYAG-LSGEAYPIIKGVAYKVASLFDSNQICDKAFAYLTRNQHTLSQPLTDEHLQALFRVATTEMD 593          

HSP 2 Score: 72.4034 bits (176), Expect = 4.355e-44
Identity = 37/117 (31.62%), Postives = 65/117 (55.56%), Query Frame = -1
Query: 2523 VKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNL 2873
             +A   +   +A K + + +G+FV +C+  ++ +V+PD   ++  I LS +   + I +I   +   L  R + FKAYSLA D+   ++  + L VFIRGV     V +D+L ++NL
Sbjct:   99 TRAGLGLCRFLALKGRGWGEGDFVHQCMEVLLREVLPDHVGVLEGIDLSPEITRQRILSIDSNLRSQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGRDLEVQEDLLTIINL 215          
BLAST of SMED30027226 vs. Ensembl Mouse
Match: Epm2aip1 (EPM2A (laforin) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1925031])

HSP 1 Score: 127.872 bits (320), Expect = 4.355e-44
Identity = 100/346 (28.90%), Postives = 167/346 (48.27%), Query Frame = -2
Query: 1433 MIGKNKGTVKLFMYELEATSVNPSEIFVIH--CLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVR-WLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFP--------LLKKFNSSQTI-NFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKID 2419
            MIG+N G V  +M E    +V+P+   VIH    +H + L +  + +N ++  + + V  I++  ++  +F+  L E  SE+G+ V    +  WL RG  LK  F LR EIE F+        + +D+ WL D  FLV+I + +  +++ELQ        A   I  F+ KL   +  +   NL  FP        L ++F   Q I +  +    I +L  +F   F +L    K  E+FS+PF       P ++++E+  LQ N  L + ++     + Y   ++ E YP +K    K+ S F S  +C+  F+ +          LTDE+L++  R ATT++D
Sbjct:  253 MIGENSGLVS-YMRE---KAVSPNCWNVIHYSGFLHLELLSSYDVDINQIINTISEWVVMIKTRGVRRPEFQPLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEIEAFLVSVGATTVHFSDKQWLCDFGFLVDIMDYLREISEELQISKVFAAAAFERICTFEGKLSSLQRHMEEVNLTDFPAFSIIVDELKQQFKEDQKIFDPDRYQMVISRLQKDFERHFKDLRFIKKDLELFSNPFSFKPEYAPISVRVELTKLQANTDLWNEYRVKDLGQFYAG-LSGEAYPIIKGVAYKVASLFDSNQICDKAFAYLTRNQHTLSQPLTDEHLQALFRVATTEMD 593          

HSP 2 Score: 72.4034 bits (176), Expect = 4.355e-44
Identity = 37/117 (31.62%), Postives = 65/117 (55.56%), Query Frame = -1
Query: 2523 VKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNL 2873
             +A   +   +A K + + +G+FV +C+  ++ +V+PD   ++  I LS +   + I +I   +   L  R + FKAYSLA D+   ++  + L VFIRGV     V +D+L ++NL
Sbjct:   99 TRAGLGLCRFLALKGRGWGEGDFVHQCMEVLLREVLPDHVGVLEGIDLSPEITRQRILSIDSNLRSQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGRDLEVQEDLLTIINL 215          
BLAST of SMED30027226 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 117.857 bits (294), Expect = 5.982e-34
Identity = 104/381 (27.30%), Postives = 168/381 (44.09%), Query Frame = -2
Query: 1385 FFRFREYLWIA-------SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMN--HVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEE--RNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKY-----DKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFS-----KMKFHASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2464
            F R  E  W +        A A +G   G  +L + E      +P  I   HC++H Q L  + L  +   VM  V+ +VN++++ +L  R F     +L      ++  T+ RWLSRG  LK  FELR E++ F  ++  R   +  +D   L  + +LV+I   +N LN  LQG ++  +     I +FQ KL L++ +L  N  +  P L  F     I   K    +  +        SE++ Y     +  F +  SPF V    VPE  Q +   L  ++  ++   T    + +   +  + YP L     +++  F +TY+CE  FS     K K+ + L    +E  LRCA  K    +  L  +K+ Q  H
Sbjct:  388 FLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNE------SPKAIGA-HCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSAFFEEHDIEQHKRITVVISVKEHLDMLASEISWYFPNLPEIPFALARSPFSVKAEDVPETAQEDFTRLTNSDAARADFSTMPVTQFWVKCL--QSYPVLSEMVLRLLLPFPTTYLCETGFSSLLVIKSKYRSRLV---VEDDLRCALAKTTPRISDLVRKKQSQPSH 756          

HSP 2 Score: 48.521 bits (114), Expect = 5.982e-34
Identity = 43/139 (30.94%), Postives = 71/139 (51.08%), Query Frame = -1
Query: 2484 VKASYSVAMLIAKKMKPFSDGEFV-----KECLAAVIEDVMPDKHKMISSISLSSQTICRHINA----ILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2873
            V+ SY VA+ IA+ MKP +  E +     K+ +  +I D    K   +S++SLS+ T+ R I+     ILD++V  ++         S+  DESTD+++  QL V++R + D      + L    L+ T    DVF  +
Sbjct:  253 VETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTK---LSAVSLSNDTVRRRIHDMSADILDQVVQEIKS--APLPICSIQLDESTDVANCLQLMVYVRYINDG-DFKDEFLCCKPLERTATALDVFEAV 385          
BLAST of SMED30027226 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 98.9821 bits (245), Expect = 3.262e-20
Identity = 85/331 (25.68%), Postives = 150/331 (45.32%), Query Frame = -2
Query: 1400 HCLIH*QNLCAQVLS--MNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSN-LNDEMWLLDLCFLVNITEKINHLNKELQGQDN--LNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSP---------FQVDVFT------VPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKFHASLTDENLESQLRCATTKIDVDLKTLSDRKE 2332
            HC IH ++L A+ LS  ++ ++    + ++++++ A   +      +E+ SE+ ++    +VRWLSRG  L   FELR EIE F+ ++ + ++   +DE W+  L +L +I   IN LN  LQG      N+Y  N +  FQ +L ++  + + N+   FPL  +F  S  ++    A  I          F  L    + F     P         +  D F       + ++ + ++  L  +   +SVHK+ S  + +    T+  YP L     K++  F ST +C+  FS +              LR A T +   ++ L+  KE
Sbjct:  933 HCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLY--NKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDVSVKNIASII----------FEHLEGLSQIFHACYPPEEDLRSGNLWLTDPFATYHSNNLTDSEEEKLAVLSADTGFQSVHKSMSVTQFWVNAKTS--YPKLHEKALKLLLPFSSTCLCDATFSALTASKQRDLRTCGPTLRLAVTSLVPRIEKLAKEKE 1249          

HSP 2 Score: 52.7582 bits (125), Expect = 4.036e-6
Identity = 41/144 (28.47%), Postives = 77/144 (53.47%), Query Frame = -1
Query: 2472 LQLSSNIVKASYSVAMLIAKKMKPFSDGE-FVKECLAAVIEDVM-PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGV-YDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVY 2894
            L +  ++VKASY +A  IA + KPFS  E  +K  L  +  +V+     + + +I LS+ TI   I  + D+I   L +++++ + ++L  DES++ ++   L  ++R + YD   V +++L    +   +   +VF  I N Y
Sbjct:  746 LLVEESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELI-NKY 888          
BLAST of SMED30027226 vs. UniProt/SwissProt
Match: sp|Q86UP8|GTD2A_HUMAN (General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3)

HSP 1 Score: 231.106 bits (588), Expect = 1.392e-74
Identity = 138/336 (41.07%), Postives = 190/336 (56.55%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK--KFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFF-----SKMKFHASLTDENLESQLRCAT 2431
               AM+  N G V      + AT    +E+  I C+IH ++LCAQ L M+HVM VV+K+VN+I S  L H +F   L EL S+YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+   W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF   + +V E LQME+I+LQCN  LK+ +      E Y  Y+    YP  K    KI+S FGSTY+CE  F     SK K+ + L D   +S L  AT
Sbjct:  620 GTPAMVDANNGLVTKLKSRV-ATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGLNYIP---KIAELQTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYK-YLWGS-YPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT 949          

HSP 2 Score: 73.9442 bits (180), Expect = 1.392e-74
Identity = 37/120 (30.83%), Postives = 70/120 (58.33%), Query Frame = -1
Query: 2406 PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVYPVIL*I*RIFMDCFCFCYDW*K 2765
            P++ ++ ++ S + ++  + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F              R+      FC DW K
Sbjct:  506 PEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFS-------------RVEKSLKNFCIDWSK 612          
BLAST of SMED30027226 vs. UniProt/SwissProt
Match: sp|Q6EKJ0|GTD2B_HUMAN (General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 5.166e-74
Identity = 138/336 (41.07%), Postives = 190/336 (56.55%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK--KFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFF-----SKMKFHASLTDENLESQLRCAT 2431
               AM+  N G V      + AT    +E+  I C+IH ++LCAQ L M+HVM VV+K+VN+I S  L H +F   L EL S+YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+   W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF   + +V E LQME+I+LQCN  LK+ +      E Y  Y+    YP  K    KI+S FGSTY+CE  F     SK K+ + L D   +S L  AT
Sbjct:  620 GTPAMVDANNGLVTKLKSRV-ATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLVSRNESDGLNYIP---KIAELKTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYK-YLWGS-YPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT 949          

