DUF1619 domain-containing protein

Overview
NameDUF1619 domain-containing protein
Smed IDSMED30027220
Length (bp)1620
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF1619 domain-containing protein (SMED30027220) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF1619 domain-containing protein (SMED30027220) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF1619 domain-containing protein (SMED30027220) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF1619 domain-containing protein (SMED30027220) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027220

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027220h1SMcG0008598 SmedASXL_011949SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027220h1SMcG0008598 dd_Smed_v6_14210_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30027220h1SMcG0008598 Contig34213uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027220h1SMcG0008598 Contig34213newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30027220h1SMcG0008598 dd_Smed_v4_14210_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF1619 domain-containing protein vs. Ensembl Xenopus
Match: ap3s2 (adaptor related protein complex 3 subunit sigma 2 [Source:Xenbase;Acc:XB-GENE-5734699])

HSP 1 Score: 51.9878 bits (123), Expect = 3.650e-8
Identity = 70/265 (26.42%), Postives = 112/265 (42.26%), Query Frame = 2
Query:  743 GILSPNVVCNLGPCASLVKSGCNNIVTGANMTI--SGESGITSVNINLQIANV---IGQFTHTSNVVFTKTGFNPENSQYSGNPGYLTGKPLRA---------IYNNNLLKDWLI---PAGDDCVT--GSRTKINFGYNMEIDCXXXXXXXXXXXXXXX------XXXXXYIGPFGNSAASDS-DQVPVIXXXXXXXXXXALKKQF-----IYVVYARNGTLTLPQNKVIGVKVTNVYSDIPQGVNNS-----WVSISVSFIDAS 1429
            GI  P+V+ +  P        C ++V G +  I  + +  IT+VN  L +  +   +G    +  V F + G  P  S  SGNPGY+ G P+ A         + N N      I    AG +C+T  G+R  + FGYNM   C         V ++           P Y+  FGNS   +  D VP+   +     S+    +      + V + + G+L  PQ +++ V     Y+ + Q  N+       +S SV+F+D S
Sbjct:  406 GIFIPSVIDHYVPVLDNTTELCKDVVLGGSYQILYTEQGAITAVNAFLILGVINATLGTVQQSFKVSFVQDGTFP--SLLSGNPGYIVGLPVIAGFKEPQYPFLVNTNRFAQLTILRSSAGQNCLTEEGNRAAVLFGYNMVSGCKLQYPVPCQVAATAILNVLRGQQFPEYVASFGNSQPQNVLDWVPITVVTSTLPQSATADCKIPVSLDLEVRWTKYGSLVNPQAQIVNVTEKITYAFV-QNTNSGSGNVLQISTSVTFLDVS 667          

HSP 2 Score: 26.5646 bits (57), Expect = 3.650e-8
Identity = 18/60 (30.00%), Postives = 28/60 (46.67%), Query Frame = 1
Query:  442 TTYSYGSPIYTFQFNGATPSVGYLSVAQPSASDGSCIFGLPIQYLQNQAVTCSYTTDCSN 621
            T Y YGSP+ T        +  YLS+  P  +   C    P+ +L +Q  TC++    +N
Sbjct:  323 TRYEYGSPLLT--------ASAYLSLPAPLGTK-ECTDRNPVGFLVSQDSTCTWNVSLNN 373          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A267GY02 (DUF1619 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010888g1 PE=4 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.804e-10
Identity = 34/85 (40.00%), Postives = 43/85 (50.59%), Query Frame = 2
Query:   53 LLNFLISGIVSDFFIT-------NDGVCTCDYNANVCDIGCCCDTSCSALQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKIN 286
            L NF+    V  FF+        N G CTCD   + CD+ CCCD  CS+  IQ F+  +   S L   C PS ++F N T Y IN
Sbjct:   27 LRNFVFQATVILFFVAIKSIAQNNVGPCTCDLTQSACDVNCCCDADCSSADIQVFSGCSNDYSFLQT-CFPSSIMFRNYTPYVIN 110          