HSP 2 Score: 71.633 bits (174), Expect = 5.166e-74
Identity = 31/91 (34.07%), Postives = 63/91 (69.23%), Query Frame = -1
Query: 2493 PDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2765
            P++ ++ ++ S + ++  + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F
Sbjct:  506 PEQKQVFANPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 596          
BLAST of SMED30027226 vs. UniProt/SwissProt
Match: sp|A4IFA3|GT2D2_BOVIN (General transcription factor II-I repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=GTF2IRD2 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.582e-73
Identity = 132/336 (39.29%), Postives = 188/336 (55.95%), Query Frame = -2
Query: 1445 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKF--NSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKFH-----ASLTDENLESQLRCAT 2431
               AM+  N G V     ++ A     S++  + C+IH ++LCAQ L M+H+M VV+  VN+I S  L H +F   L EL  +YG ++Y+T+++WLSRG  LK FFE   EI++FM+    P+  L+ + W+ DL FLV++T  +N LN  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK    N S  +N+     +I +L  EF  R S+   Y+    +FSSPF + + +V EALQME+I+LQCN  LK+ +      E Y     +  YP  K    KI+S FGSTY+CE  FS MK       + L D   +S L  +T
Sbjct:  621 GTPAMVDANDGLVTKLKSKV-AMVCKGSDLKSVCCIIHPESLCAQKLKMDHIMSVVVNAVNWICSRGLNHSEFTTLLYELDCQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSQDWIKDLAFLVDMTMHLNTLNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLARNNLAHFPTLKSVSRNESDGLNYIP---KIVELKTEFQKRLSDFKLYESELTLFSSPFSMKIESVQEALQMEVIDLQCNTVLKTKYDKVGIPEFYKHLWGS--YPKYKIHCAKILSMFGSTYICEQLFSIMKLSKTEYCSQLKDSQWDSVLHIST 950          

HSP 2 Score: 72.4034 bits (176), Expect = 4.582e-73
Identity = 33/106 (31.13%), Postives = 67/106 (63.21%), Query Frame = -1
Query: 2493 EFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2810
            E +++ L    + V P++ ++ + ++       + +  +   +   LRE+I+ F AYS+A DE TDI++T+QLA+FIRGV ++F V++++L+ + +  T  G+++F
Sbjct:  492 EGLRKYLLGSSDTVCPEQKQVFAKVNPRENAAVQPVEDVAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 597          
BLAST of SMED30027226 vs. UniProt/SwissProt
Match: sp|Q99NI3|GT2D2_MOUSE (General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 5.494e-67
Identity = 117/311 (37.62%), Postives = 175/311 (56.27%), Query Frame = -2
Query: 1496 AMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQT--INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKF 2422
            AM+  N G V        A+    +++  + C+IH + LCAQ L M HVM VV+ +VN+I S  L H  F   L EL S+YG ++Y T ++WL RG  L+ FFE   EI++FM+    PV  L+   W+LDL FLV++T  +N L+  LQG   +     + I+AF  KL L+E+ L  NNL HFP LK  + S++  +N+     +I +L AEF  R S+    +    +FSSPF   + +V E LQME+I+LQCN  L++ +      + Y    ++  YP  +    +++S F ST++CE  FS +K 
Sbjct:  617 AMMDANSGLVTKLRAR-AASCCKGADLKSVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESDGLNYIP---KIVELKAEFQRRLSDFKSCESELTLFSSPFSTTIDSVREELQMEVIDLQCNTVLRTKYDKVGVPDFYKHLWSS--YPKYRSHCARMLSMFSSTHICEQLFSILKL 921          

HSP 2 Score: 67.3958 bits (163), Expect = 5.494e-67
Identity = 29/60 (48.33%), Postives = 47/60 (78.33%), Query Frame = -1
Query: 2493 LRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2672
            LR++I+ F AYS+A DE TDI+DT+QLA+FIRGV D+F V++++L+ + +     G+++F
Sbjct:  531 LRQKIRSFVAYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIF 590          
BLAST of SMED30027226 vs. UniProt/SwissProt
Match: sp|Q7L775|EPMIP_HUMAN (EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.784e-45
Identity = 105/346 (30.35%), Postives = 170/346 (49.13%), Query Frame = -2
Query: 1433 MIGKNKGTVKLFMYELEATSVNPSEIFVIH--CLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVR-WLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNS---SQTINFAKCADE------I*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKID 2419
            MIG+N G V  +M E    +V+P+   VIH    +H + L +  + +N ++  + + +  I++  ++  +F+  L E  SE+G+ V    +  WL RG  LK  F LR E+E F+        + +D+ WL D  FLV+I E +  L++EL+        A +HI  F+ KL LF+  +   NL  FP L++       Q     K  D       I +L  EF   F +L    K  E+FS+PF       P ++++E+  LQ N  L + ++     + Y   ++AE YP +K    K+ S F S  +CE  FS +          LTDE+L++  R ATT+++
Sbjct:  252 MIGENSGLVS-YMRE---KAVSPNCWNVIHYSGFLHLELLSSYDVDVNQIINTISEWIVLIKTRGVRRPEFQTLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEMEAFLVSVGATTVHFSDKQWLCDFGFLVDIMEHLRELSEELRVSKVFAAAAFDHICTFEVKLNLFQRHIEEKNLTDFPALREVVDELKQQNKEDEKIFDPDRYQMVICRLQKEFERHFKDLRFIKKDLELFSNPFNFKPEYAPISVRVELTKLQANTNLWNEYRIKDLGQFY-AGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEME 592          

HSP 2 Score: 69.707 bits (169), Expect = 3.784e-45
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = -1
Query: 2523 SSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNL 2900
            +S        +A   +  L+A K + + +G+FV +C+  ++ +V+P+   ++  + LS     + I +I   +   L  R + FKAYSLA D+   ++  + L VFIRGV     V +D+L ++NL
Sbjct:   89 ASFTPEERAARAGLGLCRLLALKGRGWGEGDFVYQCMEVLLREVLPEHVSVLQGVDLSPDITRQRILSIDRNLRNQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGPELEVQEDLLTIINL 214          
BLAST of SMED30027226 vs. TrEMBL
Match: A0A5C6NWF3 (General transcription factor II-I repeat domain-containing protein 2A OS=Takifugu flavidus OX=433684 GN=D4764_17G0006410 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.883e-99
Identity = 145/355 (40.85%), Postives = 215/355 (60.56%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFA-KCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A AM+G  KG   L   E+    ++PS+I V HC+IH ++LCA  L +N+VM  V+ T+N+I+S  L +R+FK  L EL SEYGD+VY  +VRWLSR   L  F+ LR E+++FM  +  PV  L+D  +L DL F+V+IT+ ++ LN +LQG + L     +++K F+ KL L++ QL   N  HFP L++        +A +CA    KL   F  RF ++    +  ++F++PF V    VP+  QMEII LQ NN+LK+ +   S ++ Y  Y++AE +P L+    K  S FG+TY CE FFSK+     +F + LTD NLE+QLR A++ +  D++ LS  K+ Q  H
Sbjct:  247 GAPAMVGTQKGLTALVKKEMSRLGLDPSDIVVCHCVIHQESLCAHSLKLNNVMKTVVSTINFIKSRGLNNRQFKELLSELESEYGDLVYHCEVRWLSRANMLARFYTLREEVKHFMEMKGKPVMELSDGKFLSDLAFMVDITKHLSELNIKLQGPNQLISSLLSNVKTFEVKLRLWQEQLERGNTVHFPTLQEQKPDVMTEYAGECA----KLVQAFDERFHDVKNIQRELDMFATPFNVQPSDVPDKFQMEIIELQNNNELKAKYNNLSLLDFYKLYVSAEDFPILRRHALKFASLFGTTYRCEQFFSKLTLAKTRFRSRLTDPNLENQLRVASSSLPADIRCLSKEKQFQPSH 597          

HSP 2 Score: 120.168 bits (300), Expect = 1.883e-99
Identity = 58/132 (43.94%), Postives = 93/132 (70.45%), Query Frame = -1
Query: 2484 NIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2879
            NI +AS+ V+ LIAKK+KP ++GEFVKECL A  E + PDK K+  S+SLS +T+   I  +   I  TL++  + F+ +SLA DE+TDI++T+QLA+F+RG+   F + +++L+L  +  T++G+D+F  +
Sbjct:   96 NITQASFVVSELIAKKLKPHAEGEFVKECLVAAAEVLAPDKVKLFQSVSLSRRTVADRITDMAQNIEKTLKDTARDFEYFSLACDETTDITNTAQLAIFVRGI-SKFEIKEELLSLQAMHGTSKGEDLFSQV 226          
BLAST of SMED30027226 vs. TrEMBL
Match: A0A3S2LTQ6 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00165900 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 4.468e-99
Identity = 148/358 (41.34%), Postives = 224/358 (62.57%), Query Frame = -2
Query: 1391 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKF-NSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKS----VHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFS-----KMKFHASLTDENLESQLRCAT-TKIDVDLKTLSDRKEKQI 2431
             A +M G+  G V L   +LE   V   E   +HC+IH Q LC++ L  ++VM V++K +N IRS  L+HR+F+A+L+E+ SEYGD++YFT+VRWLSRG  LK FFELR E+++FM ++   VS L+D  WL+DL FLV+IT ++N LNK+LQGQ  L     ++++AF TKL+L+++QL   NL HFP  K   ++    +  K  + I KL  EF  RF++   +  TF++F+ P+  DV   P  LQME+I+LQCN+ LK+    V   T K+  +   +T   +P L    ++ +  FGSTY+CE  FS     K K+ + LTDE+L++ LR +T + +  ++  L ++K  Q+
Sbjct:  252 GAPSMTGRKNGLVALVQKKLEEEGVE--EAIALHCIIHQQALCSRCLKFDNVMSVIVKCINQIRSRGLKHRRFRAFLEEMESEYGDVLYFTEVRWLSRGNVLKRFFELRAEVKDFMEKDGMAVSVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSATYDNVRAFCTKLVLWKAQLSQTNLCHFPACKALVDAGTPFSGEKYVEAILKLQEEFDQRFADFKTHRATFQMFADPYSFDVQDAPPVLQMELIDLQCNSALKAKFRDVSGKTDKLGHFLKELTPS-FPELSRMFKRTMCLFGSTYMCEKLFSTLNFNKSKYRSKLTDEHLQALLRVSTASSLKPNVAQLCEKKRCQV 606          