HSP 2 Score: 40.0466 bits (92), Expect = 3.804e-10
Identity = 40/122 (32.79%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  304 CIYSDNYTLRNFYYAPNLTNFKXXXXXXXXXXXXXXXXXALS-VLNYTTYSY----GSPIYTFQFNGATPSVGYLSVAQPSASDGS--CIFGLPIQYLQNQAVTCSYTTD---CSNLPGVDL 639
            CIY DN+T RN+Y  P + N   T  ++ +   S  + SA++   ++++YS     G+PI T       PS  YL   QPSA  GS  C +  P  +L + + +C+       C+  PG+DL
Sbjct:  119 CIYYDNFTARNYYTNPQIENRNVTKVALRALDYSGYNLSAINPATDFSSYSRIYTAGNPILTVYNASGGPS--YL--FQPSAQSGSQFCGYSSPASFLTSGSSSCTRVISAETCATDPGIDL 236          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A1I8G7C7 (DUF1619 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.642e-10
Identity = 34/85 (40.00%), Postives = 43/85 (50.59%), Query Frame = 2
Query:   53 LLNFLISGIVSDFFIT-------NDGVCTCDYNANVCDIGCCCDTSCSALQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKIN 286
            L NF+    V  FF+        N G CTCD   + CD+ CCCD  CS+  IQ F+  +   S L   C PS ++F N T Y IN
Sbjct:    7 LRNFVFQATVILFFVAIKSIAQNNVGPCTCDLTQSACDVNCCCDADCSSADIQVFSGCSNDYSFLQT-CFPSSIMFRNYTPYVIN 90          

HSP 2 Score: 40.0466 bits (92), Expect = 5.642e-10
Identity = 40/122 (32.79%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  304 CIYSDNYTLRNFYYAPNLTNFKXXXXXXXXXXXXXXXXXALS-VLNYTTYSY----GSPIYTFQFNGATPSVGYLSVAQPSASDGS--CIFGLPIQYLQNQAVTCSYTTD---CSNLPGVDL 639
            CIY DN+T RN+Y  P + N   T  ++ +   S  + SA++   ++++YS     G+PI T       PS  YL   QPSA  GS  C +  P  +L + + +C+       C+  PG+DL
Sbjct:   99 CIYYDNFTARNYYTNPQIENRNVTKVALRALDYSGYNLSAINPATDFSSYSRIYTAGNPILTVYNASGGPS--YL--FQPSAQSGSQFCGYSSPASFLTSGSSSCTRVISAETCATDPGIDL 216          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A267E3Y3 (DUF1619 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010888g2 PE=4 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.306e-10
Identity = 34/85 (40.00%), Postives = 43/85 (50.59%), Query Frame = 2
Query:   53 LLNFLISGIVSDFFIT-------NDGVCTCDYNANVCDIGCCCDTSCSALQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKIN 286
            L NF+    V  FF+        N G CTCD   + CD+ CCCD  CS+  IQ F+  +   S L   C PS ++F N T Y IN
Sbjct:   27 LRNFVFQATVILFFVAIKSIAQNNVGPCTCDLTQSACDVNCCCDADCSSADIQVFSGCSNDYSFLQT-CFPSSIMFRNYTPYVIN 110          

HSP 2 Score: 39.2762 bits (90), Expect = 7.306e-10
Identity = 40/122 (32.79%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  304 CIYSDNYTLRNFYYAPNLTNFKXXXXXXXXXXXXXXXXXALS-VLNYTTYS----YGSPIYTFQFNGATPSVGYLSVAQPSASDGS--CIFGLPIQYLQNQAVTCSYTTD---CSNLPGVDL 639
            CIY DN+T RN+Y  P + N   T  ++ +   S  + SA++   ++++YS     G+PI T       PS  YL   QPSA  GS  C +  P  +L + + +C+       C+  PG+DL
Sbjct:  119 CIYYDNFTARNYYTNPQIENSNVTKVALRALDYSGYNLSAINPATDFSSYSSIYTAGNPILTVYNASGGPS--YL--FQPSAQSGSQFCGYSSPASFLTSGSSSCTRVISAETCATDPGIDL 236          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A1I8HT22 (DUF1619 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 5.279e-9
Identity = 28/62 (45.16%), Postives = 35/62 (56.45%), Query Frame = 2
Query:  101 NDGVCTCDYNANVCDIGCCCDTSCSALQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKIN 286
            N G CTCD   + CD+ CCCD  CS+  IQ F+  +   S L   C PS ++F N T Y IN
Sbjct:  260 NVGPCTCDLTQSACDVNCCCDADCSSADIQVFSGCSNDYSFLQT-CFPSSIMFRNYTPYVIN 320          