HSP 2 Score: 116.316 bits (290), Expect = 4.468e-99
Identity = 56/141 (39.72%), Postives = 93/141 (65.96%), Query Frame = -1
Query: 2484 FSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2906
            F  + + ++  V+ASY V+ +IAK  KPF++GEFVK+CL  V   V P+K    ++ISLS+ T+   I+ +  +I   L E+ + F  YS+A DE+TDI+DT+QLA+++RGV D+F V +++L ++ +   T   ++FH +
Sbjct:   91 FKKATKENNAAVEASYVVSEMIAKAGKPFTEGEFVKKCLLQVAHFVCPEKKGQFNNISLSANTVAERISDLSSDIYEQLCEKAKCFSVYSVALDETTDITDTAQLAIYVRGVDDNFEVIEELLTVIPMHGQTTAKEIFHQL 231          
BLAST of SMED30027226 vs. TrEMBL
Match: A0A498N0V3 (General transcription factor II-I repeat domain-containing 2-like protein OS=Labeo rohita OX=84645 GN=ROHU_005422 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 5.737e-99
Identity = 143/355 (40.28%), Postives = 218/355 (61.41%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFA-KCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A AM+G+ KG   L   E+   +++PS++ V HC+IH ++LCA  L ++ VM  V+ T+N+I+S  L  R+FK  L +L SEYGD+VY  +VRWLSR   L+ F++LR E++ FM  +  PV  L+D+ WL DL F+V+IT+ ++ LN +LQG + L     +H+K+F+ KL L++SQL  +   HFP L++   + T  +A +CA    KL   F  RF ++       +IF+ PF V+   VP+ LQ EII LQ N++LK+ +     +E    Y+ +E +P L+    K+ S FG+TY CE FFSK+     +F + LTD NLE+QLR A++ +  D+K L+  K+ Q  H
Sbjct:  181 GAPAMLGQQKGLTALIKKEMSRLNLDPSDLVVCHCIIHQESLCAHSLKLHSVMTTVVSTINFIKSRGLNSRQFKELLSDLESEYGDLVYHCEVRWLSRADMLERFYKLREEVKQFMEIKGKPVVELSDDKWLCDLAFMVDITKHLSELNVKLQGLNQLLSSLLSHVKSFEAKLKLWQSQLEKSCTVHFPTLQEQKPAMTTEYAGECA----KLLQAFGERFQDIKSKQNELKIFAVPFNVEPSEVPDNLQHEIIELQSNDELKAKYNNLPLLEFCKLYVRSEDFPILRRHALKLASLFGTTYCCEQFFSKLTLAKTRFRSRLTDSNLENQLRVASSSLPSDIKCLAKEKQFQPSH 531          

HSP 2 Score: 121.324 bits (303), Expect = 5.737e-99
Identity = 57/132 (43.18%), Postives = 91/132 (68.94%), Query Frame = -1
Query: 2484 NIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2879
            N++  S+ V+ LIAKK+KP SDGEFVKECL A  E + P+K K+  S+SLS +T+   I  +  +I  TL +  ++ + +SLA DE+TDI++T+QLA+F+R +   F  T+++L+L  +  TT+G+D+F  +
Sbjct:   29 NVIHTSFVVSELIAKKLKPHSDGEFVKECLVAAAELLAPEKVKLFQSVSLSRRTVAERITDMAQDIETTLNDTGKKLQFFSLACDETTDITNTTQLAIFVRRITAEFETTEELLSLQAMHGTTKGEDLFEQV 160          
BLAST of SMED30027226 vs. TrEMBL
Match: A0A2D0RR35 (general transcription factor II-I repeat domain-containing protein 2-like OS=Ictalurus punctatus OX=7998 GN=LOC108270644 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.060e-98
Identity = 147/357 (41.18%), Postives = 219/357 (61.34%), Query Frame = -2
Query: 1391 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQT-INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKS-VHKTTSKIEIYNTYIT--AERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCA-TTKIDVDLKTLSDRKEKQI 2431
             A +M G+  G V L   +LE   V   E   +HC+IH Q LC++ L  ++VM  V+K +N+IRS  L+HR+F+ +L+E+ S Y D++YFT+VRWLSRG  LK FFELR E++ FM ++   V  L+D  WL+DL FLV+IT+++N LNK+LQGQ  L   A + ++AF TKL+L+++QL   NL HFP  K    S T  +  K  D I KL  EF HRF++   +  TF+IF+ PF  DV   P  +Q+E+I+LQC+++LK+   + + K +    ++      +P L    ++I+  FGSTY+CE  FS M     KF + LTDE+L + LR +  + +  ++  L  RK  Q+
Sbjct:  250 GAPSMTGRRNGLVALVQRKLEEEGVE--EAIALHCIIHQQALCSKCLKFDNVMSDVVKCINHIRSRGLKHRQFRTFLEEIESAYEDVLYFTEVRWLSRGDVLKRFFELRAEVKAFMDKDGMAVPVLSDPKWLMDLAFLVDITQELNVLNKKLQGQGQLVSVAYDSVRAFSTKLVLWKAQLSQTNLCHFPACKALMDSGTPFSGEKYVDTILKLQEEFDHRFADFKTHRATFQIFADPFSFDVEDAPPVVQLELIDLQCSSELKAKFREVSGKTDKLGQFMREFPPTFPELPKMFKRIMCLFGSTYLCEKLFSTMNFNKSKFRSRLTDEHLRAILRVSVASSLKPNVAQLCKRKRCQV 604          

HSP 2 Score: 119.398 bits (298), Expect = 1.060e-98
Identity = 59/142 (41.55%), Postives = 90/142 (63.38%), Query Frame = -1
Query: 2484 MFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2909
             F  + + S   V+ASY V+ +IAK  KPF DGEF+K+C+      V  +K    S+ISLS+ T+   I+ + D I   LRE+ + F +YS+A DESTD++DT QLA+++RGV D+F V +D+L +  +   T G ++FH +
Sbjct:   90 FFKKASKESDAAVEASYVVSEMIAKAGKPFKDGEFIKQCMLQAASIVCLEKKGQFSNISLSANTVAERISDLSDNIYDQLREKARHFHSYSVALDESTDVTDTVQLAIYVRGVDDNFEVMEDLLTINPMHGQTTGQEIFHQL 231          
BLAST of SMED30027226 vs. TrEMBL
Match: A0A4U5TU71 (General transcription factor II-I repeat domain-containing protein 2 OS=Collichthys lucidus OX=240159 GN=D9C73_027755 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.047e-98
Identity = 148/357 (41.46%), Postives = 224/357 (62.75%), Query Frame = -2
Query: 1391 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQT-INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKS-VHKTTSKIEIYNTYIT--AERYPNLK*FGQKIVSAFGSTYVCEVFFS-----KMKFHASLTDENLESQLRCAT-TKIDVDLKTLSDRKEKQI 2431
             A +M  +  G V L   +LE   V   E   +HC+IH Q LC++ L  ++VM VV+K +N I+S  L+HR+F+A+L+E+ SEYGD++YFT+VRWLSRG  LK FFELR E++ FM ++   V  L+D  WL+DL FLV+IT ++N LNK+LQGQ  L   A ++++AF TKL+L+++QL   NL HFP  K    + T  +  K  D I KL  EF HRF++   +  TF+IF+ PF  DV   P  LQME+I+LQCN++LK+   + + K++    ++      +P L    ++ +  FGSTY+CE  FS     K K+ + LTD++L++ LR +T + +  ++  L +R+  Q+
Sbjct:  228 GALSMTRRKNGLVALVKKKLEEEGVE--EAIALHCIIHQQALCSKCLKFDNVMSVVVKCINQIKSRGLKHRRFRAFLEEMESEYGDVLYFTEVRWLSRGNVLKRFFELRAEVKAFMEKDGVAVPVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSTKLVLWKAQLSQTNLCHFPACKALADAGTPFSGEKYVDVILKLQEEFDHRFADFKTHRATFQIFADPFSFDVQDAPPVLQMELIDLQCNSELKAKFREVSGKVDKLGQFLRELTPSFPELSRMFKRTMCLFGSTYLCEKLFSTLNFNKSKYRSRLTDDHLQAILRVSTASSLHPNVARLCERRRCQV 582          