HSP 2 Score: 39.6614 bits (91), Expect = 5.279e-9
Identity = 40/122 (32.79%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  304 CIYSDNYTLRNFYYAPNLTNFKXXXXXXXXXXXXXXXXXALS-VLNYTTYS----YGSPIYTFQFNGATPSVGYLSVAQPSASDGS--CIFGLPIQYLQNQAVTCSYTTD---CSNLPGVDL 639
            CIY DN+T RN+Y  P + N   T  ++ +   S  + SA++   ++++YS     G+PI T       PS  YL   QPSA  GS  C +  P  +L + + +C+       C+  PG+DL
Sbjct:  329 CIYYDNFTARNYYTNPQIENSNVTKVALRALDYSGYNLSAINPATDFSSYSSIYTAGNPILTVYNASGGPS--YL--FQPSAQSGSQFCGYSSPASFLTSGSSSCTRVISAETCATDPGIDL 446          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A267H714 (DUF1619 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010888g3 PE=4 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.293e-9
Identity = 33/85 (38.82%), Postives = 43/85 (50.59%), Query Frame = 2
Query:   53 LLNFLISGIVSDFFIT-------NDGVCTCDYNANVCDIGCCCDTSCSALQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKIN 286
            L NF+    V  FF+        N G CTCD   + CD+ CCCD  CS+  IQ F+  +   S L   C P+ ++F N T Y IN
Sbjct:   26 LRNFVFQATVILFFVAIKSIAQNNVGPCTCDLTQSACDVNCCCDADCSSADIQVFSGCSNDYSFLQT-CFPTSIMFRNYTPYVIN 109          

HSP 2 Score: 36.1946 bits (82), Expect = 9.293e-9
Identity = 41/125 (32.80%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  304 CIYSDNYTLRNFYYAPNLTNFKXXXXXXXXXXXXXXXXXALSVLNYTT--------YSYGSPIYTFQFNGATPSVGYLSVAQPSASDGS--CIFGLPIQYLQNQAVTCSYTTD---CSNLPGVDL 639
            CIY DN+T RN+Y  P + N   T  ++ +   S  +   LS +N  T        Y+ G+PI T       PS  YL   QPSA  GS  C +  P  +L + + +C+       C+  PG+DL
Sbjct:  118 CIYYDNFTARNYYTNPQVENSNVTKVAVRALDYSGYN---LSAINPATDFSSYGNIYTAGNPILTVYNASGGPS--YL--FQPSALSGSQFCGYSSPASFLTSSSSSCTRVISAETCATDPGIDL 235          
BLAST of DUF1619 domain-containing protein vs. Planmine SMEST
Match: SMESG000002053.1 (SMESG000002053.1)

HSP 1 Score: 501.13 bits (1289), Expect = 9.576e-174
Identity = 281/294 (95.58%), Postives = 286/294 (97.28%), Query Frame = 2
Query:  719 TPEISHRVGILSPNVVCNLGPCASLVKSGCNNIVTGANMTISGESGITSVNINLQIANVIGQFTHTSNVVFTKTGFNPENSQYSGNPGYLTGKPLRAIYNNNLLKDWLIPAGDDCVTGSRTKINFGYNMEIDCXXXXXXXXXXXXXXXXXXXXYIGPFGNSAASDSDQVPVIXXXXXXXXXXALKKQFIYVVYARNGTLTLPQNKVIGVKVTNVYSDIPQGVNNSWVSISVSFIDASQTVFDVNAAVIRARSGRSVRDFLYLLYVENHSISAINFNKIYILLCLSFWLAKSFQI 1600
            T  ++     ++PNVVCNLGPCASLVKSGCNNIVTGANMTISGESGITSVNINLQIANVIGQFTHTSNVVFTKTGFNP NSQYSGNPGY+TGKPLRAIYNNNLLKDWLIPAGDDCVTGSRTKINFGYNMEIDCSFAVVNLASVNSSLTSSLPSYIGPFGNSAASDSDQVPVISSSENSNSSSALKKQFIYVVYARNGTLTLPQNKVIGVKVTNVYSDIPQGVNNSWVSISVSFIDASQTVFDVNAAVIRARSGRSVRDFLYLLYVENHSISAINFNKIYILLCLSFWLAKSFQI
Sbjct:  230 TGNLTSSGNFITPNVVCNLGPCASLVKSGCNNIVTGANMTISGESGITSVNINLQIANVIGQFTHTSNVVFTKTGFNPANSQYSGNPGYITGKPLRAIYNNNLLKDWLIPAGDDCVTGSRTKINFGYNMEIDCSFAVVNLASVNSSLTSSLPSYIGPFGNSAASDSDQVPVISSSENSNSSSALKKQFIYVVYARNGTLTLPQNKVIGVKVTNVYSDIPQGVNNSWVSISVSFIDASQTVFDVNAAVIRARSGRSVRDFLYLLYVENHSISAINFNKIYILLCLSFWLAKSFQI 523          

HSP 2 Score: 267.314 bits (682), Expect = 9.278e-117
Identity = 158/168 (94.05%), Postives = 159/168 (94.64%), Query Frame = 1
Query:  292 GSQMCIYSDNYTLRNFYYAPNLTNFKXXXXXXXXXXXXXXXXXALSVLNYTTYSYGSPIYTFQFNGATPSVGYLSVAQPSASDGSCIFGLPIQYLQNQAVTCSYTTDCSNLPGVDLYLTNTLLVASFPSAMLAYYSYDISLNNTGNLTSSGNFITECCL*PRALCITG 795
            GSQMCIYSDNYTLRNFYYAPNLTNFKSTFTSISSSPISYSSFSALSVLNYTTYSYGSPIYTFQFNGATPSVGYLSVAQPSASDGSCIFGLPIQYLQNQAVTCSYTTDCSNLPGVDLYLTNTLLVASFPSAMLAYYSYDISLNNTGNLTSSGNFIT     P  +C  G
Sbjct:   87 GSQMCIYSDNYTLRNFYYAPNLTNFKSTFTSISSSPISYSSFSALSVLNYTTYSYGSPIYTFQFNGATPSVGYLSVAQPSASDGSCIFGLPIQYLQNQAVTCSYTTDCSNLPGVDLYLTNTLLVASFPSAMLAYYSYDISLNNTGNLTSSGNFIT-----PNVVCNLG 249          