HSP 2 Score: 113.235 bits (282), Expect = 3.047e-98
Identity = 55/138 (39.86%), Postives = 91/138 (65.94%), Query Frame = -1
Query: 2493 FSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVF 2906
            F  + + S+  VKASY V+ +IA   KPF++GEFVK+C+      + P+K    S+ISLS+ T+   I+ + ++I   L E+ + F AYS+A DE+TDI+DT+QLA+++RGV D+F V +++L ++ +   T   ++F
Sbjct:   67 FKKATKESNAAVKASYMVSEMIATAGKPFTEGEFVKKCILQAASIICPEKKGQFSNISLSANTVAERISDLSNDIYDQLCEKAKCFSAYSVALDETTDITDTAQLAMYVRGVNDNFEVMEELLRVIPMHGQTTAQEIF 204          
BLAST of SMED30027226 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.529 bits (654), Expect = 2.095e-96
Identity = 135/319 (42.32%), Postives = 198/319 (62.07%), Query Frame = -2
Query: 1487 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQT-INFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKS-VHKTTSKIEIYNTYIT--AERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKFHAS 2431
             A +M G+  G        LE  SV   E   +HC+IH Q LC++ L  ++VM VV+K +N IRS +L+HR+F+A L+E+ SEYGD++YFT+VRWLSRG  LK FFELR E++ FM ++   V+ L+D  WL+DL FLV+IT ++N LNK+LQGQ  L   A ++++AF  KL+L+++QL   N  HFP  K    + T  +  K  D I  L  EF HRF++   +  TF+IF+ PF  DV   P  LQME+I+LQCN++L++   + + K +    ++      +P L    ++ +  FGSTY+CE  FS + F+ S
Sbjct:  304 GAPSMTGRKNG--------LEEESVE--EAIALHCIIHQQALCSKCLKFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAEVKAFMEKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSAKLMLWKAQLSQTNFCHFPACKALMDAGTPFSGEKYVDAILMLQEEFDHRFADFKTHRATFQIFADPFSFDVQDAPPVLQMELIDLQCNSELRAKFREVSGKADKLGQFLRELPLSFPELSRMFKRTMCLFGSTYLCEKLFSTLNFNKS 612          

HSP 2 Score: 118.242 bits (295), Expect = 2.095e-96
Identity = 57/142 (40.14%), Postives = 93/142 (65.49%), Query Frame = -1
Query: 2484 MFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2909
             F  + + +   V+ASY V+ +IAK  KPF++GEFVK+C+      V P+K    S+ISLS+ T+   I+ +  +I   L E+ ++F  YS+A DESTDI+DT+QLA+++RGV D+F VT+++L ++ +   T   ++FH +
Sbjct:  142 FFKKATKENDAAVEASYVVSEMIAKAGKPFTEGEFVKKCILQAASIVCPEKKGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQL 283          
BLAST of SMED30027226 vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 240.736 bits (613), Expect = 9.209e-91
Identity = 131/352 (37.22%), Postives = 204/352 (57.95%), Query Frame = -2
Query: 1406 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNS--SQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATT---KIDVDLKTLSDR 2431
             A AM G+  G V L   +++  + +   +   HC+IH + LC +VL M++++  V+KTVN+IR+  L HR+F+ +L E+ SE+GD++Y T+VRWLSR      FFELR +I  FM  + NP+S L+D  WL D   L +ITE +  LN++LQG+  +     + I AFQ KL L+  Q + +NL HFP+ +  ++    T + A+   ++ +L  EF  RFS+       F IF++PF  DV T P+ LQME+I LQ ++ L++  +  + I+ +   +     P L+    +++S FGSTY+CE  FS M     K  + LTD+NL + LR A+    K D+D   +  R
Sbjct:  247 GAPAMCGEKNGLVGLMKGKMQKMNCH-MPLITYHCIIHQEALCGKVLGMDNIVTTVMKTVNFIRARGLNHRQFQMFLQEIDSEHGDVLYHTEVRWLSRSR----FFELREDIALFMQSKGNPLSELSDPKWLCDFAVLCDITEHLAQLNQKLQGRKQVITQMSDMITAFQRKLDLWMCQAKQDNLAHFPVCQSMSALFPGTFSCAQLTTKLSRLKTEFDRRFSDFRGQQSGFAIFANPFTTDVCTAPQHLQMELIELQSDSGLRAKFQDAA-IQDFYRLLPPGLMPQLRLHAARVLSMFGSTYLCEQMFSIMNLNKNKHRSCLTDDNLHAVLRIASAQDLKPDIDTLVMGKR 592          

HSP 2 Score: 115.161 bits (287), Expect = 9.209e-91
Identity = 58/149 (38.93%), Postives = 92/149 (61.74%), Query Frame = -1
Query: 2481 IKNIKKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2927
            +K+ + +F+ +   +S  VKAS+ VA  IA+  K FS G F+K+C+  V E V PD+ +   ++SLS  TI   +  + + +   L E  + + A+SLA DESTD +DT+QLA+FIRGV     VT+D+L++  +  TT G D+F  ++
Sbjct:   79 LKSQQNLFTKATAKNSAAVKASFIVAEEIARASKYFSGGAFLKQCMLKVCEQVCPDQIQTFKNVSLSRNTIADRVKELAENLATQLAEETRSYTAFSLAVDESTDNTDTAQLAIFIRGVKSDLSVTEDLLDVAAMHGTTTGQDIFDAVE 227          
BLAST of SMED30027226 vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.81 bits (608), Expect = 8.070e-84
Identity = 129/354 (36.44%), Postives = 206/354 (58.19%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKFHAS-----LTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A +++G+  G +      L       +E+   HC+IH + LC + L    +M  V+  VN+IR+ +L+HR+F ++L+++S+ YGD++Y T+VRWLSRG  LK FF LR EI+ F+ ++      + +  W+ DL FL ++T  +N LN +LQG+D L  +    + AF+ KL LF +QL+  NL HFP  ++  + +  N+++ +  +  L   F+ RF +      T ++ + PF VD  TVP  LQ EII L+C+  +++ H+    +E Y + +  E++PNL    QK +S FGSTY+CE  FS MK + S     LTDENL++ LR ATT ++ D+  L   +   I H
Sbjct:  437 GALSVVGETNGFIGHLKRHLGPDQA--AELKHYHCIIHQEALCGKHLHFKEIMDFVVSAVNFIRARSLKHREFPSFLEDISAAYGDVIYHTEVRWLSRGNVLKRFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAHKNYNWSRHSCVLEDLKLAFSARFGQFRNEQATLQLLADPFSVDTETVPGELQPEIIELKCSTAMRTKHREMPLLEFYQS-LDREQFPNLFANAQKWISMFGSTYICEQMFSLMKLNKSPLRTRLTDENLQAVLRLATTSLEPDINQLVSERRCNISH 787          

HSP 2 Score: 93.9745 bits (232), Expect = 8.070e-84
Identity = 51/129 (39.53%), Postives = 74/129 (57.36%), Query Frame = -1
Query: 2481 ASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2867
            ASY +A L+AK  +PF DGEFVK+C+    + + P+      +ISLS  TI   I  +       L+ RI     +S A DESTD +DT+QL++FIRGV  +  V Q++  L+ L   T G ++F+  K
Sbjct:  289 ASYRIANLVAKSARPFIDGEFVKDCMLEACDVICPEAKDAFKNISLSRTTIQLRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFK 417          
BLAST of SMED30027226 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 4.103e-72
Identity = 134/358 (37.43%), Postives = 197/358 (55.03%), Query Frame = -2
Query: 1388 SASAMIGKNKGTVKLFMYELEATSVNPSEIFV-IHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHF----PLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIF 2431
             A AM G + G + L         + P+  FV  HC+IH Q L ++V+  +HVM VV+K VN IR+ ALQHR FK+ LDEL +EYGD++    VRWLSRG  L+ F  L  EI +F+   +     L D+ WLLDL FL ++T K+N LN ELQG+D    +  + + AF+ KL L+ SQL+   L HF     +L   ++  + +       + +L  EF+ RF EL K     E  S+ FQ  VF +P  + MEII+L+ + ++K+     S+ + +   ++ ERYP+L     K+ + FGSTY CE+ F +M     K+   LTD +L   +R A +    D K  +D  + Q F
Sbjct:  250 GAPAMCGIHAGFIAL----CRKDPIFPA--FVSYHCVIHQQALASKVVDFSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAEYGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEEYRELADDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLNNISNKDSFHPENFCIHLNRLEEEFSKRFEELNK--DIIEELSAKFQ-QVFELPNGVDMEIIDLENDIEMKA----RSRDKDFWGLVSRERYPSLSACALKVKAFFGSTYFCEMSFPQMKIIKSKYRTCLTDAHLTDCVRLAVSNYTPDYKAPADSVQPQNF 594          

HSP 2 Score: 85.8853 bits (211), Expect = 4.103e-72
Identity = 49/144 (34.03%), Postives = 83/144 (57.64%), Query Frame = -1
Query: 2481 LQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPD-KHK-----MISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2894
            L+ ++   +AS+ V+ L+AK  K F+DGE  KE +    + +  D K+K      IS++SL   T+ R +  + ++I   +   + + + +SL FDES DI+DT+QL VF+R  +    V +D L LL L + TRG+D++   +
Sbjct:   87 LEKANANTEASFRVSHLLAKHKKTFTDGELFKEAMLFASDSLFRDFKNKDEIRTAISNMSLGPATVVRRVELLSEDISKQVLSDLSRCEYFSLQFDESVDITDTAQLVVFVRMTFSDASVKEDFLTLLPLNERTRGEDIYRAFR 230          
BLAST of SMED30027226 vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.963 bits (476), Expect = 1.269e-69
Identity = 94/266 (35.34%), Postives = 157/266 (59.02%), Query Frame = -2
Query: 1634 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHK 2431
             A +M+G+  G +      L       +E+   HC+IH + LC + L    +M  V+  VN+IR+ +L HR+F+++L+++S+ YGD++Y T+VRWLSRG  LK FF LR EI+ F+ ++      + +  W+ DL FL ++T  +N LN +LQG+D L  +    + AF+ KL LF +QL+  NL HFP  ++  + +  N+++ +  +  L   F+ RF +      T ++ + PF VD  TVP  LQ+EII L+C+  +++ H+
Sbjct:  249 GAPSMVGETNGFIGHLKRHLGPDQA--AELKHYHCIIHQEALCGKHLQFKQIMDFVVSAVNFIRARSLNHREFQSFLEDISAAYGDVIYHTEVRWLSRGNVLKIFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAHKNYNWSRHSCVLEDLKLAFSARFGQFRNEQATLQLLADPFSVDTETVPGELQLEIIELKCSTAMRTKHR 512          