HSP 3 Score: 173.326 bits (438), Expect = 9.278e-117
Identity = 84/85 (98.82%), Postives = 84/85 (98.82%), Query Frame = 2
Query:   35 MFAKYLLLNFLISGIVSDFFITNDGVCTCDYNANVCDIGCCCDTSCSALQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKINN 289
            MFAKYLLLNFLISGIVSDFFITNDGVCTCDYNANVCDIGCCCDTSCS LQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKINN
Sbjct:    1 MFAKYLLLNFLISGIVSDFFITNDGVCTCDYNANVCDIGCCCDTSCSGLQIQSFTCSNTQISPLSYGCLPSEVLFGNNTSYKINN 85          
The following BLAST results are available for this feature:
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ap3s23.650e-826.42adaptor related protein complex 3 subunit sigma 2 ... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GY023.804e-1040.00DUF1619 domain-containing protein (Fragment) OS=Ma... [more]
A0A1I8G7C75.642e-1040.00DUF1619 domain-containing protein OS=Macrostomum l... [more]
A0A267E3Y37.306e-1040.00DUF1619 domain-containing protein (Fragment) OS=Ma... [more]
A0A1I8HT225.279e-945.16DUF1619 domain-containing protein OS=Macrostomum l... [more]
A0A267H7149.293e-938.82DUF1619 domain-containing protein (Fragment) OS=Ma... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002053.19.576e-17495.58SMESG000002053.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027220 ID=SMED30027220|Name=DUF1619 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1620bp
TTTAATATTCAAGTACATTGTTACTAACGACTCTATGTTTGCTAAATACC
TTTTATTAAATTTTTTAATATCGGGAATTGTGTCGGATTTTTTTATAACT
AACGATGGAGTCTGTACATGCGACTACAATGCAAATGTTTGTGATATAGG
ATGTTGTTGTGATACAAGTTGTTCAGCTTTACAAATACAATCCTTTACAT
GCTCTAATACACAAATAAGTCCTCTCTCTTATGGCTGCCTTCCATCTGAA
GTGTTATTTGGTAATAATACATCTTATAAAATTAACAATATGGTAGTCAA
ATGTGTATCTATAGTGATAATTACACGCTGAGGAACTTTTATTACGCTCC
CAACCTCACAAATTTTAAAAGCACTTTTACATCGATTTCGAGTTCCCCGA
TCAGCTACTCAAGCTTTTCAGCATTAAGTGTTTTGAATTACACTACTTAT
TCTTATGGTTCGCCTATCTATACATTTCAATTTAACGGCGCAACCCCTTC
TGTAGGCTATCTTTCGGTTGCTCAGCCTAGTGCCAGTGATGGATCTTGTA
TTTTCGGTCTCCCAATTCAGTACCTTCAGAACCAAGCAGTGACTTGTAGT
TACACAACAGACTGTAGCAACCTACCGGGAGTGGATTTGTATTTGACAAA
TACTCTGCTGGTTGCTAGTTTCCCTTCTGCAATGCTCGCTTACTATAGCT
ATGATATCAGCTTGAATAACACCGGAAATCTCACATCGAGTGGGAATTTT
ATCACCGAATGTTGTCTGTAACCTCGGGCCTTGTGCATCACTGGTGAAGA
GTGGGTGTAATAATATAGTCACTGGAGCAAATATGACCATCTCAGGAGAA
TCTGGCATTACTTCTGTCAATATCAATTTGCAAATAGCAAATGTCATCGG
CCAATTCACTCACACATCCAACGTTGTATTTACAAAAACAGGATTCAATC
CGGAAAATTCCCAGTATAGCGGAAACCCTGGATATCTCACAGGGAAACCG
CTCAGAGCCATTTATAACAACAACTTGTTAAAGGATTGGTTGATACCTGC
GGGAGATGATTGCGTAACGGGCTCCAGAACTAAAATTAATTTTGGATACA
ATATGGAAATTGACTGTTCTTTTGCTGTCGTCAATCTAGCCAGCGTGAAT
TCATCACTCACATCTTCATTGCCATCTTATATCGGTCCATTTGGCAACAG
TGCTGCCAGTGATTCCGATCAAGTGCCAGTTATCTCCTCCAGTGAAAATT
CAAACTCCTCATCTGCATTAAAAAAACAATTTATCTATGTCGTATACGCC
AGAAATGGAACTCTCACTCTGCCTCAAAATAAAGTGATCGGTGTCAAAGT
CACTAATGTATACTCAGATATTCCTCAAGGCGTCAATAATTCTTGGGTTT
CTATTTCTGTGAGCTTCATCGATGCGTCACAAACTGTATTTGATGTAAAT
GCCGCAGTAATTAGAGCGAGATCTGGGAGAAGCGTTAGAGATTTTCTCTA
CTTGCTTTATGTGGAGAATCATTCAATTAGTGCTATTAACTTTAACAAAA
TTTATATATTATTATGCCTCTCATTTTGGCTCGCTAAATCATTTCAAATA
TAATTTTATCAACATTAAAA
back to top

protein sequence of SMED30027220-orf-1

>SMED30027220-orf-1 ID=SMED30027220-orf-1|Name=SMED30027220-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MCIYSDNYTLRNFYYAPNLTNFKSTFTSISSSPISYSSFSALSVLNYTTY
SYGSPIYTFQFNGATPSVGYLSVAQPSASDGSCIFGLPIQYLQNQAVTCS
YTTDCSNLPGVDLYLTNTLLVASFPSAMLAYYSYDISLNNTGNLTSSGNF
ITECCL*
back to top

protein sequence of SMED30027220-orf-2

>SMED30027220-orf-2 ID=SMED30027220-orf-2|Name=SMED30027220-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=257bp
MTISGESGITSVNINLQIANVIGQFTHTSNVVFTKTGFNPENSQYSGNPG
YLTGKPLRAIYNNNLLKDWLIPAGDDCVTGSRTKINFGYNMEIDCSFAVV
NLASVNSSLTSSLPSYIGPFGNSAASDSDQVPVISSSENSNSSSALKKQF
IYVVYARNGTLTLPQNKVIGVKVTNVYSDIPQGVNNSWVSISVSFIDASQ
TVFDVNAAVIRARSGRSVRDFLYLLYVENHSISAINFNKIYILLCLSFWL
AKSFQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR040354Tectonic
IPR011677DUF1619
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011677Domain of unknown function DUF1619PFAMPF07773DUF1619coord: 38..107
e-value: 8.5E-12
score: 45.6
IPR040354TectonicPANTHERPTHR14611UNCHARACTERIZED DUF1619-CONTAININGcoord: 34..109
NoneNo IPR availablePANTHERPTHR14611:SF0TECTONICcoord: 34..109
NoneNo IPR availableTMHMMTMhelixcoord: 13..32