HSP 2 Score: 97.4413 bits (241), Expect = 1.269e-69
Identity = 52/129 (40.31%), Postives = 75/129 (58.14%), Query Frame = -1
Query: 2481 ASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2867
            ASY +A L+AK  +PF DGEFVK+C+    + + P+      +ISLS  TI R I  +       L+ RI     +S A DESTD +DT+QL++FIRGV  +  V Q++  L+ L   T G ++F+  K
Sbjct:  101 ASYRIANLVAKSARPFIDGEFVKDCMLEACDVICPEAKDAFKNISLSRTTIQRRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFK 229          
BLAST of SMED30027226 vs. Ensembl Medaka
Match: ENSORLT00000027093.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111947639])

HSP 1 Score: 217.624 bits (553), Expect = 4.481e-82
Identity = 131/340 (38.53%), Postives = 195/340 (57.35%), Query Frame = -2
Query: 1415 MIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKF-----HASLTDENLESQLRCATTKIDVDLKTL 2419
            + GKN G +K    ++  T +     F +HC+IH + LC  VL M HV+ VV KTVN+IR+ AL HR+F A+L+E   E+GDI Y   VRWLS G  LK  ++LR +I++F  ++ + V  L+DE W+ DL F V++T  +N LN +LQ +        + +KAF  KL    SQ+++NNL H P LK+    +  +  K +  +  L AEF+ RF +    +    + SSPF   V   P  +QME+I LQ +  L    ++ S ++ Y++ +  E +P+L+   QKI+  FGSTY CE  FS MKF      +S+TD++L + LR AT+ I  D   L
Sbjct:  238 LTGKNVGLLKRMQDKM--TEIVQKLTF-LHCIIHQEVLCKTVLKMKHVVDVVTKTVNFIRARALNHRQFVAFLEENEIEHGDIRYHCTVRWLSLGKVLKSVWDLRGQIQDFCVDKGHDVPELSDEDWVADLGFAVDVTALMNQLNVKLQSKGLFVHEMYSAVKAFMRKLQFLSSQVKDNNLTHLPTLKEAKRPEG-HLQKYSTMLEALHAEFSRRFQDFKTLESEMHVVSSPFNCIVDDAPSEVQMELIELQSDMLLAERFRSVSLLDFYSS-LKKENFPHLRRHAQKILVLFGSTYHCEQAFSVMKFNKSKHRSSVTDDHLSAVLRIATSDIQPDFCAL 572          

HSP 2 Score: 109.383 bits (272), Expect = 4.481e-82
Identity = 52/130 (40.00%), Postives = 80/130 (61.54%), Query Frame = -1
Query: 2484 VKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2873
            V+ S+ ++  IA+  KPFSDGEFVKECL   +  + P+      +ISLS +T+ R I  I   + + L+ R   F  +SLA DES DI DT+QL +F+RG+   F +T+++  + ++K TT G D+F  +
Sbjct:   84 VRTSFVISHKIARNSKPFSDGEFVKECLLDSVALICPETKSAFENISLSRRTVARRIEDIAGNLELQLKSRAADFDCFSLALDESCDIRDTAQLLIFLRGITAEFQITEELAAMRSMKGTTTGQDLFREV 213          
BLAST of SMED30027226 vs. Ensembl Medaka
Match: ENSORLT00000044825.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:111949247])

HSP 1 Score: 235.343 bits (599), Expect = 9.226e-79
Identity = 129/350 (36.86%), Postives = 200/350 (57.14%), Query Frame = -2
Query: 1397 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFS-----KMKFHASLTDENLESQLRCATTKIDVDLKTLSDRKEK 2431
             A AMIGK  G   L     +  S    ++   HC++H + LCA+ + +  V+  V+K +N IRS AL HR+F+A+LDE+ ++Y DI+Y  +VRWLSRGT LK FFELR  I  F++          D+ W+ D+ F+V+IT+ +N+LN +LQG++ +     +HIKAFQ KL L    L   N  HFP L+  N  +     +  + +  L  EF  RF +  K     E+FS PF V   +VPE LQME+I  QC+ +L+    +    + Y  +++ +RYP ++   Q ++S FGSTY+CE  FS     K+K   +LTD +L+  L  + +K+  ++++L   K++
Sbjct:  213 GAPAMIGKKAGLTALIS---QKVSECGGKVAQYHCILHQEQLCAKTIGLADVVRDVVKIINCIRSKALSHRQFRAFLDEVDAQYKDILYHQEVRWLSRGTVLKRFFELRQLIAEFLSSASRDTQIPTDKRWIFDVAFMVDITDLLNNLNVKLQGKEQIITELFDHIKAFQMKLQLLCRHLSAGNFAHFPSLRDVN-VEVDRLPEYGELLSNLNKEFNLRFVDFKKTAGDMELFSQPFSVSPDSVPEHLQMELIEFQCDTELRRKFVSLPLRDFY-PHVSKQRYPQMRKNAQVMLSLFGSTYICEQTFSLMNLNKIKLRGTLTDSHLQDILTLSVSKLQPNIQSLIKSKDQ 557          

HSP 2 Score: 80.8777 bits (198), Expect = 9.226e-79
Identity = 41/107 (38.32%), Postives = 65/107 (60.75%), Query Frame = -1
Query: 2475 CLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNV 2795
            CL+     + P + ++ S ISLS  T+ R +  +  +I   L  + + F A+SLA DESTDISD++QL VF+RG+     +TQ++  L  L+ TT+G+D+F  +  V
Sbjct:   89 CLSTAASIMCPSQERVFSQISLSRNTVTRRVEDLSRDIRDQLTVKSRDFVAFSLACDESTDISDSAQLLVFVRGINADMEITQELAGLETLRGTTKGEDLFAAVSRV 195          
BLAST of SMED30027226 vs. Ensembl Medaka
Match: ENSORLT00000028655.1 (pep primary_assembly:ASM223467v1:8:18412528:18414615:1 gene:ENSORLG00000023148.1 transcript:ENSORLT00000028655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 2.559e-71
Identity = 105/307 (34.20%), Postives = 163/307 (53.09%), Query Frame = -2
Query: 1532 LWIASASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFP---LLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGST 2443
            L    A AM G   G V      +   +V   E+   HC+IH ++LC + L M HVM  + + VN IR+  L HR+FKA+L EL +EYG++ Y T+VRWLS+G  L+  FELR  I  F+  +    + L DE +L ++ FL +IT  +N +N +LQG+  +     + ++ F+TKL L+E+ +R  NL HFP    +K+  S+     A+ AD++                      I ++ F++DV + P  LQME+I LQCN+ LK  +      E +  +I  ++   L+    + +S FGST
Sbjct:  252 LTTDGAPAMCGHRSGLVARMRERMREENVT-GELTAYHCIIHQESLCGKALKMEHVMSTITRAVNLIRARGLNHRQFKAFLGELDTEYGELPYHTEVRWLSQGKVLQRCFELREGICLFIVNKGKDTTELRDETFLCEMAFLCDITSHLNVMNLQLQGRGRVISDMYSTVQVFKTKLSLWETHMRKENLSHFPSCQTMKEKLSTAVFPTAQFADKL---------------------NILAADFRLDVESAPPNLQMELIKLQCNDTLKEKYDRVGAAE-FARFI-PDKMAELRIPAAQTLSMFGST 534          

HSP 2 Score: 114.005 bits (284), Expect = 2.559e-71
Identity = 60/152 (39.47%), Postives = 95/152 (62.50%), Query Frame = -1
Query: 2484 IKNIKKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERI----QQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2927
            +K+ + +F+ +   S   VKAS+ VA  + K  +PF++GEF+K C+  V + V PDK ++ S++SLS  T+   I    D++   L+E++    + F AYSLA DESTD SD +QL++FIRGV  S  +T+++L L  L  TT G D++  +
Sbjct:   87 LKSQQALFTIAKSQSGAAVKASFIVAEEVEKSARPFTEGEFIKNCMLKVCDAVCPDKRQLFSNVSLSRNTVAERI----DQLSTNLKEQLVGKGKDFIAYSLAVDESTDTSDIAQLSIFIRGVDSSLSITEELLALRPLHGTTTGQDLYEEV 234          
BLAST of SMED30027226 vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.608 bits (527), Expect = 3.462e-70
Identity = 133/373 (35.66%), Postives = 195/373 (52.28%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKK-----FNSSQTINFA--KCADEI*KLPAEFTHRFSELTKYDKTFEIFSSPF-QVDVFTVPEAL-----------QMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKF-----HASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A AM G++ G    F+ + +     P +    HC+IH Q +CA+V   +HVM  V+K +N IRS A QHR FK  +DELS+EYGD++  T++RWLSRG  L+ F  L  EI+ FM  +    S L D  W+LDL FL ++T  +NHLN+ELQG+D    +  + + AF+ KL +F +QL+   + HFP ++       ++S  +N A  K +  I +L  EF  RF +  + +      ++PF QVDV +  E L           +MEI+ LQ N+ L   H++      +   +  E+Y  +     KI   FGSTY+CE  FS M F        LTD +L+  LR A +    D   L    + Q  H
Sbjct:  252 GAPAMTGRHVG----FIAQCKNDPDFP-KFLHYHCIIHQQAICAKVTGFDHVMTPVVKIINSIRSKAKQHRMFKMLMDELSAEYGDLLLHTEIRWLSRGRILQRFLSLLGEIKEFMKSKGEDTSLLEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVTNPFMQVDVTSTAEQLSALFTLNAGDVEMEILTLQ-NDLLLKAHQSAPN---FWCLVDQEKYSGVCTAAMKIACFFGSTYLCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSPDYNALVSSMQCQTSH 615          

HSP 2 Score: 79.7221 bits (195), Expect = 3.462e-70
Identity = 51/154 (33.12%), Postives = 83/154 (53.90%), Query Frame = -1
Query: 2472 KKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVI------EDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVY 2915
            +  F+   + S N  +AS+  A  + K  KPFSDGE +KE +  V       E   PD    +S + L + TI R + ++ + +   L   +   + +S+  DES D + T+QL +FIR V++ F   +++L LL LK TTRG D++  +KN +
Sbjct:   82 RTFFTRPAKKSHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIFKDEKYAPDVISTLSDVQLGASTIARRVTSLSENLTEKLDRDLAACRWFSVQCDESVDSASTAQLMIFIRMVFEDFSTKEELLTLLPLKTTTRGVDIYTTVKNFF 235          
BLAST of SMED30027226 vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 7.011e-65
Identity = 133/373 (35.66%), Postives = 191/373 (51.21%), Query Frame = -2
Query: 1385 SASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLK---KFNSSQTINFAKCADE----I*KLPAEFTHRFSELTKYDKTFEIFSSPF-QVDVFTVPEAL-----------QMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKMKF-----HASLTDENLESQLRCATTKIDVDLKTLSDRKEKQIFH 2431
             A AM+G+  G    F+   +     P +    HC+IH Q LCA+V+   HVM  V+K +N IRS A QHR FK  L+E+S+EYGD++  T++RWLSRG  L  F  L  EI+ FM  +   VS L D  W LDL FLV+IT K+N LN +LQG+    +   + + AF+ K+  F + L+   + HFP ++   K N+S +  F K A++    I +L  EF +RF +L + +      S+PF   D     E L           ++EII LQ +  LK+     +   + +T    E+Y  +     K+ S FGSTY+CE  FS M F        LTD +L   L  A +    D  TL +  + Q  H
Sbjct:  252 GAPAMVGRQTG----FIAHCKRDPDFP-KFLHYHCIIHQQALCAKVIGFGHVMTPVVKIINNIRSKAKQHRIFKVLLEEMSAEYGDLLLHTEIRWLSRGRVLHRFLSLLREIKEFMQSKGEDVSLLEDTEWTLDLAFLVDITGKLNLLNCQLQGKGKTVVDMISALNAFKAKMNAFSADLQRKKVLHFPSVQSVLKDNASASETFEKVAEKYIEVINRLGQEFENRFCDLHQLEPCVFFISNPFMNGDTTCFAEQLSATFNLDAGQVEIEIITLQNDLHLKAYQAAPNFWRLVDT----EKYSGVCTAAMKVASLFGSTYLCESAFSDMNFIKNKHRTRLTDAHLRDSLTVAVSSYTPDYNTLVNSMQCQSSH 615          

HSP 2 Score: 75.0998 bits (183), Expect = 7.011e-65
Identity = 51/154 (33.12%), Postives = 84/154 (54.55%), Query Frame = -1
Query: 2472 KKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHK------MISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVY 2915
            +  F+   + S    +AS+     + KK K F+DGE VKE +  +   V  D+         +S + L + T+ R ++A+   +V  L + + + K +SL  DES D S T+QL VFIR V++ F   +++L LL LK TTRG D+++ +K  +
Sbjct:   82 QSFFTRPTKNSQKASEASFRATHFLIKKKKAFTDGEVVKEAMLLIANTVFKDEKNGSDLISTLSDVQLGASTMARRVSAMSSNLVDQLEQDLAKCKWFSLQCDESVDSSSTAQLLVFIRMVFNDFSTKEELLTLLPLKTTTRGVDIYNTVKEFF 235          
BLAST of SMED30027226 vs. Planmine SMEST
Match: SMESG000018070.1 (SMESG000018070.1)

HSP 1 Score: 223.016 bits (567), Expect = 1.821e-101
Identity = 107/126 (84.92%), Postives = 110/126 (87.30%), Query Frame = -2
Query: 2066 LWIASASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNP 2443
            L    A AMIGKNK TVK FM ELEATSV PSEIFVIHCLIH QNLCAQVLSMNHVM VVIKTVNY+RSHALQHRK KAYL ELSSEYGDIVYFTKVRWLSRGTCLK  FELR++IEN MAEERNP
Sbjct: 1021 LTTDGAPAMIGKNKRTVKFFMDELEATSVKPSEIFVIHCLIHQQNLCAQVLSMNHVMDVVIKTVNYVRSHALQHRKLKAYLGELSSEYGDIVYFTKVRWLSRGTCLKRIFELRVKIENSMAEERNP 1146          

HSP 2 Score: 163.31 bits (412), Expect = 1.821e-101
Identity = 92/149 (61.74%), Postives = 103/149 (69.13%), Query Frame = -1
Query: 2481 IKNIKKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2927
            +K  +K+FSSSLQL+SNIVKASYSV +LIAKKMKPF D E +KECLAAV+EDVM DKHKM SSI               +EIV+TLRER QQ K YSL F+ESTDISD SQL VFIRGV DSFGVT              G+DVF  IK
Sbjct:  886 LKYQQKIFSSSLQLASNIVKASYSVTLLIAKKMKPFLDRECIKECLAAVLEDVMLDKHKMSSSI---------------NEIVMTLRERFQQSKVYSLVFNESTDISDASQLVVFIRGVNDSFGVT--------------GEDVFRAIK 1005          

HSP 3 Score: 26.1794 bits (56), Expect = 1.821e-101
Identity = 12/21 (57.14%), Postives = 13/21 (61.90%), Query Frame = -3
Query: 2437 CFSRYKKCLSCNSLDLENIYG 2499
             F   KKCLSCN L LE + G
Sbjct: 1000 VFRAIKKCLSCNCLHLEKLSG 1020          
BLAST of SMED30027226 vs. Planmine SMEST
Match: SMESG000027812.1 (SMESG000027812.1)

HSP 1 Score: 177.178 bits (448), Expect = 8.152e-88
Identity = 85/96 (88.54%), Postives = 85/96 (88.54%), Query Frame = -2
Query: 2156 LWIASASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTK 2443
            L    A AMIGKNK TVKLFM ELEATSV PSEIFVIHCLIH QNLCAQVLSMNHVM VVIKTVNYIRSHALQHRKFKAYL ELSSEYGDIVYFTK
Sbjct:  173 LTTDGAPAMIGKNKRTVKLFMDELEATSVKPSEIFVIHCLIHQQNLCAQVLSMNHVMDVVIKTVNYIRSHALQHRKFKAYLGELSSEYGDIVYFTK 268          

HSP 2 Score: 163.696 bits (413), Expect = 8.152e-88
Identity = 92/149 (61.74%), Postives = 103/149 (69.13%), Query Frame = -1
Query: 2481 IKNIKKMFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2927
            +K  +K+FSSSLQL+SNIVKASYSV +LIAKKMKPF D E +KECLAAV+EDVM DKHKM SSI               +EIV+TLRER QQ K YSL F+ESTDISD SQL VFIRGV DSFGVT              G+DVF  IK
Sbjct:   38 LKYQQKIFSSSLQLASNIVKASYSVTLLIAKKMKPFLDRECIKECLAAVLEDVMLDKHKMSSSI---------------NEIVMTLRERFQQSKVYSLVFNESTDISDASQLVVFIRGVNDSFGVT--------------GEDVFRAIK 157          

HSP 3 Score: 26.1794 bits (56), Expect = 8.152e-88
Identity = 12/21 (57.14%), Postives = 13/21 (61.90%), Query Frame = -3
Query: 2437 CFSRYKKCLSCNSLDLENIYG 2499
             F   KKCLSCN L LE + G
Sbjct:  152 VFRAIKKCLSCNCLHLEKLSG 172          
BLAST of SMED30027226 vs. Planmine SMEST
Match: SMESG000027812.1 (SMESG000027812.1)

HSP 1 Score: 177.563 bits (449), Expect = 5.514e-75
Identity = 85/96 (88.54%), Postives = 85/96 (88.54%), Query Frame = -2
Query: 2156 LWIASASAMIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTK 2443
            L    A AMIGKNK TVKLFM ELEATSV PSEIFVIHCLIH QNLCAQVLSMNHVM VVIKTVNYIRSHALQHRKFKAYL ELSSEYGDIVYFTK
Sbjct:  104 LTTDGAPAMIGKNKRTVKLFMDELEATSVKPSEIFVIHCLIHQQNLCAQVLSMNHVMDVVIKTVNYIRSHALQHRKFKAYLGELSSEYGDIVYFTK 199          

HSP 2 Score: 120.168 bits (300), Expect = 5.514e-75
Identity = 68/117 (58.12%), Postives = 74/117 (63.25%), Query Frame = -1
Query: 2481 MKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2831
            MKPF D E +KECLAAV+EDVM DKHKM SSI               +EIV+TLRER QQ K YSL F+ESTDISD SQL VFIRGV DSFGVT              G+DVF  IK
Sbjct:    1 MKPFLDRECIKECLAAVLEDVMLDKHKMSSSI---------------NEIVMTLRERFQQSKVYSLVFNESTDISDASQLVVFIRGVNDSFGVT--------------GEDVFRAIK 88          

HSP 3 Score: 26.1794 bits (56), Expect = 5.514e-75
Identity = 12/21 (57.14%), Postives = 13/21 (61.90%), Query Frame = -3
Query: 2437 CFSRYKKCLSCNSLDLENIYG 2499
             F   KKCLSCN L LE + G
Sbjct:   83 VFRAIKKCLSCNCLHLEKLSG 103          
BLAST of SMED30027226 vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 173.326 bits (438), Expect = 9.145e-67
Identity = 121/350 (34.57%), Postives = 173/350 (49.43%), Query Frame = -2
Query: 1394 MIGKNKGTVKLFMYELEATSVNPSEIFVIHCLIH*QNLCAQVLS-MNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI*KLPAEFTHRFSELTKYDKTFEI--FSSPFQVDVFTVPEALQMEIINLQCNNKLKSVHKTTSKIEIYNTYITAERYPNLK*FGQKIVSAFGSTYVCEVFFSKM-----KFHASLTDENLESQLRCATTKIDVDLKTLSDRKEKQ 2419
            M G   G V     EL+  + +   +F  HC+IH ++LC  +LS M  +M  +I TVNYIR H L+HR+FK +L E+ SE+ D++Y++ VRWLSRG  L+  + L                       +  L F+V+IT  +N LN  LQG+  L       I AF+ KL L +  +   NL HF   K             AD        F   F     ++K+ EI  F +PF VD+  VP  LQMEI+ LQ N  LK+     +    Y      ++Y  L  F +K++ AFGSTY+CE  FS M     KF + LTDE+L + +R  T+ +  D+  L+  K+ Q
Sbjct:  229 MCGSKTGVVGRICAELQNIACDNPMVF--HCIIHQESLCCTILSSMKDIMNTLISTVNYIRRHGLKHRQFKKFLKEIDSEFNDVIYYSAVRWLSRGAVLRRKYYLTA---------------------IGSLAFMVDITTYLNELNLNLQGKGKLLADLFCDINAFEAKLCLLKKHMIEENLTHFICCKSVP----------ADGWQTQKGTFFMDF-----HNKSSEIRLFLNPFNVDINDVPNELQMEILQLQHNEILKNAFLLENIQHFYRCL--PKQYEGLISFAKKMIVAFGSTYICEQEFSAMSFRKNKFSSQLTDEHLNASIRICTSGLKADIDNLAKDKQPQ 538          

HSP 2 Score: 102.064 bits (253), Expect = 9.145e-67
Identity = 54/131 (41.22%), Postives = 80/131 (61.07%), Query Frame = -1
Query: 2481 VKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIK 2873
            +KAS +    I  K +PF+D EFVK CL AV E + P+   +   ISLS++T  R +  I   +   L+ + + F  YSLA DES DI+DT+QL +FIRG+   F V +++ +L +LKD   G+D+F  +K
Sbjct:   76 LKASLTAQQSIFMK-RPFTDLEFVKRCLVAVAEKLCPETKTLFQDISLSARTCARRVEEIGTNLFEQLKCKAKSFDCYSLAMDESIDITDTAQLIIFIRGIDGDFNVHEELTSLCSLKDAITGNDLFIKVK 205          
BLAST of SMED30027226 vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.284e-46
Identity = 60/139 (43.17%), Postives = 94/139 (67.63%), Query Frame = -1
Query: 2484 SSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPDKHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDISDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGI 2900
            SS+Q ++   KAS  +A  I K  KPFS+GEFVK+C+  + + + P+  K   +ISLS +T+ R I +I +++   L  +I+ F+ +S+A DESTDI DT+QL +FIRG+ D F  T+++L++ +LKDTT G D+F  +
Sbjct:  612 SSIQEAA--TKASLVIAHKIVKHNKPFSEGEFVKDCVLEIADIICPENKKKFENISLSRRTVVRRIESIAEDLSDQLLNKIKTFQWFSIALDESTDIQDTAQLLIFIRGIDDKFIATEELLSMEHLKDTTTGQDLFDNL 748          

HSP 2 Score: 88.1965 bits (217), Expect = 2.284e-46
Identity = 58/185 (31.35%), Postives = 97/185 (52.43%), Query Frame = -2
Query: 1889 SASAMIGKNKGTVKLFMYELEATSVNPS-EIFVIHCLIH*QNLCAQVLSMNHVMYVVIKTVNYIRSHALQHRKFKAYLDELSSEYGDIVYFTKVRWLSRGTCLK*FFELRMEIENFMAEERNPV---SNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLNIYACNHIKAFQTKLILFESQLR 2431
             A ++ GKN G +      ++  +++P   I  +HC+IH ++LC  VL  N ++ ++               +FK++L++L S++ D++Y T VRWLS G  LK  + L+ EI  F+  +   V   + +    WL D  F V+I +K+N LN +LQG+          +K+FQ KL LF   L+
Sbjct:  769 GAPSLTGKNVGLITKIKDHVK--NLHPDHTIIPLHCIIHQESLCKSVLDFNTLLTLL---------------QFKSFLEDLESDHSDVLYHTNVRWLSLGKVLKRVWNLKDEIVLFLEMKDITVEFTTQMKTSEWLSDFSFAVDILDKLNELNVKLQGKGVFAHELFAEVKSFQVKLQLFSRHLK 936          
The following BLAST results are available for this feature:
BLAST of SMED30027226 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF2IRD23.089e-7541.07GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD23.144e-7541.07GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD2B1.167e-7441.07GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
GTF2IRD2B1.387e-7441.07GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
EPM2AIP18.546e-4630.35EPM2A interacting protein 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of SMED30027226 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027226 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027226 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL928808.13.470e-7034.70pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR392001.35.652e-4729.62pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
back to top
BLAST of SMED30027226 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000016563.12.453e-7134.46pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
spag14.182e-6332.20sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000028445.13.518e-4328.77general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of SMED30027226 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtf2ird28.996e-6837.62GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
Epm2aip14.355e-4428.90EPM2A (laforin) interacting protein 1 [Source:MGI ... [more]
Epm2aip14.355e-4428.90EPM2A (laforin) interacting protein 1 [Source:MGI ... [more]
Zbed55.982e-3427.30zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym63.262e-2025.68zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30027226 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86UP8|GTD2A_HUMAN1.392e-7441.07General transcription factor II-I repeat domain-co... [more]
sp|Q6EKJ0|GTD2B_HUMAN5.166e-7441.07General transcription factor II-I repeat domain-co... [more]
sp|A4IFA3|GT2D2_BOVIN4.582e-7339.29General transcription factor II-I repeat domain-co... [more]
sp|Q99NI3|GT2D2_MOUSE5.494e-6737.62General transcription factor II-I repeat domain-co... [more]
sp|Q7L775|EPMIP_HUMAN3.784e-4530.35EPM2A-interacting protein 1 OS=Homo sapiens OX=960... [more]
back to top
BLAST of SMED30027226 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5C6NWF31.883e-9940.85General transcription factor II-I repeat domain-co... [more]
A0A3S2LTQ64.468e-9941.34Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
A0A498N0V35.737e-9940.28General transcription factor II-I repeat domain-co... [more]
A0A2D0RR351.060e-9841.18general transcription factor II-I repeat domain-co... [more]
A0A4U5TU713.047e-9841.46General transcription factor II-I repeat domain-co... [more]
back to top
BLAST of SMED30027226 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030525.12.095e-9642.32pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000035253.19.209e-9137.22general transcription factor II-I repeat domain-co... [more]
ENSAMXT00000037725.18.070e-8436.44pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000039226.14.103e-7237.43pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052542.11.269e-6935.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30027226 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027226 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027226 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027226 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027093.14.481e-8238.53general transcription factor II-I repeat domain-co... [more]
ENSORLT00000044825.19.226e-7936.86general transcription factor II-I repeat domain-co... [more]
ENSORLT00000028655.12.559e-7134.20pep primary_assembly:ASM223467v1:8:18412528:184146... [more]
ENSORLT00000033470.13.462e-7035.66pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000046355.17.011e-6535.66pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
back to top
BLAST of SMED30027226 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018070.11.821e-10184.92SMESG000018070.1[more]
SMESG000027812.18.152e-8888.54SMESG000027812.1[more]
SMESG000027812.15.514e-7588.54SMESG000027812.1[more]
SMESG000045419.19.145e-6734.57SMESG000045419.1[more]
SMESG000037770.12.284e-4643.17SMESG000037770.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027226 ID=SMED30027226|Name=SMED30027226|organism=Schmidtea mediterranea sexual|type=transcript|length=3848bp
ATTTAGACAATCAAACATTTAAAAATTGAAAAATTAATTTTAAGTAAAAT
TAATTTTATAAAAAATTATTTGGCTCATGAATAATAACTCGAAAAATCCA
TTTATATCTGATGGGGATAGTTATGTTTACGATTCTGATCATTCTGCAAA
TGATGAAAATATGTCTATTTCTGGAACAGCAATGAATTTTTCTGACGAAG
GGCAGTATTCTATCGTTAGAAATGAAGTTAGAAGTACTTGGCCTAAAAGA
AGACCAAAGTTATTAATATTTTATCAAATTTTATTTAAAGATAAATTTAA
ATTAAAAACCGCAAAATTTCTAAAAAAGTTCTTCATAGCACTCTTACATT
ACTTTCAAAAACTTATTGAAATCCCAAAAGCTCTGTTAGCTCATATCATT
TGTCGTCTTAATATTATTATTGTCAACATAACTAATAAAAATCTAATGAA
CTTTTATCTCGAATGTAAATTCTATAAATGGTTAGAATATTATATTAAAA
ATAATTATGCTCTAATGACTAACATTGTTTTCCCAAAATTTATAAAAAAT
CCCAAATTTTTTACACAATCCAAAATTTGCAAAATTTGTGTTGTCTGGAA
AAGACGAAAAACTCATCTGGCTTTTTAAAAGTTTGCAAAATTTTTCTAAA
TATATTTGTGAGTATTTTTGTTTGATGAAATTTTGACAAACTGCAAAGAT
TATGACGTAAGCAGCTCAAACAAGATCAAGATTTTGGTTTTTGAAATATG
GCTTTAAAGGAGTTTTTGATTTTGGGCAATTATCGATTTCTTAACCAATT
ATAATTAATCATACTCAAACATTTATCCAATGAAATTCTAAAATACATAA
TAATATTACCAAGCTCCATTCATACAATAGATCAGTGTTACTTAACCCGT
GGCACTCACCACTGAGGCTGCCAAAGAAGTTTCTAAATTTTCGTTGGAGA
CTTCAAGTTGAAAATGGAAATTTTGCAAACTTTACTTGATTAAATCATTT
TTGAAAAGGAAAAAATAATAATTTTGACTGAATTACAATATCTCCAACAA
TTGAATGCATCTTTTGAAAGGGATATATTAATAAAGTTCAGAAATGGATA
CTGAATCCATTTCTATTTAATCTAGTACAGGCCTGTGCAAAACCAAATCG
CTTTGCGGGCCAATCTTTTAATCCAAAAATTTCAACGGGCTATATATTAT
ATGAAAACCTCAATTTTTATTGAAACATTTATTTGAATTATTTCAGTACA
TAGATTTATTTGAACTATTCCAAGAAAAACATTTATTTTTATATTTACAG
TAGATTTTTTTTATTGTTTCAAGAACATTTTTATTGAACCATTTATTTTT
ATTAATTCAGAACACTTAAGTATAACATTTATTAATGGAATATTTGCTTT
TCTTTGCGATCGCTCAATGTTTTTAAATCTACATCAATTTTGGTAGTTGC
ACATCGTAATTGGCTTTCAAGGTTTTCATCTGTTAATGAAGCGTGAAATT
TCATTTTTGAAAAAAAGACTTCACAAACATATGTAGATCCGAAGGCGCTT
ACAATTTTTTGACCAAATCATTTTAAGTTAGGATACCTTTCTGCTGTTAT
ATACGTGTTGTAGATCTCAATTTTTGATGTCGTTTTATGAACACTCTTCA
ACTTATTGTTACACTGCAAATTGATTATTTCCATTTGTAAAGCTTCTGGA
ACAGTGAAAACGTCAACTTGAAAAGGTGAAGAAAATATCTCAAACGTTTT
GTCATATTTTGTAAGTTCTGAGAAACGATGAGTAAATTCAGCTGGAAGTT
TTCAAATTTCATCAGCGCACTTTGCAAAATTAATAGTTTGACTGCTATTA
AATTTTTTTAATAACGGAAAATGGTGAAGATTGTTATTTCTAAGTTGGGA
CTCAAATAAAATTAGCTTGGTTTGGAATGCTTTTATATGATTACAAGCAT
AAATATTTAAATTATCTTGCCCCTGTAACTCCTTGTTTAGATGGTTAATT
TTTTCGGTTATATTTACTAAGAAACACAGGTCCAACAACCACATTTCGTC
ATTTAAATTTGAAACTGGATTTCTCTCTTCAGCCATAAAATTTTCTATTT
CCATCCGTAATTCAAAAAATCATTTTAAACATGTTCCGCGACTTAACCAT
CTAACTTTGGTAAAATAAACAATATCGCCATATTCCGAACTTAATTCGTC
AAGGTATGCTTTGAACTTGCGATGCTGAAGAGCATGTGATCGAATATAGT
TAACTGTTTTTATTACCACATACATGACATGGTTCATGGACAATACCTGG
GCACATAAATTTTGCTAATGTATCAAACAGTGTATTACAAATATTTCACT
GGGGTTAACAGATGTTGCTTCAAGTTCATACATAAACAACTTTACAGTTC
CTTTATTTTTACCAATCATAGCAGAAGCAGAAGCAATCCATAAATATTCT
CTAAATCTAAAGAATTACAGGATAAACATTTTTTATACCGTGAAAAACAT
CATCTCCTCTAGTGGTGTCTTTTAAATTTAAAAGATTTAACATATCTTGT
GTCACTCCGAAAGAATCGTAAACTCCACGAATAAATACAGCAAGTTGTGA
TGTATCTGAAATATCTGTGCTTTCGTCGAAAGCTAGAGAATATGCTTTGA
ATTGTTGAATCCGCTCTCGTAAAGTCACCACTATTTCATCTAAAATAGCA
TTAATGTGACGACAAATAGTTTGACTAGACAAACTAATGCTTGAAATCAT
TTTATGTTTATCTGGCATAACATCTTCTATAACAGCTGCCAAACATTCTT
TTACAAATTCTCCGTCCGAAAATGGTTTCATTTTCTTAGCGATTAACATT
GCGACAGAGTAGCTTGCTTTAACAATATTAGAAGATAGTTGTAGTGAAGA
ACTAAACATTTTCTTGATATTTTTTATCACTTAAAACTACGCAACTTCAT
ATCCTAACTAAAACAAAGCCAAACTAAAAATGTTTTTCAATAACTGTCGG
CTTCTTTAGTTATATTTTTCTGGCAAAACCTACTATATAAATATTTTTGA
ATTATTTAAATTTTTTACTTATGAATAAATATATATGCACAGAAAACGGA
TTTTTCTGTCCACTAAAAAACATAATAAAAACTTTTTAATATCGAATTTT
GTAGTCAATACTTTTTCAAAAAAGTCTGTATTTAATAATTTTAGTAGATT
TTGTAATATATTTATTTTTTATAGATTCTGTAAAAAAAATTAAAGCAAAT
AATAATCATGCCACGGGCCTCGGCTTGGCCACGCCTGATCTAGATCCAAT
GAAAGACAGCGATAGAACAATTCTGGTGTACACAGTTAGAACCTTATCCA
CGGCTGACAAAAGCAGCATTGCAGACACTTTTACAATTTGACACAACTTA
CCTATATGGAATTGAATTTTCATCACTTTTGCACACATACAAAAGCCAGG
GTTGATTTAAAAGCAAGTCATGACTTATGTGTGACTAGAGCTGCCACCTC
TCAAGATTTCAGAGTAAGTCTCAAGACTCAAGACTTGAAAACCGAATCTC
AAGATTTTATAAATTTCGCATTTCGGGTATATTTCTTTCTGGGTAAAATA
ATGTACCGTTTAAGTTGGTGATGATTTCAAAATTAAATAAATGTTTTAAA
TTTTAAAGCTCAGAACGGGTTAATTTGGTTGTACTTAGATTTAAGTTTTT
TATTTTATATTTTGGGTAGCCCCCAGTGACTGAACTTTGAATATTGTCTT
TGTTTTTTATTATAATATTACGCTTATATTTCATTCGTTAGTTCATTGTA
TTGCTATTTTGTACACTCTGAATTTACCCAAATTTGGCCATTTTTCGT
back to top

protein sequence of SMED30027226-orf-1

>SMED30027226-orf-1 ID=SMED30027226-orf-1|Name=SMED30027226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MNNNSKNPFISDGDSYVYDSDHSANDENMSISGTAMNFSDEGQYSIVRNE
VRSTWPKRRPKLLIFYQILFKDKFKLKTAKFLKKFFIALLHYFQKLIEIP
KALLAHIICRLNIIIVNITNKNLMNFYLECKFYKWLEYYIKNNYALMTNI
VFPKFIKNPKFFTQSKICKICVVWKRRKTHLAF*
back to top

protein sequence of SMED30027226-orf-2

>SMED30027226-orf-2 ID=SMED30027226-orf-2|Name=SMED30027226-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MFSSSLQLSSNIVKASYSVAMLIAKKMKPFSDGEFVKECLAAVIEDVMPD
KHKMISSISLSSQTICRHINAILDEIVVTLRERIQQFKAYSLAFDESTDI
SDTSQLAVFIRGVYDSFGVTQDMLNLLNLKDTTRGDDVFHGIKNVYPVIL
*
back to top

protein sequence of SMED30027226-orf-3

>SMED30027226-orf-3 ID=SMED30027226-orf-3|Name=SMED30027226-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MEIENFMAEERNPVSNLNDEMWLLDLCFLVNITEKINHLNKELQGQDNLN
IYACNHIKAFQTKLILFESQLRNNNLHHFPLLKKFNSSQTINFAKCADEI
*
back to top